HHSEARCH alignment of GI: 254781095 and SCOP domain: d1hska1

Alignment
>d1hska1 d.145.1.2 (A:15-208) Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
Probab=100.00  E-value=0  Score=353.33  Aligned_cols=190  Identities=32%  Similarity=0.549  Sum_probs=172.3

Q ss_pred             HHHHHHHHHHHHHCCEEEECCCCCCCCCCCCCCEEEEEEEECCHHHHHHHHHHHH-CCCCEEEECCCCEEEEECCCEECC
Q ss_conf             9999999998750662775488001522576614889999689899999999856-299899984752036604884022
Q gi|254781095|r    5 RISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAGIRGV   83 (318)
Q Consensus         5 ~~~~~l~~~~~~~~g~i~~n~~L~~~tt~rvGG~A~~~~~p~s~~el~~~l~~~~-~~~p~~iiG~GSNil~~D~~~~G~   83 (318)
                      .+-+.|+.++.+  .+++.|+||++|||||+||+|++|++|+|.+|+.+++++++ +++|++++|+|||++++|.+++|+
T Consensus         3 ~~~~~l~~~l~~--~~i~~~~~L~~~tt~~vGG~a~~~v~p~s~~el~~~~~~a~~~~ip~~v~G~GSNll~~d~~~~g~   80 (194)
T d1hska1           3 DIYQALQQLIPN--EKIKVDEPLKRYTYTKTGGNADFYITPTKNEEVQAVVKYAYQNEIPVTYLGNGSNIIIREGGIRGI   80 (194)
T ss_dssp             HHHHHHHHHSCG--GGEEEEEEGGGTCTTSCCCEEEEEECCSSHHHHHHHHHHHHHTTCCEEEESSCSSEEECTTCEEEE
T ss_pred             HHHHHHHHHCCC--CCEEECCCCHHCCEEEECEEEEEEEECCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCEEE
T ss_conf             899999866683--637827840343271128298899951999999999987564365367860554223577872239


Q ss_pred             HHHHCCCCCCCEEEECCCCCCCCCEEEHHHHHHHHHHHHCCCHHCCCCHHHHHHHHHCCCCCCCCCEEEEEEEEEEEECC
Q ss_conf             02211234431133026651233112215677778875201200038725663243115732158313456664344112
Q gi|254781095|r   84 VLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDR  163 (318)
Q Consensus        84 vI~l~~~~~~~i~~~~~~~i~v~AG~~~~~l~~~~~~~gl~GlE~l~gIPGTVGGAi~mNAGayG~ei~d~i~~V~~~d~  163 (318)
                      ||++..  +..++..++ .++|+||+.|.++++++.++||+|+||++|||||||||++|||||||.|++|+|.+|+++++
T Consensus        81 vi~l~~--~~~~~~~~~-~v~~~aG~~~~~l~~~~~~~gl~g~e~~~gipgtvGGai~mNaG~yG~ei~d~v~~v~~v~~  157 (194)
T d1hska1          81 VISLLS--LDHIEVSDD-AIIAGSGAAIIDVSRVARDYALTGLEFACGIPGSIGGAVYMNAGAYGGEVKDCIDYALCVNE  157 (194)
T ss_dssp             EEECTT--CCCEEEETT-EEEEETTSBHHHHHHHHHHTTEESCGGGTTCCSBHHHHHHHTCEETTEEHHHHEEEEEEECT
T ss_pred             EEEEEC--CCCCCCCCC-EEEEEECCCHHHHHHHHHHHCCCCCCCCCCCCEEEHHHHHCCCCCCCCEEEEEEEEEEEECC
T ss_conf             998202--222224697-69998356317888999861034332427766334545552574168417889999999948


Q ss_pred             CCCEEEECCCCCCCCCCCCCCCC-CCCEEEEECCCCC
Q ss_conf             32100001233443100232246-7620010023545
Q gi|254781095|r  164 KGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGFP  199 (318)
Q Consensus       164 ~g~~~~l~~~e~~f~YR~S~~~~-~~iIl~a~l~l~~  199 (318)
                      +|++++++++||+|+||+|.|++ ++||++|+|+|.|
T Consensus       158 ~G~i~~l~~~e~~f~YR~s~~~~~~~iIl~a~f~L~P  194 (194)
T d1hska1         158 QGSLIKLTTKELELDYRNSIIQKEHLVVLEAAFTLAP  194 (194)
T ss_dssp             TSCEEEEETTTTTCBTTBCHHHHTTCEEEEEEEECEE
T ss_pred             CCCEEEEEHHHCCCCCCCCCCCCCCEEEEEEEEEEEC
T ss_conf             9989998789926307778799999999999999979


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: FAD-binding/transporter-associated domain-like
superfamily: FAD-binding/transporter-associated domain-like
family: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain
domain: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain
species: Staphylococcus aureus [TaxId: 1280]