HHsearch results for GI: 254781095 and protein with PDBid: 2ipi_A

>2ipi_A Aclacinomycin oxidoreductase (aknox); anthracycline, flavoenzyme, twinning, MAD; HET: AKY FAD; 1.65A {Streptomyces galilaeus}
Probab=99.49  E-value=9.2e-14  Score=105.88  Aligned_cols=165  Identities=9%  Similarity=-0.037  Sum_probs=114.7

Q ss_pred             CCCCEEEEEEEECCHHHHHHHHHHHH-CCCCEEEECCCCEEEE-ECCCEECCHHHHCCCCCCCEEEEC-CCCCCCCCEEE
Q ss_conf             76614889999689899999999856-2998999847520366-048840220221123443113302-66512331122
Q gi|254781095|r   34 RTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILV-RDAGIRGVVLRLSNAGFSNIEVRN-HCEMIVGARCS  110 (318)
Q Consensus        34 rvGG~A~~~~~p~s~~el~~~l~~~~-~~~p~~iiG~GSNil~-~D~~~~G~vI~l~~~~~~~i~~~~-~~~i~v~AG~~  110 (318)
                      +.-+....++.|+|++|+++++++|+ +++|+.+.|+|++.-- +...-.|++|.+++  |+.|+++. ..+++|++|+.
T Consensus        51 ~~~~~P~~Vv~P~s~~eV~~~v~~A~~~g~~v~~rggGhs~~g~~~~~~~gvvIDls~--mn~I~vD~~~~tv~V~aGv~  128 (521)
T 2ipi_A           51 RFRGRPDVVYVVHTADQVVDAVNQAMAAGQRIAVRSGGHCFEGFVDDPAVRAVIDMSQ--MRQVFYDSGKRAFAVEPGAT  128 (521)
T ss_dssp             TCCCCCSEEEECSSHHHHHHHHHHHHHHTCCEEEESSCCCTTCGGGCTTCCEEEECTT--CCCEEEETTTTEEEECTTSB
T ss_pred             CCCCCCCEEEECCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCEEEEECCC--CCCEEEECCCCEEEECCCCC
T ss_conf             7668898899559999999999999987981999899847563836789739998888--99879838999899908969


Q ss_pred             HHHHHHHHHHHHCCCHHCCCCHHHHHHHHHCCCCC-----CCCCEEEEEEEEEEEECCCCCEEEECCCCC----------
Q ss_conf             15677778875201200038725663243115732-----158313456664344112321000012334----------
Q gi|254781095|r  111 GKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAG-----ANNCETSQYVVEVHGIDRKGNQHVIPREQL----------  175 (318)
Q Consensus       111 ~~~l~~~~~~~gl~GlE~l~gIPGTVGGAi~mNAG-----ayG~ei~d~i~~V~~~d~~g~~~~l~~~e~----------  175 (318)
                      |.+|.+.+.++++.-.-.-..-..||||.+..|+.     -||. +.|+|.+++++..||++.+.+....          
T Consensus       129 ~~dl~~~l~~~g~~~~~~g~~~~v~iGG~i~~gg~G~~s~~yG~-~~d~v~~levVladG~~~~~~~~~~~~~~~~~~~l  207 (521)
T 2ipi_A          129 LGETYRALYLDWGVTIPAGVCPQVGVGGHVLGGGYGPLSRRDGV-VADHLYAVEVVVVDASGRARKVVATSAADDPNREL  207 (521)
T ss_dssp             HHHHHHHHHHHHSBCCCCCSCTTCBHHHHTTTTCCCTTHHHHCC-GGGGEEEEEEEEECTTSCEEEEEEECCTTCTTHHH
T ss_pred             HHHHHHHHHHHCCEEECCCCCCCEEECCEECCCCCCCCCCCCCC-HHHEEEEEEEEEECCCEEEEEEEEECCCCCCCCHH
T ss_conf             99999999860896857887565046142079987777778863-64638888999866818997532100101235067


Q ss_pred             CCCCCCCCCCCCCCEEEEECCCCCCC
Q ss_conf             43100232246762001002354565
Q gi|254781095|r  176 KYQYRSSEITKDLIITHVVLRGFPES  201 (318)
Q Consensus       176 ~f~YR~S~~~~~~iIl~a~l~l~~~~  201 (318)
                      .++-|...-..-.||++++|++.|..
T Consensus       208 ~~al~~g~~g~~GVVT~~~l~l~p~~  233 (521)
T 2ipi_A          208 WWAHTGGGGGNFGIVTRYWFRTPGAT  233 (521)
T ss_dssp             HHHTTTSCSSSSCEEEEEEECCSSCC
T ss_pred             HHHHHHHCCCCCCEEEEEEEEEECCC
T ss_conf             87787510011324899999961588