BLAST/PSIBLAST alignment of GI: 254781095 and GI: 86358448 at iteration 1
>gi|86358448|ref|YP_470340.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobium etli CFN 42] Length = 324
>gi|123511378|sp|Q2K6C3|MURB_RHIEC RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase; AltName: Full=UDP-N-acetylmuramate dehydrogenase Length = 324
>gi|37544105|gb|AAQ93038.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobium etli] Length = 324
>gi|86282550|gb|ABC91613.1| UDP-N-acetylenolpyruvoylglucosamine reductase protein [Rhizobium etli CFN 42] Length = 324
 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 171/293 (58%), Positives = 219/293 (74%)

Query: 15  KQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNIL 74
           K +RG+   + P+ ++TWFR GG AE+MFQP DI DL  FL +LP ++P+T++G+GSNIL
Sbjct: 18  KDIRGRITPDAPMDRVTWFRAGGLAELMFQPHDIDDLIAFLKILPEEVPLTVIGVGSNIL 77

Query: 75  VRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPG 134
           VRD GI GVVLRLS  GF  +E+     ++ GA C  K +A  A+ +GIGG HF+YGIPG
Sbjct: 78  VRDGGIPGVVLRLSAKGFGFVELAGENRILAGAICPDKHVAAMAMDNGIGGLHFYYGIPG 137

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVV 194
           +IGGAA MNAGAN  ET + ++EV+ +DRKGN+HV+   ++ Y YR S    DLI T V+
Sbjct: 138 AIGGAARMNAGANGVETRERLIEVNAVDRKGNKHVLSNAEMGYSYRHSAAPTDLIFTSVL 197

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
             G+PE +  I A +  V +HRETVQP++EKTGGSTFKNP GHSAW+LI+++GCRGL  G
Sbjct: 198 FEGYPEDRAQIRAEMDAVRNHRETVQPVREKTGGSTFKNPPGHSAWKLIDEAGCRGLVIG 257

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFF 307
           GA++S LHCNFMIN   ATGYDLEYLGEQVR++VF + GI LEWEIKRLG F 
Sbjct: 258 GAQMSSLHCNFMINMGQATGYDLEYLGEQVRREVFEKEGIKLEWEIKRLGVFM 310