HHSEARCH alignment of GI: 254781095 and SCOP domain: d1uxya2

Alignment
>d1uxya2 d.146.1.1 (A:201-342) Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain {Escherichia coli [TaxId: 562]}
Probab=100.00  E-value=3.1e-34  Score=233.77  Aligned_cols=110  Identities=29%  Similarity=0.390  Sum_probs=95.9

Q ss_pred             CCCCHHHHHHCCCCCCCC--CCCCCEEEEEEEECCC--------------------------CCCCHHHHHHCCCCCCCC
Q ss_conf             431001222100110001--5566704658897278--------------------------985100026318688206
Q gi|254781095|r  202 QNIISAAIANVCHHRETV--QPIKEKTGGSTFKNPT--------------------------GHSAWQLIEKSGCRGLEF  253 (318)
Q Consensus       202 ~~~i~~~~~~~~~~R~~~--qP~~~~s~GSvFkNP~--------------------------~~~A~~LIe~~GlKG~~i  253 (318)
                      |.++++.+.+   .|+++  +|...||||||||||.                          ..+||||||+|||||+++
T Consensus         3 p~~i~~~v~~---iR~~klPdp~~~~n~GSfFKNPii~~~~~~~l~~~~~~~~~~~~~~~~~Ki~Aa~LIe~~G~Kg~~~   79 (142)
T d1uxya2           3 PQQVFNAVCH---MRTTKLPDPKVNGNAGAFFKNPVVSAETAKALLSQFPTAPNYPQADGSVKLAAGWLIDQCQLKGMQI   79 (142)
T ss_dssp             HHHHHHHHHH---HHHHHSCCTTTSCEEEESBCCCEECHHHHHHHHHHSTTCCEEECTTSCEEECHHHHHHHTTCTTCEE
T ss_pred             HHHHHHHHHH---HHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHEEEHHHCCCCCC
T ss_conf             8999999999---9954499965156667543687544899999987287643444689984143122010020278776


Q ss_pred             CCEEECCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHHHCCEEEECCEEEECCCCHHHHHHH
Q ss_conf             67787156770899689979999999999999999998475400422896216835688863
Q gi|254781095|r  254 GGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVDAT  315 (318)
Q Consensus       254 G~a~vS~kHanfivN~g~ata~di~~Li~~v~~~V~~~~gi~Le~Ev~~iG~f~~~~~~~~~  315 (318)
                      |+|+||++|||||||.|+||++|+++|++.||+.|+++|||.||+||++|| +..+..++.|
T Consensus        80 G~a~vs~kHalvlVN~g~ata~Di~~L~~~I~~~V~~kfgI~LE~E~~iiG-~~~~~~~~~~  140 (142)
T d1uxya2          80 GGAAVHRQQALVLINEDNAKSEDVVQLAHHVRQKVGEKFNVWLEPEVRFIG-ASGEVSAVET  140 (142)
T ss_dssp             TTEEECSSCTTEEEECSSCCHHHHHHHHHHHHHHHHHHHSCCCCBCSEEEE-TTEECCHHHH
T ss_pred             CCCEECHHCCEEEEECCCCCHHHHHHHHHHHHHHHHHHHCCEEEEEEEEEC-CCCCCCHHHH
T ss_conf             880685324748997899999999999999999999988984057248977-9984698886


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain
superfamily: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain
family: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain
domain: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain
species: Escherichia coli [TaxId: 562]