HHSEARCH alignment of GI: 254781095 and SCOP domain: d1n62c2

Alignment
>d1n62c2 d.145.1.3 (C:1-177) Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]}
Probab=98.18  E-value=7.7e-07  Score=60.64  Aligned_cols=153  Identities=16%  Similarity=0.209  Sum_probs=99.1

Q ss_pred             EEEEECCHHHHHHHHHHHHCCCCEEEECCCCEEEE--ECCC-EECCHHHHCCCC-CCCEEEECCCCCCCCCEEEHHHHHH
Q ss_conf             99996898999999998562998999847520366--0488-402202211234-4311330266512331122156777
Q gi|254781095|r   41 VMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV--RDAG-IRGVVLRLSNAG-FSNIEVRNHCEMIVGARCSGKSLAN  116 (318)
Q Consensus        41 ~~~~p~s~~el~~~l~~~~~~~p~~iiG~GSNil~--~D~~-~~G~vI~l~~~~-~~~i~~~~~~~i~v~AG~~~~~l~~  116 (318)
                      -|+.|+|.+|+.++++...  -...++.+|+.++.  .++. .+..+|.+..-. +..|+..++ .+..||.+.+.++..
T Consensus         7 ~y~~P~sl~ea~~ll~~~~--~~a~~laGGT~l~~~~~~~~~~~~~lidl~~i~el~~I~~~~~-~~~iGa~~t~~~~~~   83 (177)
T d1n62c2           7 DYHRPKSIADAVALLTKLG--EDARPLAGGHSLIPIMKTRLATPEHLVDLRDIGDLVGIREEGT-DVVIGAMTTQHALIG   83 (177)
T ss_dssp             EEECCSSHHHHHHHHHHHG--GGEEEESSCTTHHHHHHTTSCCCSEEEECTTCGGGSCEEEETT-EEEEETTCBHHHHHH
T ss_pred             CEECCCCHHHHHHHHHHCC--CCCEEEEECCCHHHHHHHCCCCCCCCCCCCCCCCCEEEEECCC-EEEEECCCCHHHHHC
T ss_conf             4638899999999997539--9976998247224325305577653346202523408963585-699703454887521


Q ss_pred             HHH-HHHCCCH----HCCCCHH----HHHHHHHCCCCCCCCCEEEEEE----EEEEEECCCCCEEEECCCCCCCCCCCCC
Q ss_conf             788-7520120----0038725----6632431157321583134566----6434411232100001233443100232
Q gi|254781095|r  117 SAL-RHGIGGF----HFFYGIP----GSIGGAAYMNAGANNCETSQYV----VEVHGIDRKGNQHVIPREQLKYQYRSSE  183 (318)
Q Consensus       117 ~~~-~~gl~Gl----E~l~gIP----GTVGGAi~mNAGayG~ei~d~i----~~V~~~d~~g~~~~l~~~e~~f~YR~S~  183 (318)
                      ... ..-+..+    .+.++..    |||||.++. |-..+ ++.-.+    -.|++...+|+ ++++-+|+--+||.+.
T Consensus        84 ~~~~~~~~p~l~~a~~~~as~qIRn~aTiGGNi~~-a~p~~-D~~~~Llal~A~v~l~~~~G~-R~vpl~dF~~g~~~t~  160 (177)
T d1n62c2          84 SDFLAAKLPIIRETSLLIADPQIRYMGTIGGNAAN-GDPGN-DMPALMQCLGAAYELTGPEGA-RIVAARDYYQGAYFTA  160 (177)
T ss_dssp             CHHHHHHCHHHHHHHTTSSCHHHHHHCBHHHHHHS-CCTTC-SHHHHHHHHTCEEEEEETTEE-EEEEHHHHEEETTEES
T ss_pred             CHHHHHHCCHHHHHHHHCCCHHHEEEEEEECCEEC-CCCCC-HHHHHHHHHCCEEEEECCCCE-EEEEHHHHCCCCCCCC
T ss_conf             07676536479999641389427689996153201-45333-268999984031488538835-9989999505603134


Q ss_pred             CCCCCCEEEEECCCCC
Q ss_conf             2467620010023545
Q gi|254781095|r  184 ITKDLIITHVVLRGFP  199 (318)
Q Consensus       184 ~~~~~iIl~a~l~l~~  199 (318)
                      ++.+.+++++.+-..|
T Consensus       161 l~~~Eii~~I~iP~p~  176 (177)
T d1n62c2         161 IEPGELLTAIRIPVPP  176 (177)
T ss_dssp             CCTTCEEEEEEEECCC
T ss_pred             CCCCCEEEEEEECCCC
T ss_conf             5989769999965998


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: FAD-binding/transporter-associated domain-like
superfamily: FAD-binding/transporter-associated domain-like
family: CO dehydrogenase flavoprotein N-terminal domain-like
domain: Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain
species: Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]