BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781095|ref|YP_003065508.1|
UDP-N-acetylenolpyruvoylglucosamine reductase [Candidatus Liberibacter
asiaticus str. psy62]
         (318 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254781095|ref|YP_003065508.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040772|gb|ACT57568.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 318

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/318 (100%), Positives = 318/318 (100%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS
Sbjct: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR
Sbjct: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
           HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR
Sbjct: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
           SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW
Sbjct: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI
Sbjct: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300

Query: 301 KRLGDFFDHQIVDATKIF 318
           KRLGDFFDHQIVDATKIF
Sbjct: 301 KRLGDFFDHQIVDATKIF 318


>gi|315122421|ref|YP_004062910.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495823|gb|ADR52422.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 316

 Score =  511 bits (1315), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 238/309 (77%), Positives = 273/309 (88%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
            R+R +QLRGKFQENFP+KQ+TWFRTGGNAE MFQP+DIHDLKYFLTLLP+DI ITIVGL
Sbjct: 8   FRKRVQQLRGKFQENFPMKQVTWFRTGGNAEFMFQPKDIHDLKYFLTLLPNDITITIVGL 67

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
           GSNILVRDAGI+GVVLRLS++GFS IE+++ CE++VGA CSGK LAN A+ HGIGG HFF
Sbjct: 68  GSNILVRDAGIKGVVLRLSHSGFSQIEMKSDCEIVVGASCSGKFLANWAMHHGIGGLHFF 127

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLI 189
           YGIPGSIGGA YMNAGANNCETSQ VVEVH +DR GNQH+IP+ ++ YQYR S + KD I
Sbjct: 128 YGIPGSIGGAVYMNAGANNCETSQCVVEVHAMDRMGNQHIIPQNKMGYQYRHSLLPKDYI 187

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
           ITHV L+GFPESQ++I +AI+ V  HR+TVQPIKEKTGGSTFKNP GHSAW+LIE+S CR
Sbjct: 188 ITHVFLKGFPESQDVIRSAISTVSVHRQTVQPIKEKTGGSTFKNPMGHSAWKLIEESQCR 247

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDH 309
           GLEFGGAKISELHCNFMIN  NATGYDLEYLGE VRKKV  ++GI+LEWEIKRLG+F DH
Sbjct: 248 GLEFGGAKISELHCNFMINTGNATGYDLEYLGELVRKKVLKKTGIVLEWEIKRLGEFVDH 307

Query: 310 QIVDATKIF 318
           +I+D T IF
Sbjct: 308 RIIDDTTIF 316


>gi|190892581|ref|YP_001979123.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobium etli CIAT
           652]
 gi|218509397|ref|ZP_03507275.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobium etli
           Brasil 5]
 gi|254765528|sp|B3PTV8|MURB_RHIE6 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|190697860|gb|ACE91945.1| UDP-N-acetylenolpyruvoylglucosamine reductase protein [Rhizobium
           etli CIAT 652]
 gi|327194620|gb|EGE61470.1| UDP-N-acetylenolpyruvoylglucosamine reductase protein [Rhizobium
           etli CNPAF512]
          Length = 324

 Score =  375 bits (962), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 172/293 (58%), Positives = 221/293 (75%)

Query: 15  KQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNIL 74
           K +RG+   + P+ ++TWFR GG AE+MFQP D+ DL  FL +LP ++P+T++G+GSNIL
Sbjct: 18  KDIRGRITPDAPMDRVTWFRAGGLAELMFQPHDVDDLIAFLKILPEEVPLTVIGVGSNIL 77

Query: 75  VRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPG 134
           VRD GI GVVLRLS  GF  +E+     ++ GA C  K +A  A+ +GIGGFHF+YGIPG
Sbjct: 78  VRDGGIPGVVLRLSAKGFGFVELAGENRILAGAICPDKHVAAMAMDNGIGGFHFYYGIPG 137

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVV 194
           +IGGAA MNAGAN  ET + +VEV+ +DRKGN+HV+   ++ Y YR S  + DLI T V+
Sbjct: 138 AIGGAARMNAGANGVETRERLVEVNAVDRKGNKHVLSNAEMGYSYRHSAASADLIFTSVL 197

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
             G+PE +  I A +  V +HRETVQP++EKTGGSTFKNP GHSAW+LI+++GCRGL  G
Sbjct: 198 FEGYPEDRAQIRAEMDAVRNHRETVQPVREKTGGSTFKNPPGHSAWKLIDEAGCRGLVIG 257

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFF 307
           GA++S LHCNFMIN   ATGYDLEYLGEQVR++VF + GI LEWEIKRLG F 
Sbjct: 258 GAQMSSLHCNFMINMGQATGYDLEYLGEQVRREVFEKDGIKLEWEIKRLGVFM 310


>gi|209550172|ref|YP_002282089.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|254765536|sp|B5ZWJ2|MURB_RHILW RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|209535928|gb|ACI55863.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 324

 Score =  374 bits (960), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 172/293 (58%), Positives = 221/293 (75%)

Query: 15  KQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNIL 74
           K +RG+   + P+ ++TWFR GG AE+MFQP DI DL  FL +LP ++P+T++G+GSNIL
Sbjct: 18  KDIRGRITPDAPMDRVTWFRAGGLAELMFQPHDIDDLVAFLKILPEEVPLTVIGVGSNIL 77

Query: 75  VRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPG 134
           VRD GI GVVLRLS  GF  +E+     ++ G+ C  K +A  A+ +GIGGFHFFYGIPG
Sbjct: 78  VRDGGIPGVVLRLSAKGFGFVELAGENRILAGSICPDKHVAAMAMDNGIGGFHFFYGIPG 137

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVV 194
           SIGGAA MNAGAN  ET + ++EV+ +DRKGN+HV+   ++ Y YR S  + +LI T V+
Sbjct: 138 SIGGAARMNAGANGVETRERLIEVNAVDRKGNKHVLSNAEMGYSYRHSTASSELIFTSVL 197

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
             G+PE +  I A +  V +HRETVQP++EKTGGSTFKNP GHSAW+LI+++GCRGL  G
Sbjct: 198 FEGYPEERAQIRAEMDAVRNHRETVQPVREKTGGSTFKNPAGHSAWKLIDEAGCRGLVIG 257

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFF 307
           GA++S LHCNFMIN   ATGYDLEYLGEQVR++VF + GI LEWEIKRLG F 
Sbjct: 258 GAQMSSLHCNFMINMGQATGYDLEYLGEQVRREVFEKEGIKLEWEIKRLGVFM 310


>gi|86358448|ref|YP_470340.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobium etli CFN
           42]
 gi|123511378|sp|Q2K6C3|MURB_RHIEC RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|37544105|gb|AAQ93038.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobium etli]
 gi|86282550|gb|ABC91613.1| UDP-N-acetylenolpyruvoylglucosamine reductase protein [Rhizobium
           etli CFN 42]
          Length = 324

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 171/293 (58%), Positives = 219/293 (74%)

Query: 15  KQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNIL 74
           K +RG+   + P+ ++TWFR GG AE+MFQP DI DL  FL +LP ++P+T++G+GSNIL
Sbjct: 18  KDIRGRITPDAPMDRVTWFRAGGLAELMFQPHDIDDLIAFLKILPEEVPLTVIGVGSNIL 77

Query: 75  VRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPG 134
           VRD GI GVVLRLS  GF  +E+     ++ GA C  K +A  A+ +GIGG HF+YGIPG
Sbjct: 78  VRDGGIPGVVLRLSAKGFGFVELAGENRILAGAICPDKHVAAMAMDNGIGGLHFYYGIPG 137

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVV 194
           +IGGAA MNAGAN  ET + ++EV+ +DRKGN+HV+   ++ Y YR S    DLI T V+
Sbjct: 138 AIGGAARMNAGANGVETRERLIEVNAVDRKGNKHVLSNAEMGYSYRHSAAPTDLIFTSVL 197

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
             G+PE +  I A +  V +HRETVQP++EKTGGSTFKNP GHSAW+LI+++GCRGL  G
Sbjct: 198 FEGYPEDRAQIRAEMDAVRNHRETVQPVREKTGGSTFKNPPGHSAWKLIDEAGCRGLVIG 257

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFF 307
           GA++S LHCNFMIN   ATGYDLEYLGEQVR++VF + GI LEWEIKRLG F 
Sbjct: 258 GAQMSSLHCNFMINMGQATGYDLEYLGEQVRREVFEKEGIKLEWEIKRLGVFM 310


>gi|325293463|ref|YP_004279327.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Agrobacterium sp.
           H13-3]
 gi|325061316|gb|ADY65007.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Agrobacterium sp.
           H13-3]
          Length = 321

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 174/299 (58%), Positives = 219/299 (73%)

Query: 15  KQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNIL 74
           K+LRG+   + P+ ++TWFR GG AEVMFQP D  DL  FL +LP D+P+T+VG+GSN+L
Sbjct: 18  KELRGRLTPDAPMDRVTWFRAGGLAEVMFQPHDTDDLVTFLKILPEDVPLTVVGVGSNLL 77

Query: 75  VRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPG 134
           VRD GI GVV+RLS  GF ++E+     +  GA C  K +A  A+ +GIGGFHF+YGIPG
Sbjct: 78  VRDGGIPGVVVRLSAKGFGSVELSGENRIKAGAICPDKHIAAMAMDNGIGGFHFYYGIPG 137

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVV 194
           SIGGA  MNAGAN  ET + VVEV+ +DR+GNQHV+    + Y YR S     LI T  +
Sbjct: 138 SIGGALRMNAGANGGETRERVVEVYAVDRQGNQHVLSNADMDYSYRHSGADAGLIFTGAL 197

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
             G+PE +  I A +  V HHRETVQPI+E+TGGSTFKNP GHSAW+LI+++G RGL  G
Sbjct: 198 FEGYPEDRAKIRADMDAVRHHRETVQPIREQTGGSTFKNPEGHSAWELIDEAGGRGLVIG 257

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVD 313
           GA++S LHCNFMIN  +ATGYDLEYLGE +RK+VF +SGI LEWEIKRLG F   + V+
Sbjct: 258 GAQMSSLHCNFMINTGHATGYDLEYLGETIRKRVFEKSGIRLEWEIKRLGLFMPGREVE 316


>gi|15889376|ref|NP_355057.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Agrobacterium
           tumefaciens str. C58]
 gi|30316075|sp|Q8UDN0|MURB_AGRT5 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|15157226|gb|AAK87842.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Agrobacterium
           tumefaciens str. C58]
          Length = 321

 Score =  365 bits (938), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 172/298 (57%), Positives = 219/298 (73%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
           +LRG+   + P+ ++TWFR GG AEVMFQP D  DL  FL +LP D+P+T+VG+GSN+LV
Sbjct: 19  ELRGRLTPDAPMDRVTWFRAGGLAEVMFQPHDTDDLIAFLKILPEDVPLTVVGVGSNLLV 78

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD GI GVV+RLS  GF ++E+ +   +  GA C  K +A  A+ +GIGGFHF+YGIPGS
Sbjct: 79  RDGGIPGVVVRLSAKGFGSVELADENRIKAGAICPDKHIAAMAMDNGIGGFHFYYGIPGS 138

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           IGGA  MNAGAN  ET + VVEV+ +DR+GNQHV+    + Y YR S     LI T  + 
Sbjct: 139 IGGALRMNAGANGGETRERVVEVYAVDRQGNQHVLSNADMGYSYRHSGADAGLIFTGALF 198

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
            G+PE +  I A +  V HHRETVQPI+E+TGGSTFKNP GHSAW+LI+++G RGL  GG
Sbjct: 199 EGYPEDKAKIRADMDAVRHHRETVQPIREQTGGSTFKNPEGHSAWELIDEAGGRGLVIGG 258

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVD 313
           A++S LHCNFMIN  +ATGYDLEYLGE +R++VF +SGI LEWEIKRLG F   + V+
Sbjct: 259 AQMSSLHCNFMINTGHATGYDLEYLGETIRRRVFEKSGIRLEWEIKRLGLFMPGREVE 316


>gi|227822649|ref|YP_002826621.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sinorhizobium fredii
           NGR234]
 gi|254765543|sp|C3MEM7|MURB_RHISN RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|227341650|gb|ACP25868.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sinorhizobium fredii
           NGR234]
          Length = 324

 Score =  357 bits (916), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 164/291 (56%), Positives = 211/291 (72%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RG+   + P+ ++TWFR GG AE+MFQP D  DL  FL L+P ++P+ ++G+GSN+LVR
Sbjct: 20  IRGRITPDAPMDRVTWFRAGGLAELMFQPHDTDDLVAFLKLVPEEVPVMVIGVGSNLLVR 79

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GI GVV+RLS  GF ++E+     +  GA C  K++A  AL HGIGGF+F+YGIPGSI
Sbjct: 80  DGGIPGVVIRLSAKGFGDLEIVGENRIKAGAICPDKNIAAMALDHGIGGFYFYYGIPGSI 139

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET + VVEVH +DR+GN+HV+    + Y YR +   KDLI TH +  
Sbjct: 140 GGALRMNAGANGGETRERVVEVHAVDRRGNRHVLSNADMGYSYRHTAAAKDLIFTHAIFE 199

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           GFPE +  I   +  V  HRETVQPI+EKTGGSTFKNP G+SAW+LI+++G RG+  GGA
Sbjct: 200 GFPEDKAKIRHDMDAVRQHRETVQPIREKTGGSTFKNPEGNSAWKLIDEAGGRGMMIGGA 259

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFF 307
           ++S LHCNFMIN   A+GY+LEYLGE VR +V   SGI LEWEIKR+G F 
Sbjct: 260 QMSPLHCNFMINTGQASGYELEYLGETVRAQVLEHSGIKLEWEIKRIGKFM 310


>gi|163760788|ref|ZP_02167868.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Hoeflea
           phototrophica DFL-43]
 gi|162282110|gb|EDQ32401.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Hoeflea
           phototrophica DFL-43]
          Length = 325

 Score =  355 bits (911), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 166/297 (55%), Positives = 210/297 (70%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
            +RG+   N  + ++TWFRTGG AE++FQP D  DL  FLT+LP ++P+  VG+GSN+LV
Sbjct: 21  DVRGRLTPNAEMSKVTWFRTGGPAELLFQPLDEDDLSAFLTVLPEEVPVLPVGIGSNLLV 80

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD GI GVV+RLS  GF   E  +   ++ GA C  K LA  AL  G+GGFHF++GIPG+
Sbjct: 81  RDGGIPGVVIRLSAKGFGRAEQVSDTRLMAGAVCPDKHLAALALETGLGGFHFYHGIPGA 140

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           IGGA  MNAGAN  ET + VVEVH +DRKG +HV+    + Y YR S   KDLI T  + 
Sbjct: 141 IGGALRMNAGANGVETRERVVEVHAVDRKGERHVLSNADMGYAYRHSSAPKDLIFTRAIF 200

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
            G P  ++ I  A+  V HHRETVQPI+EKTGGSTFKNP GHSAW++I+++GCRGL  GG
Sbjct: 201 EGAPADKDEIRQAMDAVQHHRETVQPIREKTGGSTFKNPEGHSAWKVIDEAGCRGLTVGG 260

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIV 312
           A++S +HCNFMIN  +A+GY+LE LGE VR +V   SG+ LEWEIKRLG F   Q V
Sbjct: 261 AQMSPMHCNFMINTGSASGYELENLGETVRARVLENSGVRLEWEIKRLGLFDPEQTV 317


>gi|116253046|ref|YP_768884.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|187609739|sp|Q1ME35|MURB_RHIL3 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|115257694|emb|CAK08792.1| putative UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 324

 Score =  354 bits (909), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 174/293 (59%), Positives = 220/293 (75%)

Query: 15  KQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNIL 74
           K +RG+   + P+ ++TWFR GG AE+MFQP DI DL  FL +LP ++P+T+VG+GSNIL
Sbjct: 18  KDIRGRITPDAPMDRVTWFRAGGLAELMFQPHDIDDLVAFLKILPEEVPLTVVGVGSNIL 77

Query: 75  VRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPG 134
           VRD GI GVVLRLS  GF  +E+     ++ GA C  K +A  A+ +GIGGFHFFYGIPG
Sbjct: 78  VRDGGIPGVVLRLSAKGFGFVELAGENRILAGAICPDKHVAAMAMDNGIGGFHFFYGIPG 137

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVV 194
            IGGAA MNAGAN  ET + ++EVH +DRKG++HV+   ++ Y YR S  + DLI T V+
Sbjct: 138 GIGGAARMNAGANGVETRERLIEVHAVDRKGDKHVLSNAEMGYSYRHSTASTDLIFTSVL 197

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
             G+PE +  I A +  V +HRETVQP++EKTGGSTFKNP GHSAW+LI+++GCRGL  G
Sbjct: 198 FEGYPEERAQIRAEMDAVRNHRETVQPVREKTGGSTFKNPAGHSAWKLIDEAGCRGLVIG 257

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFF 307
           GA++S LHCNFMIN   ATGYDLEYLGEQVR++VF + GI LEWEIKRLG F 
Sbjct: 258 GAQMSSLHCNFMINMGQATGYDLEYLGEQVRREVFEKDGIKLEWEIKRLGVFM 310


>gi|222086442|ref|YP_002544976.1| UDP-N-acetylenolpyruvoylglucosamine reductase protein
           [Agrobacterium radiobacter K84]
 gi|254764125|sp|B9JH49|MURB_AGRRK RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|221723890|gb|ACM27046.1| UDP-N-acetylenolpyruvoylglucosamine reductase protein
           [Agrobacterium radiobacter K84]
          Length = 324

 Score =  354 bits (909), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 176/293 (60%), Positives = 220/293 (75%)

Query: 15  KQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNIL 74
           K +RG+   + P+ ++TWFR GG AE+MFQP D  DL  FL +LP D+P+T+VG+GSNIL
Sbjct: 18  KDIRGRLTPDAPMDRVTWFRAGGLAELMFQPHDTDDLIDFLKILPDDVPLTVVGVGSNIL 77

Query: 75  VRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPG 134
           VRD GI GVVLRLS  GF ++E+     ++ GA C  K +A  A+ +GIGGFHF+YGIPG
Sbjct: 78  VRDGGIPGVVLRLSAKGFGSVELAGENRILAGAICPDKHVAAMAMDNGIGGFHFYYGIPG 137

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVV 194
            IGGAA MNAGAN  ET + V+EVH +DRKG +HV+  +Q+ Y YR S    DLI THV+
Sbjct: 138 GIGGAARMNAGANGAETCERVIEVHAVDRKGVKHVLTNDQMGYTYRHSAAADDLIFTHVL 197

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
             G+PE +  I A +  V  HRETVQPI+EKTGGSTFKNP G SAW+LI+++GCRGL  G
Sbjct: 198 FEGYPEDRTKIRAEMDAVRAHRETVQPIREKTGGSTFKNPDGLSAWKLIDEAGCRGLVIG 257

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFF 307
           GA++S LHCNFMIN + ATGYDLEYLGEQVR++VF +SG+ LEWEIKRLG F 
Sbjct: 258 GAQMSSLHCNFMINMEQATGYDLEYLGEQVRREVFEKSGVKLEWEIKRLGGFM 310


>gi|110634355|ref|YP_674563.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Mesorhizobium sp.
           BNC1]
 gi|123162149|sp|Q11GS7|MURB_MESSB RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|110285339|gb|ABG63398.1| UDP-N-acetylmuramate dehydrogenase [Chelativorans sp. BNC1]
          Length = 321

 Score =  354 bits (908), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 171/304 (56%), Positives = 211/304 (69%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           L +R   LRG+   +  + +ITWFR GG A+++FQPQD  DL  FL  +P +IP+TIVG+
Sbjct: 11  LGDRLSGLRGRLTPDAGMDKITWFRAGGEADLLFQPQDEEDLAAFLKAVPEEIPVTIVGI 70

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
           GSN+LVRD G+RG V+RLS  GF   EV +   +  GA    K LA  AL  GIGGFHFF
Sbjct: 71  GSNLLVRDDGMRGFVVRLSAKGFGEAEVISPTRIRAGAAIPDKRLAAFALEAGIGGFHFF 130

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLI 189
           +GIPG +GGA  MNAGAN  ETS+ VVEV  +DR+G  HV    ++ Y YR+S  ++ LI
Sbjct: 131 HGIPGGLGGALRMNAGANGVETSERVVEVRALDRRGELHVFSNAEMGYSYRASAASQGLI 190

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
            T  VL G+ E +  I AA+  V HHRETVQPI+EKTGGSTFKNP G SAW+ I+++GCR
Sbjct: 191 FTSAVLEGYAEDREAIRAAMDAVQHHRETVQPIREKTGGSTFKNPEGTSAWKEIDRAGCR 250

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDH 309
           GL  GGA++S +HCNFMIN   ATGYDLEYLGE VR +V   SGI LEWEIKR+G F   
Sbjct: 251 GLMIGGAQMSPMHCNFMINTGTATGYDLEYLGETVRARVLENSGIKLEWEIKRIGAFKPD 310

Query: 310 QIVD 313
             VD
Sbjct: 311 HSVD 314


>gi|241205555|ref|YP_002976651.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240859445|gb|ACS57112.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 324

 Score =  352 bits (903), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 172/293 (58%), Positives = 219/293 (74%)

Query: 15  KQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNIL 74
           K +RG+   + P+ ++TWFR GG AE+MFQP DI DL  FL +LP ++P+T+VG+GSNIL
Sbjct: 18  KDIRGRITPDAPMDRVTWFRAGGLAELMFQPHDIDDLIAFLKILPEEVPLTVVGVGSNIL 77

Query: 75  VRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPG 134
           VRD GI GVVLRLS  GF  +E+     ++ GA C  K +A  A+ +GIGGFHFFYGIPG
Sbjct: 78  VRDGGIPGVVLRLSAKGFGFVELAGENRILAGAICPDKHVAAMAMDNGIGGFHFFYGIPG 137

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVV 194
            IGGAA MNAGAN  ET + ++EVH +DRKG++HV+   ++ Y YR S  + DLI T V+
Sbjct: 138 GIGGAARMNAGANGVETRERLIEVHAVDRKGDKHVLSNAEMGYSYRHSTASTDLIFTSVL 197

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
             G+PE +  I   +  V +HRETVQP++EKTGGSTFKNP GHSAW+L++++GCRGL  G
Sbjct: 198 FEGYPEERAQIRTEMDAVRNHRETVQPVREKTGGSTFKNPAGHSAWKLVDEAGCRGLVIG 257

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFF 307
           GA++S LHCNFMIN   ATGYDLEYLGEQVR++VF + GI LEWEIKRLG F 
Sbjct: 258 GAQMSSLHCNFMINMGQATGYDLEYLGEQVRREVFEKDGIKLEWEIKRLGVFM 310


>gi|15965927|ref|NP_386280.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sinorhizobium
           meliloti 1021]
 gi|307308237|ref|ZP_07587946.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sinorhizobium
           meliloti BL225C]
 gi|307319704|ref|ZP_07599129.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sinorhizobium
           meliloti AK83]
 gi|30316099|sp|Q92NM1|MURB_RHIME RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|15075196|emb|CAC46753.1| Probable UDP-N-acetylenolpyruvoylglucosamine reductase
           [Sinorhizobium meliloti 1021]
 gi|306894635|gb|EFN25396.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sinorhizobium
           meliloti AK83]
 gi|306901235|gb|EFN31841.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sinorhizobium
           meliloti BL225C]
          Length = 324

 Score =  348 bits (892), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 166/291 (57%), Positives = 216/291 (74%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RG+   + P+ ++TWFR GG AE+MFQP D  DL  FL L+P ++P+ +VG+GSN+LVR
Sbjct: 20  IRGRLTPDAPMDRVTWFRAGGLAELMFQPHDTDDLVAFLKLVPEEVPVMVVGVGSNLLVR 79

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GI GVV+RLS  GF ++E+     +  GA C  K++A  AL HGIGGF+F+YGIPGSI
Sbjct: 80  DGGIPGVVIRLSAKGFGDLELAGENRIKAGAICPDKNIAAMALDHGIGGFYFYYGIPGSI 139

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN+ ETS+ VVEVH +DRKGN+HV+ + ++ Y YR S   K+LI TH +  
Sbjct: 140 GGALRMNAGANSGETSERVVEVHAVDRKGNRHVLSKAEMGYGYRHSGAAKELIFTHAIFE 199

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G+ E +  I   +  V  HRETVQPI+EKTGGSTFKNP GHSAW+LI+++GCRG+  G A
Sbjct: 200 GYAEDKTKIRTDMDAVRQHRETVQPIREKTGGSTFKNPDGHSAWKLIDEAGCRGMMIGNA 259

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFF 307
           ++S LHCNFMIN   ATGY+LEYLGE VR++V   SG+ LEWEIKR+G+F 
Sbjct: 260 QMSPLHCNFMINTGQATGYELEYLGETVRQRVMEHSGVKLEWEIKRVGNFM 310


>gi|150397281|ref|YP_001327748.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sinorhizobium
           medicae WSM419]
 gi|187609740|sp|A6UB83|MURB_SINMW RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|150028796|gb|ABR60913.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sinorhizobium
           medicae WSM419]
          Length = 324

 Score =  344 bits (883), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 166/291 (57%), Positives = 215/291 (73%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RG+   + P+ ++TWFR GG AE+MFQP D  DL  FL L+P ++P+ +VG+GSN+LVR
Sbjct: 20  IRGRITPDAPMDRVTWFRAGGLAELMFQPHDTDDLTTFLKLVPEEVPVLVVGVGSNLLVR 79

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GI GVV+RLS  GF ++E+     +  GA C  K+LA  AL HGIGGF+F+YGIPGSI
Sbjct: 80  DGGIPGVVIRLSAKGFGDLELAGEHRIKAGAICPDKNLAAMALDHGIGGFYFYYGIPGSI 139

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ETS  V+EVH +DRKG++HV+ + ++ Y YR S   KDLI TH +  
Sbjct: 140 GGALRMNAGANAGETSARVLEVHAVDRKGDRHVLSKSEMGYGYRHSGAAKDLIFTHAIFE 199

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G+ E +  I   +  V  HRETVQPI+EKTGGSTFKNP GHSAW+LI+++GCRG+  G A
Sbjct: 200 GYAEDKAKIRNDMDAVRQHRETVQPIREKTGGSTFKNPEGHSAWKLIDEAGCRGMMIGNA 259

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFF 307
           ++S LHCNFMIN   ATGY+LEYLGE VR++V + SG+ LEWEIKR+G+F 
Sbjct: 260 QMSPLHCNFMINTGQATGYELEYLGETVRQRVMDHSGVKLEWEIKRVGNFM 310


>gi|114704919|ref|ZP_01437827.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Fulvimarina pelagi
           HTCC2506]
 gi|114539704|gb|EAU42824.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Fulvimarina pelagi
           HTCC2506]
          Length = 320

 Score =  344 bits (882), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 160/303 (52%), Positives = 208/303 (68%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           LR R K  RG+   N  + ++TWFR GG AEV+  P D  DL   +  +P+++P+ +VG+
Sbjct: 11  LRGRAKNFRGRLSANAGMDKVTWFRVGGPAEVLAMPADEDDLGLLMAAIPAEVPVRVVGI 70

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
           GSN+LVRD GI GVV+RLS  GF   E  +   +I G  C  K +A +AL+ G+ GFHF+
Sbjct: 71  GSNLLVRDGGIPGVVIRLSAKGFGMAEQVSETRLIAGTACPDKRVAATALQAGLDGFHFY 130

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLI 189
           +GIPGSIGGA  MNAGAN  ET + VVEVH IDR+G +HV+  +++ Y YR S  ++DL+
Sbjct: 131 HGIPGSIGGALRMNAGANGVETRERVVEVHAIDRRGGKHVLSNDEMGYAYRHSSASEDLV 190

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
            T  +  G       I   +  V HHRETVQP+KEKTGGSTFKNP G SAW+ ++K+GCR
Sbjct: 191 FTRALFEGPRGDAAEIQRKMDEVQHHRETVQPVKEKTGGSTFKNPEGTSAWKEVDKAGCR 250

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDH 309
           GL+ G A++SE+HCNFMIN   ATGYDLE LGE VR +V   SGI LEWEIKR+G+F D 
Sbjct: 251 GLKVGEAQMSEMHCNFMINTGEATGYDLETLGETVRDRVRKTSGITLEWEIKRIGEFIDG 310

Query: 310 QIV 312
           + V
Sbjct: 311 RTV 313


>gi|222149134|ref|YP_002550091.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Agrobacterium vitis
           S4]
 gi|254764126|sp|B9JY52|MURB_AGRVS RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|221736119|gb|ACM37082.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Agrobacterium vitis
           S4]
          Length = 324

 Score =  344 bits (882), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 163/291 (56%), Positives = 207/291 (71%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRG+   + P+ ++TWF+ GG AE+MFQP D  DL  FL LLP D+P+T+VG+GSN+LVR
Sbjct: 20  LRGRLTPDAPMDRVTWFQAGGLAELMFQPHDRDDLVTFLKLLPDDVPLTVVGVGSNLLVR 79

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GI GVV+RLS  GF  +E+     +  GA C  K +A  A+ + IGGF F+YGIPGSI
Sbjct: 80  DGGIPGVVIRLSAKGFGGLELEGENRIRAGAICPDKHIAAMAMDNNIGGFAFYYGIPGSI 139

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET++ V+EV  +DR+GN HV+ +  + Y YR S   + LI    +  
Sbjct: 140 GGALRMNAGANGGETAERVIEVEAVDRQGNLHVLSKADMGYGYRHSSAPEGLIFISGLFE 199

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           GF + ++ I A +  V  HRETVQP+KEKTGGSTFKNP GHSAW+LI++ G RGL  GGA
Sbjct: 200 GFSQEKSAIRAEMDAVRQHRETVQPVKEKTGGSTFKNPEGHSAWELIDEVGGRGLMIGGA 259

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFF 307
           ++S LHCNFMIN  +AT YDLEYLGE +R +VF QSGI L+WEIKRLG F 
Sbjct: 260 QMSSLHCNFMINVGHATAYDLEYLGETIRGQVFEQSGIKLQWEIKRLGLFM 310


>gi|319782850|ref|YP_004142326.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317168738|gb|ADV12276.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 321

 Score =  342 bits (877), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 165/297 (55%), Positives = 203/297 (68%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           L +R   LRG+   N  + +ITWFR GG AE +FQP D  DL  FL  +P +IP+T+VG+
Sbjct: 11  LGDRLAGLRGRLTPNAEMDKITWFRAGGLAEALFQPADEEDLAAFLKAVPEEIPLTVVGV 70

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
           GSN+LVRD GI G V+RLS  GF + EV +   +  GA    K +A  AL  GIGGFHF+
Sbjct: 71  GSNLLVRDGGIEGFVIRLSAKGFGDAEVISPIRIKAGAATPDKRVAAVALEAGIGGFHFY 130

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLI 189
           +GIPG+IGGA  MNAGAN  ET + V+EV  +DRKGN   +    + Y YR S     LI
Sbjct: 131 HGIPGAIGGALRMNAGANGVETRERVIEVRALDRKGNVQTLSNADMGYAYRHSAAPSGLI 190

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
            T  V  GF E +  I AA+  V +HRETVQPI+EKTGGSTFKNP G SAW+ I+K+GCR
Sbjct: 191 FTSAVFEGFAEDRATIKAAMEAVQNHRETVQPIREKTGGSTFKNPDGTSAWKEIDKAGCR 250

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           GL  GGA++S +HCNFMIN   ATGYDLEYLGE VR +V   SGI L+WEIKR+G+F
Sbjct: 251 GLMIGGAQMSPMHCNFMINTGTATGYDLEYLGETVRTRVLENSGIRLQWEIKRIGNF 307


>gi|13471547|ref|NP_103113.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Mesorhizobium loti
           MAFF303099]
 gi|30316111|sp|Q98KB5|MURB_RHILO RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|14022289|dbj|BAB48899.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Mesorhizobium loti
           MAFF303099]
          Length = 320

 Score =  341 bits (874), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 167/297 (56%), Positives = 203/297 (68%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           L +R   LRG+   N  + +ITWFR GG AEV FQP D  DL  FL  +P +IP+TIVG+
Sbjct: 10  LGDRLAGLRGRLTPNAEMDKITWFRAGGLAEVFFQPADEEDLAAFLRAVPEEIPLTIVGV 69

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
           GSN+LVRD GI G V+RLS  GF   E+ +   +  GA    K +A  AL  GIGGFHF+
Sbjct: 70  GSNLLVRDGGIPGFVIRLSAKGFGEAEIVSPIRIKAGAATPDKRVAALALEAGIGGFHFY 129

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLI 189
           +GIPG+IGGA  MNAGAN  ET + VVEV  +DRKGN   +   ++ Y YR S     LI
Sbjct: 130 HGIPGAIGGALRMNAGANGVETRERVVEVRALDRKGNVQTMSNAEMGYAYRHSAAPVGLI 189

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
            T  V  GF E +  I AA+  V +HRETVQPI+EKTGGSTFKNP G SAW+ I+K+GCR
Sbjct: 190 FTSAVFEGFAEDKATIKAAMDAVQNHRETVQPIREKTGGSTFKNPEGTSAWKEIDKAGCR 249

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           GL  GGA++S +HCNFMIN   ATGYDLEYLGE VR +V   SGI L+WEIKR+G+F
Sbjct: 250 GLMIGGAQMSPMHCNFMINTGTATGYDLEYLGETVRARVLEHSGIRLQWEIKRIGNF 306


>gi|260462092|ref|ZP_05810336.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Mesorhizobium
           opportunistum WSM2075]
 gi|259031952|gb|EEW33219.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Mesorhizobium
           opportunistum WSM2075]
          Length = 321

 Score =  340 bits (871), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 166/297 (55%), Positives = 203/297 (68%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           L +R   LRG+   N  + +ITWFR GG AE +FQP D  DL  FL  +P ++P+TIVG+
Sbjct: 11  LGDRLAGLRGRITPNAEMDKITWFRAGGLAEALFQPADEEDLAAFLKAVPEEVPMTIVGV 70

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
           GSN+LVRD GI G V+RLS  GF   EV +   +  GA    K +A  AL  GIGGFHF+
Sbjct: 71  GSNLLVRDGGIPGFVIRLSAKGFGEAEVISPIRIKAGAATPDKRVAAVALEAGIGGFHFY 130

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLI 189
           +GIPG+IGGA  MNAGAN  ET + VVEV  +DRKGN   +   ++ Y YR S     LI
Sbjct: 131 HGIPGAIGGALRMNAGANGVETRERVVEVRALDRKGNLLTLSNAEMGYAYRHSGAPSGLI 190

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
            T  V  GF E + +I AA+  V +HRETVQPI+EKTGGSTFKNP G SAW+ I+K+GCR
Sbjct: 191 FTSAVFEGFAEEKAVIKAAMDAVQNHRETVQPIREKTGGSTFKNPEGTSAWKEIDKAGCR 250

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           GL  GGA++S +HCNFMIN   ATGYDLEYLGE VR +V   SGI L WEIKR+G+F
Sbjct: 251 GLMIGGAQMSPMHCNFMINTGTATGYDLEYLGETVRARVLEHSGIRLHWEIKRIGNF 307


>gi|307944892|ref|ZP_07660229.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Roseibium sp.
           TrichSKD4]
 gi|307771816|gb|EFO31040.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Roseibium sp.
           TrichSKD4]
          Length = 323

 Score =  340 bits (871), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 158/289 (54%), Positives = 202/289 (69%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRD 77
           RGK   N PL  ITWFRTGG A+++FQP D  DL  FL+ LP DIP+  VGLGSN+L+RD
Sbjct: 18  RGKLTSNQPLASITWFRTGGPAQLLFQPADEADLAQFLSKLPKDIPVLPVGLGSNLLIRD 77

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G+ GVV+RLS  GF  IE   +  +  GA    K LA +A + G+GGF F+ GIPG++G
Sbjct: 78  GGLAGVVVRLSAKGFGAIEELANNRLRAGAAVPDKRLAEAAAKAGLGGFSFYAGIPGALG 137

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRG 197
           GA  MNAGA+  ET + +VE+  +DR G +HV+   ++ Y YR S  +KDLI T  V  G
Sbjct: 138 GALRMNAGAHGTETRERMVELTALDRDGARHVLTNAEMAYAYRHSGASKDLIFTSAVFEG 197

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P ++  I   +A+V  HRE  QPI+EKTGGSTFKNP G+SAW++++ +GCRGL  GGA+
Sbjct: 198 LPMNEETIRQEMADVQEHREKAQPIREKTGGSTFKNPPGNSAWKVVDAAGCRGLMVGGAQ 257

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           +SE+HCNFMIN   ATG+DLE LGE VR +V   SG+ LEWEIKRLGDF
Sbjct: 258 MSEMHCNFMINTGTATGHDLELLGETVRARVLKDSGVRLEWEIKRLGDF 306


>gi|254500893|ref|ZP_05113044.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Labrenzia alexandrii
           DFL-11]
 gi|222436964|gb|EEE43643.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Labrenzia alexandrii
           DFL-11]
          Length = 319

 Score =  337 bits (864), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 157/290 (54%), Positives = 200/290 (68%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RGK   N PL  +TWFRTGG A++MFQP D  DL  FL  LP DIP+  VGLGSN+L+R
Sbjct: 17  IRGKLTPNQPLSAVTWFRTGGPAQLMFQPADEDDLAVFLKKLPKDIPVLSVGLGSNLLIR 76

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G++GVV+RLS  GF  IE   +  +  GA    K LA +A + G+GGF F+ GIPG +
Sbjct: 77  DGGLKGVVVRLSAKGFGQIEELGNNRLRAGAAVPDKRLAEAAAKAGLGGFAFYTGIPGGL 136

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGA+  ET   ++E+  IDR GN+HV+    ++Y+YR S  + DLI T  V  
Sbjct: 137 GGALRMNAGAHGTETRDRMIELTAIDRDGNRHVLTNSDMEYRYRHSGASSDLIFTTAVFE 196

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G P+ +  I   +A V  HRE  QPI+EKTGGSTFKNP G+SAW++++ +GCRGL  GGA
Sbjct: 197 GVPQDEMTIREEMAAVVEHRENAQPIREKTGGSTFKNPDGNSAWKVVDAAGCRGLMVGGA 256

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           ++SE+HCNFMIN   ATG+DLE LGE VR K    +GI LEWEIKRLG+F
Sbjct: 257 QMSEMHCNFMINTGGATGHDLELLGETVRAKALEVTGIRLEWEIKRLGEF 306


>gi|254719460|ref|ZP_05181271.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella sp. 83/13]
 gi|265984466|ref|ZP_06097201.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella sp. 83/13]
 gi|306839239|ref|ZP_07472056.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella sp. NF
           2653]
 gi|264663058|gb|EEZ33319.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella sp. 83/13]
 gi|306405786|gb|EFM62048.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella sp. NF
           2653]
          Length = 322

 Score =  336 bits (862), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 160/297 (53%), Positives = 205/297 (69%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRG+   +  + +ITWFR GG A+V+FQP D  DL  FL  +P +IP+ +VG+GSN+LVR
Sbjct: 19  LRGRLTPDTGMDKITWFRAGGPAQVLFQPSDEEDLSAFLKAVPEEIPLLVVGIGSNLLVR 78

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ G V+RLS  GF  +E     ++  GA    K +A +AL  G+ GFHF++GIPG I
Sbjct: 79  DGGVPGFVVRLSAKGFGEVEQVCDTQLRAGAAAPDKRVAAAALEAGLVGFHFYHGIPGGI 138

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET + VVEV  +DRKG  HV+    + Y YR S  + DLI T V+  
Sbjct: 139 GGALRMNAGANGVETRERVVEVRALDRKGEVHVLSNADMGYAYRHSSASPDLIFTSVLFE 198

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G P  ++ I  A+  V HHRETVQP++EKTGGSTFKNP G SAW+ I+K+GCRGL  GGA
Sbjct: 199 GVPGERDDIRRAMDEVQHHRETVQPVREKTGGSTFKNPEGTSAWKEIDKAGCRGLRVGGA 258

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVD 313
           ++SE+HCNFMIN  NATG+DLE LGE VR +VF  SGI L WEIKRLG F + + ++
Sbjct: 259 QMSEMHCNFMINTGNATGHDLETLGETVRARVFENSGIRLHWEIKRLGLFREGERIE 315


>gi|319408822|emb|CBI82479.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella
           schoenbuchensis R1]
          Length = 325

 Score =  335 bits (858), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 164/304 (53%), Positives = 217/304 (71%)

Query: 15  KQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNIL 74
           K +RGKF  N  ++++TWFRTGG AE+ +QP D  DL  FL +LP  IPITIVG+GSN+L
Sbjct: 21  KNIRGKFTPNVEMRKVTWFRTGGLAELFYQPSDEADLALFLQVLPESIPITIVGIGSNLL 80

Query: 75  VRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPG 134
           VRD G+ GVV+RLS  GF  +E  +   ++VGA  + K LA +AL   + GFHF+YGIPG
Sbjct: 81  VRDGGVPGVVIRLSAKGFGQLEQVSPKHLLVGAATADKHLAAAALEAELSGFHFYYGIPG 140

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVV 194
           ++GGA  MNAGAN  ET++ VVEV+ +DRKG +HV+    + Y YR   ++++LI T  V
Sbjct: 141 NLGGALKMNAGANGIETAERVVEVYALDRKGERHVLSVNDMHYSYRHCNVSEELIFTAAV 200

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
           L G P +++ I AA+  V  HRE VQP++EKTGGSTF+NP G SAW++I+++GCRGL+ G
Sbjct: 201 LEGKPGNKDNIHAAMNEVVLHREKVQPVREKTGGSTFRNPKGTSAWRVIDEAGCRGLQIG 260

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVDA 314
           GA++S++HCNFMIN   ATGYDLE LGE VR +VF  S   LEWEI+RLG F    IV +
Sbjct: 261 GAQMSKMHCNFMINTGEATGYDLEQLGETVRARVFAHSAHYLEWEIQRLGQFEQDHIVPS 320

Query: 315 TKIF 318
              F
Sbjct: 321 FDQF 324


>gi|118590890|ref|ZP_01548290.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Stappia aggregata
           IAM 12614]
 gi|118436412|gb|EAV43053.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Stappia aggregata
           IAM 12614]
          Length = 323

 Score =  334 bits (857), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 159/306 (51%), Positives = 203/306 (66%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  +     E  + +RGK   N  L  +TWFRTGG A++MFQP D  DL  FL  LP 
Sbjct: 1   MAFADLLEQYPELAEGIRGKLTANQALSAVTWFRTGGPAQLMFQPADEDDLAAFLKKLPR 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           D+P+  VGLGSN+L+RD G++GVV+RLS  GF  IE      +  G     K LA +A +
Sbjct: 61  DVPVLPVGLGSNLLIRDGGLKGVVVRLSAKGFGAIEDIGGNRLKAGTAVPDKRLAEAAAK 120

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
            G+GGF F+ GIPG +GGA  MNAGA+  ET + +VE+  IDR GN+HV+    + Y YR
Sbjct: 121 AGLGGFAFYTGIPGGLGGALRMNAGAHGTETRERMVELTAIDRDGNRHVLANADMGYAYR 180

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
            S+ +KDLI T  V  G P+ +  I   +A+V  HRE  QPI+EKTGGSTFKNP G SAW
Sbjct: 181 HSDASKDLIFTSAVFEGVPQDEASIRQEMADVVAHRERAQPIREKTGGSTFKNPPGTSAW 240

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           + ++ +GCRGL  GGA++SELHCNFMIN   A+G+DLE LGE VR +V   SGI LEWEI
Sbjct: 241 KEVDAAGCRGLTIGGAQMSELHCNFMINTGTASGHDLELLGETVRSRVLAHSGIRLEWEI 300

Query: 301 KRLGDF 306
           KRLG+F
Sbjct: 301 KRLGEF 306


>gi|254470499|ref|ZP_05083903.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Pseudovibrio sp.
           JE062]
 gi|211960810|gb|EEA96006.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Pseudovibrio sp.
           JE062]
          Length = 324

 Score =  330 bits (845), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 156/311 (50%), Positives = 206/311 (66%)

Query: 3   YGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDI 62
           Y  +  LL +  + +RG+   N  L  +TWFR GG A++MFQP D  DL  F+  LP D+
Sbjct: 7   YPDLLPLLGDAVEDIRGRLIPNQLLSAVTWFRVGGPAQLMFQPADEADLAVFMKALPEDV 66

Query: 63  PITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHG 122
           P+T+VGLGSN+LVRD GI GVV+RL   GF  +E     ++  GA    K LA  A + G
Sbjct: 67  PVTVVGLGSNLLVRDGGIEGVVIRLPIRGFGQVEYLGGHKLRAGASVPDKKLAEEAAKTG 126

Query: 123 IGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS 182
            GGF F+ GIPG++GGA  MNAGA+  ET   VV V+ + R G    +  E++ Y YR S
Sbjct: 127 TGGFAFYTGIPGAVGGALRMNAGAHGTETKDRVVNVNAVTRSGEILTLSNEEMGYAYRHS 186

Query: 183 EITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
             +KDLI T  V  GF +S++ I A +A+V  HRE  QPI+EKTGGSTFKNP G+SAW++
Sbjct: 187 SASKDLIFTSAVFEGFAQSEDEIRAEMADVVAHREKAQPIREKTGGSTFKNPEGNSAWKV 246

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           ++ +GCRGL+ GGAK+SELHCNFM+N  +AT +DLE LGE VR +   ++G  LEWEIKR
Sbjct: 247 VDAAGCRGLQIGGAKMSELHCNFMLNVADATAHDLEMLGETVRSEALAKTGTRLEWEIKR 306

Query: 303 LGDFFDHQIVD 313
           LG F D   ++
Sbjct: 307 LGAFVDGAAIE 317


>gi|304392254|ref|ZP_07374196.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Ahrensia sp. R2A130]
 gi|303296483|gb|EFL90841.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Ahrensia sp. R2A130]
          Length = 315

 Score =  330 bits (845), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 159/290 (54%), Positives = 205/290 (70%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RG+   + P+ +ITWF+ GG A+++FQP D  DL  FL +LP+D+P+ +VG+GSN+LVR
Sbjct: 15  IRGRLTADAPMSKITWFQVGGPADLLFQPADEDDLSTFLKMLPADVPVMVVGIGSNLLVR 74

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GI GVV+RLS  GF  IE     ++  GA    K +A +AL  G+GGF F++GIPG+I
Sbjct: 75  DGGIDGVVIRLSGKGFGGIECVGDTQLRAGAAAPDKRVAAAALDAGLGGFAFYHGIPGAI 134

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET+  VVEV  IDR+G +H +    + Y YR S   KD+I T  +L 
Sbjct: 135 GGALRMNAGANGTETTNRVVEVSAIDRQGERHTLSHADMGYAYRHSGAAKDIIFTSALLE 194

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G P     I AA+  V HHRETVQPI+EKTGGSTFKNP GHS+W+L++ +G RG   GGA
Sbjct: 195 GEPADAADIRAAMDEVQHHRETVQPIREKTGGSTFKNPDGHSSWKLVDAAGLRGFSIGGA 254

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           ++SE+HCNFMIN   ATG+DLE LGE VR++VF  SG+LL WEIKRLG F
Sbjct: 255 QMSEMHCNFMINTGGATGHDLETLGETVRERVFADSGVLLNWEIKRLGRF 304


>gi|90418192|ref|ZP_01226104.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90337864|gb|EAS51515.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 318

 Score =  330 bits (845), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 166/304 (54%), Positives = 210/304 (69%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           L +R + +RG+   +  + +ITWFR GG AE++FQP D  DL  FL  LP +IP+ +VG+
Sbjct: 10  LGDRLETVRGRLTPDAGMDKITWFRAGGPAELLFQPADEADLATFLAALPEEIPVLVVGI 69

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
           GSN+LVRD G+ GVV+RLS  GF  +E      +  G     K LA +AL  G+GGFHF+
Sbjct: 70  GSNLLVRDGGVPGVVIRLSAKGFGQVERIGERTLRAGTALPDKRLAAAALEAGLGGFHFY 129

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLI 189
           +GIPG+IGGA  MNAGAN  ET + VVEV  +DR+G  HV+  E++ Y YR S  ++DLI
Sbjct: 130 HGIPGAIGGALRMNAGANGVETCERVVEVRALDRQGAVHVLTNEEMGYAYRHSAASRDLI 189

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
            T  V  G+P  +  I A +  V HHRETVQPI+EKTGGSTFKNP G SAW+ ++K+GCR
Sbjct: 190 FTSAVFEGYPAEEAEIRAKMDEVQHHRETVQPIREKTGGSTFKNPVGSSAWKEVDKAGCR 249

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDH 309
           GL  GGA +SELHCNFMIN  +AT YDLE LGE VR +V   SGI LEWEIKRLG F D 
Sbjct: 250 GLRVGGAHMSELHCNFMINDASATAYDLECLGETVRARVLEASGIRLEWEIKRLGRFRDG 309

Query: 310 QIVD 313
            +V+
Sbjct: 310 AVVE 313


>gi|240850890|ref|YP_002972290.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella grahamii
           as4aup]
 gi|240268013|gb|ACS51601.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella grahamii
           as4aup]
          Length = 327

 Score =  330 bits (845), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 157/290 (54%), Positives = 209/290 (72%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RGK   N  ++++TWFRTGG AE+ +QP D  DL  FL  LP  +P+TIVG+GSN+LVR
Sbjct: 25  VRGKLTPNVEMRKVTWFRTGGLAELFYQPVDEQDLALFLQNLPEFVPVTIVGIGSNLLVR 84

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ GVV+RLS   F  ++  +    +VGA  + K LA +AL+ GI GFHF++GIPG++
Sbjct: 85  DGGVPGVVIRLSPKNFGQVQQVSPKGFLVGAGTADKHLAVAALKAGIAGFHFYHGIPGAL 144

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET+  VVEV+ +DRKG +H++  + + Y YR  +I KD I T  +L 
Sbjct: 145 GGALKMNAGANGIETAARVVEVYALDRKGQRHILSLKDMHYSYRHCDIPKDFIFTAALLE 204

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G   +++ I AA+  V  HRETVQPI+EKTGGSTFKNP   SAW++I+++GCRGL+ GGA
Sbjct: 205 GKLGNKDDIRAAMDEVSLHRETVQPIREKTGGSTFKNPENGSAWRVIDEAGCRGLQIGGA 264

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           ++SE+HCNFMIN   ATGYDLE LGE VR +VF  S  LL+WEI+R+G F
Sbjct: 265 QMSEMHCNFMINTGQATGYDLEALGETVRARVFANSAHLLQWEIERIGQF 314


>gi|328542968|ref|YP_004303077.1| UDP-N-acetylenolpyruvoylglucosamine reductase [polymorphum gilvum
           SL003B-26A1]
 gi|326412714|gb|ADZ69777.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Polymorphum gilvum
           SL003B-26A1]
          Length = 317

 Score =  328 bits (842), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 157/296 (53%), Positives = 203/296 (68%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RGK   N PL  +TW R GG A+++FQP D  DL  FL  LP +IP+  +GLGSN+LVR
Sbjct: 17  VRGKLTANQPLAAVTWLRVGGPAQLLFQPADEDDLALFLAALPEEIPVLPIGLGSNLLVR 76

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GI GVV+RL+  GF  +EV +   + +GA    K +A +A   GIGGF F+ GIPG++
Sbjct: 77  DGGIEGVVVRLTGKGFGTVEVLDGARLRIGAAVPDKRVAEAAAEAGIGGFSFYAGIPGAL 136

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGA+  ET Q +VE+  +DR+GN+ V+    + Y YR S +  DLI T  VL 
Sbjct: 137 GGALRMNAGAHGTETCQRLVELAALDRRGNRIVLSNADMGYSYRHSAVPADLIFTGAVLA 196

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G P+++  I A +A V  HRE  QPI+EKTGGSTFKNP G SAW+ I+ +GCRGL+ GGA
Sbjct: 197 GTPQAEVEIRAEMAEVAAHRERAQPIREKTGGSTFKNPPGTSAWKEIDAAGCRGLQIGGA 256

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIV 312
           ++S++HCNFMIN  +AT +DLE LGE VR++V   SGI LEWEIKRLG F   Q V
Sbjct: 257 RMSDMHCNFMINTGDATAFDLELLGETVRRRVRAHSGICLEWEIKRLGRFLPGQGV 312


>gi|115311588|sp|Q6G126|MURB_BARQU RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
          Length = 321

 Score =  324 bits (831), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 159/298 (53%), Positives = 209/298 (70%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           ++GK   N  ++++TWFRTGG AE+ +QP D  DL  FL  LP  I +TIVG+GSN+LVR
Sbjct: 22  IKGKLTPNVDMRKVTWFRTGGLAELFYQPADEADLALFLKTLPEFISVTIVGIGSNLLVR 81

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GI GVV+RLS  GF  ++  +    +VGA  +GK LA +AL   I GFHF++GIPG +
Sbjct: 82  DGGIPGVVIRLSAKGFGQVQQVSPKRFLVGAATAGKHLAAAALEAEITGFHFYHGIPGGL 141

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET+  VVEV+ +DRKG  H++    + Y YR   I KD I T  +L 
Sbjct: 142 GGALKMNAGANGIETAARVVEVYALDRKGRHHILSLADMHYSYRHCAIPKDFIFTAALLE 201

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G P +++ I AA+  V  HRETVQP++EKTGGSTF+NP   SAW++I+++GCRGL+ GGA
Sbjct: 202 GEPGNRDDIRAAMDEVALHRETVQPVREKTGGSTFRNPENISAWRVIDEAGCRGLQIGGA 261

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVDA 314
           ++SE+HCNFMIN   ATGYDLE LGE VR +VF  S  LL+WEI+R+G F   +IV +
Sbjct: 262 QMSEMHCNFMINTGQATGYDLEALGETVRARVFAHSAHLLQWEIQRIGQFEQSRIVPS 319


>gi|49474454|ref|YP_032496.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella quintana
           str. Toulouse]
 gi|49239958|emb|CAF26363.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella quintana
           str. Toulouse]
          Length = 348

 Score =  323 bits (829), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 159/298 (53%), Positives = 209/298 (70%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           ++GK   N  ++++TWFRTGG AE+ +QP D  DL  FL  LP  I +TIVG+GSN+LVR
Sbjct: 49  IKGKLTPNVDMRKVTWFRTGGLAELFYQPADEADLALFLKTLPEFISVTIVGIGSNLLVR 108

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GI GVV+RLS  GF  ++  +    +VGA  +GK LA +AL   I GFHF++GIPG +
Sbjct: 109 DGGIPGVVIRLSAKGFGQVQQVSPKRFLVGAATAGKHLAAAALEAEITGFHFYHGIPGGL 168

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET+  VVEV+ +DRKG  H++    + Y YR   I KD I T  +L 
Sbjct: 169 GGALKMNAGANGIETAARVVEVYALDRKGRHHILSLADMHYSYRHCAIPKDFIFTAALLE 228

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G P +++ I AA+  V  HRETVQP++EKTGGSTF+NP   SAW++I+++GCRGL+ GGA
Sbjct: 229 GEPGNRDDIRAAMDEVALHRETVQPVREKTGGSTFRNPENISAWRVIDEAGCRGLQIGGA 288

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVDA 314
           ++SE+HCNFMIN   ATGYDLE LGE VR +VF  S  LL+WEI+R+G F   +IV +
Sbjct: 289 QMSEMHCNFMINTGQATGYDLEALGETVRARVFAHSAHLLQWEIQRIGQFEQSRIVPS 346


>gi|161619377|ref|YP_001593264.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella canis ATCC
           23365]
 gi|260566066|ref|ZP_05836536.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella suis bv. 4
           str. 40]
 gi|189028917|sp|A9M688|MURB_BRUC2 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|161336188|gb|ABX62493.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella canis ATCC
           23365]
 gi|260155584|gb|EEW90664.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella suis bv. 4
           str. 40]
          Length = 322

 Score =  323 bits (829), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 159/297 (53%), Positives = 204/297 (68%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRG+   +  + +ITWFR GG A+V+FQP D  DL  FL  +P +IP+ +VG+GSN+LVR
Sbjct: 19  LRGRLTPDTGMDKITWFRAGGPAQVLFQPSDEEDLSAFLKAVPEEIPLLVVGIGSNLLVR 78

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ G V+RLS  GF  +E     ++  GA    K +A +AL  G+  FHF++GIPG I
Sbjct: 79  DGGVPGFVVRLSAKGFGEVEQVCDTQLRAGAAAPDKRVAAAALEAGLADFHFYHGIPGGI 138

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET + VVEV  +DRKG  HV+    + Y YR S  + DLI T V+  
Sbjct: 139 GGALRMNAGANGVETRERVVEVRALDRKGEVHVLSNADMGYAYRHSSASPDLIFTSVLFE 198

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G P  ++ I  A+  V HHRETVQP++EKTGGSTFKNP G SAW+ I+K+GCRGL  GGA
Sbjct: 199 GVPGERDDIRRAMDEVQHHRETVQPVREKTGGSTFKNPEGTSAWKEIDKAGCRGLRVGGA 258

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVD 313
           ++SE+HCNFMIN  NATG+DLE LGE VR +VF  SGI L WEIKRLG F + + ++
Sbjct: 259 QMSEMHCNFMINTGNATGHDLETLGETVRARVFENSGIRLHWEIKRLGLFREGEQIE 315


>gi|306844328|ref|ZP_07476920.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella sp. BO1]
 gi|306275400|gb|EFM57141.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella sp. BO1]
          Length = 322

 Score =  323 bits (828), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 160/297 (53%), Positives = 205/297 (69%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRG+   +  + +ITWFR GG A+V+FQP D  DL  FL  +P +IP+ +VG+GSN+LVR
Sbjct: 19  LRGRLTPDTGMDKITWFRAGGPAQVLFQPSDEEDLSAFLKAVPEEIPLLVVGIGSNLLVR 78

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ G V+RLS  GF  +E     ++  GA    K +A +AL  G+ GFHF++GIPG I
Sbjct: 79  DGGVPGFVVRLSAKGFGEVEQVCDTQLRAGAAAPDKRVAAAALEAGLAGFHFYHGIPGGI 138

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET + VVEV  +DRKG  HV+    + Y YR S  + DLI T V+  
Sbjct: 139 GGALRMNAGANGVETRERVVEVRALDRKGEVHVLSNADMGYTYRHSSASPDLIFTSVLFE 198

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G P  ++ I  A+  V HHRETVQP++EKTGGSTFKNP G SAW+ I+K+GCRGL  GGA
Sbjct: 199 GVPGERDDIRRAMDEVQHHRETVQPVREKTGGSTFKNPEGTSAWKEIDKAGCRGLRVGGA 258

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVD 313
           ++SE+HCNFMIN  NATG+DLE LGE VR +VF  SGI L WEIKRLG F + + ++
Sbjct: 259 QMSEMHCNFMINTGNATGHDLETLGETVRARVFENSGIRLHWEIKRLGLFREGERIE 315


>gi|306843224|ref|ZP_07475835.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella sp. BO2]
 gi|306286589|gb|EFM58166.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella sp. BO2]
          Length = 322

 Score =  323 bits (828), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 160/297 (53%), Positives = 205/297 (69%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRG+   +  + +ITWFR GG A+V+FQP D  DL  FL  +P +IP+ +VG+GSN+LVR
Sbjct: 19  LRGRLTPDTGMDKITWFRAGGPAQVLFQPSDEEDLSAFLKAVPEEIPLLVVGIGSNLLVR 78

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ G V+RLS  GF  +E     ++  GA    K +A +AL  G+ GFHF++GIPG I
Sbjct: 79  DGGVPGFVVRLSAKGFGEVEQVCDTQLRAGAAVPDKRVAAAALEAGLAGFHFYHGIPGGI 138

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET + VVEV  +DRKG  HV+    + Y YR S  + DLI T V+  
Sbjct: 139 GGALRMNAGANGVETRERVVEVRALDRKGEVHVLSNADMGYAYRHSSASPDLIFTSVLFE 198

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G P  ++ I  A+  V HHRETVQP++EKTGGSTFKNP G SAW+ I+K+GCRGL  GGA
Sbjct: 199 GVPGERDDIRRAMDEVQHHRETVQPVREKTGGSTFKNPEGTSAWKEIDKAGCRGLRVGGA 258

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVD 313
           ++SE+HCNFMIN  NATG+DLE LGE VR +VF  SGI L WEIKRLG F + + ++
Sbjct: 259 QMSEMHCNFMINTGNATGHDLETLGETVRARVFENSGIRLHWEIKRLGLFREGERIE 315


>gi|148560533|ref|YP_001259322.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ovis ATCC
           25840]
 gi|225627880|ref|ZP_03785916.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ceti str.
           Cudo]
 gi|225852911|ref|YP_002733144.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           ATCC 23457]
 gi|254702150|ref|ZP_05163978.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella suis bv. 5
           str. 513]
 gi|254708101|ref|ZP_05169929.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella
           pinnipedialis M163/99/10]
 gi|254710470|ref|ZP_05172281.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella
           pinnipedialis B2/94]
 gi|254714463|ref|ZP_05176274.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ceti
           M644/93/1]
 gi|254717361|ref|ZP_05179172.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ceti
           M13/05/1]
 gi|256031964|ref|ZP_05445578.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella
           pinnipedialis M292/94/1]
 gi|256045059|ref|ZP_05447960.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|256113982|ref|ZP_05454765.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           bv. 3 str. Ether]
 gi|256263608|ref|ZP_05466140.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           bv. 2 str. 63/9]
 gi|256369845|ref|YP_003107356.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella microti CCM
           4915]
 gi|260169101|ref|ZP_05755912.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella sp. F5/99]
 gi|260565342|ref|ZP_05835826.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           bv. 1 str. 16M]
 gi|261219192|ref|ZP_05933473.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ceti
           M13/05/1]
 gi|261315604|ref|ZP_05954801.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella
           pinnipedialis M163/99/10]
 gi|261318042|ref|ZP_05957239.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella
           pinnipedialis B2/94]
 gi|261322253|ref|ZP_05961450.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ceti
           M644/93/1]
 gi|261758608|ref|ZP_06002317.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella sp. F5/99]
 gi|265989073|ref|ZP_06101630.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella
           pinnipedialis M292/94/1]
 gi|265991486|ref|ZP_06104043.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|265995324|ref|ZP_06107881.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           bv. 3 str. Ether]
 gi|294852755|ref|ZP_06793428.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella sp. NVSL
           07-0026]
 gi|30316085|sp|Q8YI64|MURB_BRUME RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|166222826|sp|A5VRH5|MURB_BRUO2 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|254764135|sp|C0RE68|MURB_BRUMB RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|148371790|gb|ABQ61769.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ovis ATCC
           25840]
 gi|225617043|gb|EEH14089.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ceti str.
           Cudo]
 gi|225641276|gb|ACO01190.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           ATCC 23457]
 gi|256000008|gb|ACU48407.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella microti CCM
           4915]
 gi|260151410|gb|EEW86504.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           bv. 1 str. 16M]
 gi|260924281|gb|EEX90849.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ceti
           M13/05/1]
 gi|261294943|gb|EEX98439.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ceti
           M644/93/1]
 gi|261297265|gb|EEY00762.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella
           pinnipedialis B2/94]
 gi|261304630|gb|EEY08127.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella
           pinnipedialis M163/99/10]
 gi|261738592|gb|EEY26588.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella sp. F5/99]
 gi|262766437|gb|EEZ12226.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           bv. 3 str. Ether]
 gi|263002270|gb|EEZ14845.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|263093659|gb|EEZ17664.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           bv. 2 str. 63/9]
 gi|264661270|gb|EEZ31531.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella
           pinnipedialis M292/94/1]
 gi|294821344|gb|EFG38343.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella sp. NVSL
           07-0026]
 gi|326409453|gb|ADZ66518.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           M28]
          Length = 322

 Score =  323 bits (828), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 160/297 (53%), Positives = 205/297 (69%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRG+   +  + +ITWFR GG A+V+FQP D  DL  FL  +P +IP+ +VG+GSN+LVR
Sbjct: 19  LRGRLTPDTGMDKITWFRAGGPAQVLFQPSDEEDLSAFLKAVPEEIPLLVVGIGSNLLVR 78

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ G V+RLS  GF  +E     ++  GA    K +A +AL  G+ GFHF++GIPG I
Sbjct: 79  DGGVPGFVVRLSAKGFGEVEQVCDTQLRAGAAAPDKRVAAAALEAGLAGFHFYHGIPGGI 138

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET + VVEV  +DRKG  HV+    + Y YR S  + DLI T V+  
Sbjct: 139 GGALRMNAGANGVETRERVVEVRALDRKGEVHVLSNADMGYAYRHSSASPDLIFTSVLFE 198

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G P  ++ I  A+  V HHRETVQP++EKTGGSTFKNP G SAW+ I+K+GCRGL  GGA
Sbjct: 199 GVPGERDDIRRAMDEVQHHRETVQPVREKTGGSTFKNPEGTSAWKEIDKAGCRGLRVGGA 258

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVD 313
           ++SE+HCNFMIN  NATG+DLE LGE VR +VF  SGI L WEIKRLG F + + ++
Sbjct: 259 QMSEMHCNFMINTGNATGHDLETLGETVRARVFENSGIRLHWEIKRLGLFREGEQIE 315


>gi|256160163|ref|ZP_05457857.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ceti
           M490/95/1]
 gi|256255369|ref|ZP_05460905.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ceti B1/94]
 gi|261222571|ref|ZP_05936852.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ceti B1/94]
 gi|265998536|ref|ZP_06111093.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ceti
           M490/95/1]
 gi|260921155|gb|EEX87808.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ceti B1/94]
 gi|262553160|gb|EEZ08994.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ceti
           M490/95/1]
          Length = 322

 Score =  323 bits (828), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 160/297 (53%), Positives = 205/297 (69%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRG+   +  + +ITWFR GG A+V+FQP D  DL  FL  +P +IP+ +VG+GSN+LVR
Sbjct: 19  LRGRLTPDTGMDKITWFRAGGPAQVLFQPSDEEDLSAFLKAVPEEIPLLVVGIGSNLLVR 78

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ G V+RLS  GF  +E     ++  GA    K +A +AL  G+ GFHF++GIPG I
Sbjct: 79  DGGVPGFVVRLSAKGFGEVEQVCDTQLRAGAAAPDKRVAAAALEAGLAGFHFYHGIPGGI 138

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET + VVEV  +DRKG  HV+    + Y YR S  + DLI T V+  
Sbjct: 139 GGALRMNAGANGVETRERVVEVRALDRKGEVHVLSNADMGYAYRHSSASPDLIFTSVLFE 198

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G P  ++ I  A+  V HHRETVQP++EKTGGSTFKNP G SAW+ I+K+GCRGL  GGA
Sbjct: 199 GVPGERDDIRRAMDEVQHHRETVQPVREKTGGSTFKNPEGTSAWKEIDKAGCRGLRVGGA 258

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVD 313
           ++SE+HCNFMIN  NATG+DLE LGE VR +VF  SGI L WEIKRLG F + + ++
Sbjct: 259 QMSEMHCNFMINTGNATGHDLETLGETVRARVFENSGIRLHWEIKRLGLFCEGEQIE 315


>gi|261752720|ref|ZP_05996429.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella suis bv. 5
           str. 513]
 gi|261742473|gb|EEY30399.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella suis bv. 5
           str. 513]
 gi|326539159|gb|ADZ87374.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           M5-90]
          Length = 321

 Score =  323 bits (828), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 160/297 (53%), Positives = 205/297 (69%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRG+   +  + +ITWFR GG A+V+FQP D  DL  FL  +P +IP+ +VG+GSN+LVR
Sbjct: 18  LRGRLTPDTGMDKITWFRAGGPAQVLFQPSDEEDLSAFLKAVPEEIPLLVVGIGSNLLVR 77

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ G V+RLS  GF  +E     ++  GA    K +A +AL  G+ GFHF++GIPG I
Sbjct: 78  DGGVPGFVVRLSAKGFGEVEQVCDTQLRAGAAAPDKRVAAAALEAGLAGFHFYHGIPGGI 137

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET + VVEV  +DRKG  HV+    + Y YR S  + DLI T V+  
Sbjct: 138 GGALRMNAGANGVETRERVVEVRALDRKGEVHVLSNADMGYAYRHSSASPDLIFTSVLFE 197

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G P  ++ I  A+  V HHRETVQP++EKTGGSTFKNP G SAW+ I+K+GCRGL  GGA
Sbjct: 198 GVPGERDDIRRAMDEVQHHRETVQPVREKTGGSTFKNPEGTSAWKEIDKAGCRGLRVGGA 257

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVD 313
           ++SE+HCNFMIN  NATG+DLE LGE VR +VF  SGI L WEIKRLG F + + ++
Sbjct: 258 QMSEMHCNFMINTGNATGHDLETLGETVRARVFENSGIRLHWEIKRLGLFREGEQIE 314


>gi|121601671|ref|YP_989226.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella
           bacilliformis KC583]
 gi|166222823|sp|A1UTC3|MURB_BARBK RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|120613848|gb|ABM44449.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella
           bacilliformis KC583]
          Length = 324

 Score =  323 bits (828), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 155/296 (52%), Positives = 208/296 (70%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           ++GK   N  ++++TWFRTGG AE+ +QP D  DL  F  +LP  +P+TIVG+GSN+LVR
Sbjct: 22  IKGKITPNVEMRKVTWFRTGGLAELFYQPADEDDLALFFKVLPEFVPVTIVGIGSNLLVR 81

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GI GVV+RLS   F  I+  +    +VGA  + K LA++AL   I GFHF++GIPG +
Sbjct: 82  DGGIPGVVIRLSTKSFGQIKQVSSTRFLVGAATADKHLASAALEAEISGFHFYHGIPGGL 141

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET++ VVEV+ +DRKG +H++    + Y YR   I + L+ T  +L 
Sbjct: 142 GGALKMNAGANGVETAERVVEVYALDRKGERHILNLRDMNYAYRHCNIPEGLVFTAALLE 201

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G   +++ I AA+  V  HRETVQPI+EKTGGSTF+N    SAW++I+++GCRGL+ GGA
Sbjct: 202 GDVGNKDDIRAAMHEVALHRETVQPIREKTGGSTFRNLEDISAWKVIDEAGCRGLQIGGA 261

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIV 312
           ++SE+HCNFMIN   ATGYDLE LGE VR +VFN S   LEWEI+R+G F   +IV
Sbjct: 262 QMSEMHCNFMINMGEATGYDLEKLGETVRARVFNHSAHHLEWEIQRIGQFEQDRIV 317


>gi|163843685|ref|YP_001628089.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella suis ATCC
           23445]
 gi|189028918|sp|B0CHL8|MURB_BRUSI RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|163674408|gb|ABY38519.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella suis ATCC
           23445]
          Length = 322

 Score =  323 bits (827), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 160/290 (55%), Positives = 201/290 (69%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRG+   +  + +ITWFR GG A+V+FQP D  DL  FL  +P +IP+ +VG+GSN+LVR
Sbjct: 19  LRGRLTPDTGMDKITWFRAGGPAQVLFQPSDEEDLSAFLKAVPEEIPLLVVGIGSNLLVR 78

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ G V+RLS  GF  +E     ++  GA    K +A +AL  G+ GFHF++GIPG I
Sbjct: 79  DGGVPGFVVRLSAKGFGEVEQVCDTQLRAGAAAPDKRVAAAALEAGLAGFHFYHGIPGGI 138

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET + VVEV  +DRKG  HV+    + Y YR S  + DLI T V+  
Sbjct: 139 GGALRMNAGANGVETRERVVEVRALDRKGEVHVLSNADMGYAYRHSSASPDLIFTSVLFE 198

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G P  ++ I  A+  V HHRETVQP++EKTGGSTFKNP G SAW+ I+K+GCRGL  GGA
Sbjct: 199 GVPGERDDIRRAMDEVQHHRETVQPVREKTGGSTFKNPEGTSAWKEIDKAGCRGLRVGGA 258

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           ++SE+HCNFMIN  NATG+DLE LGE VR +VF  SGI L WEIKRLG F
Sbjct: 259 QMSEMHCNFMINTGNATGHDLETLGETVRARVFENSGIRLHWEIKRLGLF 308


>gi|23502300|ref|NP_698427.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella suis 1330]
 gi|30316053|sp|Q8FZP4|MURB_BRUSU RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|23348276|gb|AAN30342.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella suis 1330]
          Length = 322

 Score =  323 bits (827), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 159/297 (53%), Positives = 205/297 (69%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRG+   +  + +ITWFR GG A+V+FQP D  DL  FL  +P +IP+ +VG+GSN+LVR
Sbjct: 19  LRGRLTPDTGMDKITWFRAGGPAQVLFQPSDEEDLSAFLKAVPEEIPLLVVGIGSNLLVR 78

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ G V+RLS  GF  +E     ++  GA    K +A +AL  G+ GFHF++GIPG +
Sbjct: 79  DGGVPGFVVRLSAKGFGEVEQVCDTQLRAGAAAPDKRVAAAALEAGLAGFHFYHGIPGGV 138

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET + VVEV  +DRKG  HV+    + Y YR S  + DLI T V+  
Sbjct: 139 GGALRMNAGANGVETRERVVEVRALDRKGEVHVLSNADMGYAYRHSSASPDLIFTSVLFE 198

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G P  ++ I  A+  V HHRETVQP++EKTGGSTFKNP G SAW+ I+K+GCRGL  GGA
Sbjct: 199 GVPGERDDIRRAMDEVQHHRETVQPVREKTGGSTFKNPEGTSAWKEIDKAGCRGLRVGGA 258

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVD 313
           ++SE+HCNFMIN  NATG+DLE LGE VR +VF  SGI L WEIKRLG F + + ++
Sbjct: 259 QMSEMHCNFMINTGNATGHDLETLGETVRARVFENSGIRLHWEIKRLGLFREGEQIE 315


>gi|319407501|emb|CBI81149.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella sp. 1-1C]
          Length = 325

 Score =  322 bits (826), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 158/296 (53%), Positives = 208/296 (70%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           ++GK   N  ++++TWFRTGG AE+ +QP D  DL  F   LP  IPITIVG+GSN+LVR
Sbjct: 23  IQGKLMPNVDMRKVTWFRTGGIAEIFYQPSDEADLVLFFQSLPESIPITIVGIGSNLLVR 82

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GI GVV+RLS  GF  +E  +    +VGA  +GK LA +AL   + GFHF++GIPG  
Sbjct: 83  DGGIPGVVVRLSAKGFGQLEQVSSKRFLVGAAVAGKHLAAAALEAELSGFHFYHGIPGGC 142

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET++ VVEV+ +DRKG +H++    + Y YR  ++  D +    +L 
Sbjct: 143 GGALKMNAGANGIETAERVVEVYALDRKGQRHILSVNDIHYSYRCCDVPDDFVFVAALLE 202

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G    +N I AA+  V  HR+ VQPI+EKTGGSTF+NP G SAW++I+++GCRGL+ GGA
Sbjct: 203 GEQGHRNHIRAAMEEVALHRQKVQPIREKTGGSTFRNPVGTSAWRVIDEAGCRGLKIGGA 262

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIV 312
           ++SE+HCNFMIN D ATGYDLE LGE VR +VF  SG LL+WEI+R+G F   +IV
Sbjct: 263 QMSEMHCNFMINIDQATGYDLEKLGETVRARVFAHSGHLLQWEIQRIGQFEQDRIV 318


>gi|17986864|ref|NP_539498.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           bv. 1 str. 16M]
 gi|17982502|gb|AAL51762.1| udp-n-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           bv. 1 str. 16M]
          Length = 304

 Score =  322 bits (824), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 159/297 (53%), Positives = 205/297 (69%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RG+   +  + +ITWFR GG A+V+FQP D  DL  FL  +P +IP+ +VG+GSN+LVR
Sbjct: 1   MRGRLTPDTGMDKITWFRAGGPAQVLFQPSDEEDLSAFLKAVPEEIPLLVVGIGSNLLVR 60

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ G V+RLS  GF  +E     ++  GA    K +A +AL  G+ GFHF++GIPG I
Sbjct: 61  DGGVPGFVVRLSAKGFGEVEQVCDTQLRAGAAAPDKRVAAAALEAGLAGFHFYHGIPGGI 120

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET + VVEV  +DRKG  HV+    + Y YR S  + DLI T V+  
Sbjct: 121 GGALRMNAGANGVETRERVVEVRALDRKGEVHVLSNADMGYAYRHSSASPDLIFTSVLFE 180

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G P  ++ I  A+  V HHRETVQP++EKTGGSTFKNP G SAW+ I+K+GCRGL  GGA
Sbjct: 181 GVPGERDDIRRAMDEVQHHRETVQPVREKTGGSTFKNPEGTSAWKEIDKAGCRGLRVGGA 240

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVD 313
           ++SE+HCNFMIN  NATG+DLE LGE VR +VF  SGI L WEIKRLG F + + ++
Sbjct: 241 QMSEMHCNFMINTGNATGHDLETLGETVRARVFENSGIRLHWEIKRLGLFREGEQIE 297


>gi|153009076|ref|YP_001370291.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Ochrobactrum
           anthropi ATCC 49188]
 gi|187609732|sp|A6WZQ8|MURB_OCHA4 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|151560964|gb|ABS14462.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Ochrobactrum
           anthropi ATCC 49188]
          Length = 320

 Score =  322 bits (824), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 158/297 (53%), Positives = 202/297 (68%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRG+   +  + +ITWFR GG A+V+FQP D  DL  FL  +P ++PI +VG+GSN+LVR
Sbjct: 18  LRGRLTPDTGMDKITWFRAGGPAQVLFQPADEEDLSSFLKAVPEEVPILVVGIGSNLLVR 77

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ G V+RLS  GF  ++  +  ++  GA    K +A +AL  G+ GFHF++GIPG +
Sbjct: 78  DGGVPGFVVRLSAKGFGEVDQVSETQLRAGAATPDKRVAAAALEAGLAGFHFYHGIPGGM 137

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET + VVEV  +DRKG  HV+    + Y YR S  + DLI T V+  
Sbjct: 138 GGALRMNAGANGVETRERVVEVRALDRKGEVHVLSNADMGYAYRHSSASSDLIFTSVLFE 197

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G P     I  A+  V HHRETVQP++EKTGGSTFKNP G SAW+ I+K+GCRGL  GGA
Sbjct: 198 GTPGEHEAIKQAMDEVQHHRETVQPVREKTGGSTFKNPEGTSAWKEIDKAGCRGLRVGGA 257

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVD 313
           ++SE+HCNFMIN   ATG DLE LGE VR +VF  SGI L WEIKRLG F + + V+
Sbjct: 258 QMSEMHCNFMINTGTATGLDLETLGETVRARVFENSGIRLHWEIKRLGLFREGEAVE 314


>gi|256061486|ref|ZP_05451630.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella neotomae
           5K33]
 gi|261325493|ref|ZP_05964690.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella neotomae
           5K33]
 gi|261301473|gb|EEY04970.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella neotomae
           5K33]
          Length = 322

 Score =  321 bits (823), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 159/297 (53%), Positives = 204/297 (68%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRG+   +  + +ITWFR GG A+V+FQP D  DL  FL  +P +IP+ +VG+GSN+LVR
Sbjct: 19  LRGRLTPDTGMDKITWFRAGGPAQVLFQPSDEEDLSAFLKAVPEEIPLLVVGIGSNLLVR 78

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ G V+RLS  GF  +E     ++  GA    K +A +AL  G+ GFHF++GIPG I
Sbjct: 79  DGGVPGFVVRLSAKGFGEVEQVCDTQLRAGAAAPDKRVAAAALEAGLAGFHFYHGIPGGI 138

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET + VVEV  +DRKG  HV+    + Y YR S  + DLI T V+  
Sbjct: 139 GGALRMNAGANGVETRERVVEVRALDRKGEVHVLSNADMGYAYRHSSASPDLIFTSVLFE 198

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G P  ++ I  A+  V HHRETVQP++EKTGGSTFKNP G SAW+ I+K+GCRGL  GGA
Sbjct: 199 GVPGERDDIRRAMDEVQHHRETVQPVREKTGGSTFKNPEGTSAWKEIDKAGCRGLRVGGA 258

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVD 313
           ++SE+HCNFMIN  NA G+DLE LGE VR +VF  SGI L WEIKRLG F + + ++
Sbjct: 259 QMSEMHCNFMINTGNAAGHDLETLGETVRARVFENSGIRLHWEIKRLGLFREGEQIE 315


>gi|163868711|ref|YP_001609923.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella
           tribocorum CIP 105476]
 gi|187609724|sp|A9IWA3|MURB_BART1 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|161018370|emb|CAK01928.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella
           tribocorum CIP 105476]
          Length = 327

 Score =  320 bits (821), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 156/290 (53%), Positives = 208/290 (71%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RGK   N  ++++TWFRTGG AE+ +QP D  DL  FL  LP  +P+TIVG+GSN+LVR
Sbjct: 25  IRGKLTPNVEMRKVTWFRTGGLAELFYQPVDEEDLALFLHNLPECVPVTIVGIGSNLLVR 84

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ GVV+RLS   F  ++  +    +VGA  + K LA +AL+  I GFHF++GIPG +
Sbjct: 85  DGGVPGVVIRLSPKNFGQVQQVSSKGFLVGAGTADKHLAAAALKAEIAGFHFYHGIPGGL 144

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET+  VVEV+ +DRKG +H++  + + Y YR  +I +D I T  +L 
Sbjct: 145 GGALKMNAGANGVETAARVVEVYALDRKGQRHILSLKDMHYSYRHCDIPEDFIFTAALLE 204

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G P +++ I AA+  V  HRETVQPI+EKTGGSTFKNP   SAW++I+++GCRGL+ GGA
Sbjct: 205 GEPGNKDAIRAAMDEVALHRETVQPIREKTGGSTFKNPKDTSAWRVIDEAGCRGLQIGGA 264

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           ++SE+HCNFMIN   ATGYDLE LGE VR +VF  S  LL+WEI+R+G F
Sbjct: 265 QMSEMHCNFMINTGQATGYDLEALGETVRARVFAHSAHLLQWEIERIGQF 314


>gi|62290322|ref|YP_222115.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus bv.
           1 str. 9-941]
 gi|82700246|ref|YP_414820.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           biovar Abortus 2308]
 gi|189024555|ref|YP_001935323.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus
           S19]
 gi|237815829|ref|ZP_04594826.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus
           str. 2308 A]
 gi|254689623|ref|ZP_05152877.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus bv.
           6 str. 870]
 gi|254694113|ref|ZP_05155941.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus bv.
           3 str. Tulya]
 gi|254697765|ref|ZP_05159593.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus bv.
           2 str. 86/8/59]
 gi|254730654|ref|ZP_05189232.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus bv.
           4 str. 292]
 gi|256257873|ref|ZP_05463409.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus bv.
           9 str. C68]
 gi|260546864|ref|ZP_05822603.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus
           NCTC 8038]
 gi|260758370|ref|ZP_05870718.1| UDP-N-acetylmuramate dehydrogenase [Brucella abortus bv. 4 str.
           292]
 gi|260884164|ref|ZP_05895778.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus bv.
           9 str. C68]
 gi|297248709|ref|ZP_06932427.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus bv.
           5 str. B3196]
 gi|75496537|sp|Q57C80|MURB_BRUAB RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|123546261|sp|Q2YLY7|MURB_BRUA2 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|254764134|sp|B2S6Q2|MURB_BRUA1 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|62196454|gb|AAX74754.1| MurB, UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella
           abortus bv. 1 str. 9-941]
 gi|82616347|emb|CAJ11404.1| Helix-turn-helix, AraC type:UDP-N-acetylenolpyruvoylglucosamine
           reductase:FAD linked oxidase, N-terminal [Brucella
           melitensis biovar Abortus 2308]
 gi|189020127|gb|ACD72849.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus
           S19]
 gi|237789127|gb|EEP63338.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus
           str. 2308 A]
 gi|260095914|gb|EEW79791.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus
           NCTC 8038]
 gi|260668688|gb|EEX55628.1| UDP-N-acetylmuramate dehydrogenase [Brucella abortus bv. 4 str.
           292]
 gi|260873692|gb|EEX80761.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus bv.
           9 str. C68]
 gi|297175878|gb|EFH35225.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus bv.
           5 str. B3196]
          Length = 322

 Score =  320 bits (820), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 159/297 (53%), Positives = 204/297 (68%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRG+   +  + +ITWFR GG A+V+FQP D  DL  FL  +P +IP+ +VG+GSN+LVR
Sbjct: 19  LRGRLTPDTGMDKITWFRAGGPAQVLFQPSDEEDLSAFLKAVPEEIPLLVVGIGSNLLVR 78

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ G V+RLS  GF  +E     ++  GA    K +A +AL  G+ GFHF++GIPG I
Sbjct: 79  DGGVPGFVVRLSAKGFGEVEQVCDTQLRAGAAAPDKRVAAAALEAGLAGFHFYHGIPGGI 138

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET + VVEV  +DRKG  HV+    + Y YR S  + DLI T V+  
Sbjct: 139 GGALRMNAGANGVETRERVVEVRALDRKGEVHVLSNADMGYAYRHSSASPDLIFTSVLFE 198

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G P  ++ I  A+  V HHRETVQP++EKTGGSTFKN  G SAW+ I+K+GCRGL  GGA
Sbjct: 199 GVPGERDDIRRAMDEVQHHRETVQPVREKTGGSTFKNSEGTSAWKEIDKAGCRGLRVGGA 258

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVD 313
           ++SE+HCNFMIN  NATG+DLE LGE VR +VF  SGI L WEIKRLG F + + ++
Sbjct: 259 QMSEMHCNFMINTGNATGHDLETLGETVRARVFENSGIRLHWEIKRLGLFREGEQIE 315


>gi|260755151|ref|ZP_05867499.1| UDP-N-acetylmuramate dehydrogenase [Brucella abortus bv. 6 str.
           870]
 gi|260762196|ref|ZP_05874539.1| UDP-N-acetylmuramate dehydrogenase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|261214413|ref|ZP_05928694.1| UDP-N-acetylmuramate dehydrogenase [Brucella abortus bv. 3 str.
           Tulya]
 gi|260672628|gb|EEX59449.1| UDP-N-acetylmuramate dehydrogenase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675259|gb|EEX62080.1| UDP-N-acetylmuramate dehydrogenase [Brucella abortus bv. 6 str.
           870]
 gi|260916020|gb|EEX82881.1| UDP-N-acetylmuramate dehydrogenase [Brucella abortus bv. 3 str.
           Tulya]
          Length = 321

 Score =  320 bits (819), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 159/297 (53%), Positives = 204/297 (68%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRG+   +  + +ITWFR GG A+V+FQP D  DL  FL  +P +IP+ +VG+GSN+LVR
Sbjct: 18  LRGRLTPDTGMDKITWFRAGGPAQVLFQPSDEEDLSAFLKAVPEEIPLLVVGIGSNLLVR 77

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ G V+RLS  GF  +E     ++  GA    K +A +AL  G+ GFHF++GIPG I
Sbjct: 78  DGGVPGFVVRLSAKGFGEVEQVCDTQLRAGAAAPDKRVAAAALEAGLAGFHFYHGIPGGI 137

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET + VVEV  +DRKG  HV+    + Y YR S  + DLI T V+  
Sbjct: 138 GGALRMNAGANGVETRERVVEVRALDRKGEVHVLSNADMGYAYRHSSASPDLIFTSVLFE 197

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G P  ++ I  A+  V HHRETVQP++EKTGGSTFKN  G SAW+ I+K+GCRGL  GGA
Sbjct: 198 GVPGERDDIRRAMDEVQHHRETVQPVREKTGGSTFKNSEGTSAWKEIDKAGCRGLRVGGA 257

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVD 313
           ++SE+HCNFMIN  NATG+DLE LGE VR +VF  SGI L WEIKRLG F + + ++
Sbjct: 258 QMSEMHCNFMINTGNATGHDLETLGETVRARVFENSGIRLHWEIKRLGLFREGEQIE 314


>gi|319404508|emb|CBI78113.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella
           rochalimae ATCC BAA-1498]
          Length = 325

 Score =  320 bits (819), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 155/296 (52%), Positives = 209/296 (70%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RGK   N  ++++TWFRTGG AE+ +QP D  DL  F   LP  IP+TIVG+GSN+LVR
Sbjct: 23  IRGKLMPNVNMRKVTWFRTGGLAEIFYQPSDEADLVLFFQSLPETIPVTIVGIGSNLLVR 82

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GI G+V+RLS  GF  ++  +    +VGA  +GK LA +AL   + GFHF++GIPG  
Sbjct: 83  DGGIPGIVVRLSAKGFGQLKQVSSKRFLVGAAVAGKHLAAAALEAELSGFHFYHGIPGGC 142

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET++ VVEV+ +DRKG +H++    + Y YR  ++  D +    +L 
Sbjct: 143 GGALKMNAGANGIETAERVVEVYALDRKGQRHILSVNDIHYSYRCCDVPDDFVFVAALLE 202

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G   +++ I AA+  V  HR+ VQPI+EKTGGSTF+NP G SAW++I+++GCRGL+ GGA
Sbjct: 203 GEQGNRHHIRAAMEEVALHRQKVQPIREKTGGSTFRNPVGTSAWRVIDEAGCRGLKIGGA 262

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIV 312
           ++SE+HCNFMIN D ATGYDLE LGE VR +VF  SG LL+WEI+R+G F   +IV
Sbjct: 263 QMSEMHCNFMINIDQATGYDLEKLGETVRARVFAHSGHLLQWEIQRIGQFEQDRIV 318


>gi|319406004|emb|CBI79635.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella sp. AR
           15-3]
          Length = 325

 Score =  318 bits (814), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 154/298 (51%), Positives = 209/298 (70%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           ++GK   N  ++++TWFRTGG AE+ +QP D  DL  F   LP  IP+TIVG+GSN+LVR
Sbjct: 23  IQGKLTPNVDMRKVTWFRTGGLAEIFYQPSDEADLVLFFQSLPESIPVTIVGIGSNLLVR 82

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GI GVV+RLS  GF  ++  +    +VGA  +GK LA +AL   + GFHF++GIPG  
Sbjct: 83  DGGIPGVVIRLSAKGFGQLKQVSSKRFLVGAAVAGKHLAAAALEAELSGFHFYHGIPGCC 142

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET++ VVEV+ +DRKG +H++  + + Y YR  ++  D +    +L 
Sbjct: 143 GGALKMNAGANGIETAERVVEVYALDRKGQRHILSVKDIHYSYRCCDVPDDFVFIAALLE 202

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G   ++N I  A+  V  HR+ VQPI+EKTGGSTF+NP G  AW++I+++GCRGL+ GGA
Sbjct: 203 GEQGNRNYIRTAMDEVALHRQKVQPIREKTGGSTFRNPVGTFAWRVIDEAGCRGLKIGGA 262

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVDA 314
           ++SE+HCNFMIN D ATGYDLE LGE VR +VF  SG LL+WEI+R+G F   +IV +
Sbjct: 263 QMSEMHCNFMINIDQATGYDLEKLGETVRARVFAHSGHLLQWEIQRIGQFEQGRIVSS 320


>gi|47779264|gb|AAT38532.1| MurB [Bartonella bacilliformis]
          Length = 325

 Score =  317 bits (812), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 153/296 (51%), Positives = 206/296 (69%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           ++GK   N  ++++TWFRTGG AE+ +QP D  DL  F  +LP  +P+TI G+GSN+LVR
Sbjct: 23  IKGKITPNVEMRKVTWFRTGGLAELFYQPADEDDLSLFFKVLPEFVPVTIGGIGSNLLVR 82

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GI GVV+RLS   F  I+  +    +VGA  + K LA++AL   I GFHF++GIPG +
Sbjct: 83  DGGIPGVVIRLSTKSFGQIKQVSSTRFLVGAATADKHLASAALEAEISGFHFYHGIPGGL 142

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET++ VVEV+ +DRKG +H++    + Y YR   I + L+ T  +L 
Sbjct: 143 GGALKMNAGANGVETAERVVEVYALDRKGERHILNLRDMNYAYRHCNIPEGLVFTAALLE 202

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G   +++ I AA+  V  HRETVQPI+EKTGGSTF+N    SAW++I+++GCRGL+ GGA
Sbjct: 203 GDVGNKDDIRAAMHEVALHRETVQPIREKTGGSTFRNLEDISAWKVIDEAGCRGLQIGGA 262

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIV 312
           ++SE+HCNFMIN   ATGYDLE LGE  R +VFN S   LEWEI+R+G F   +IV
Sbjct: 263 QMSEMHCNFMINMGEATGYDLEKLGETGRARVFNHSAHHLEWEIQRIGQFEQDRIV 318


>gi|115311587|sp|Q6G2Q7|MURB_BARHE RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
          Length = 325

 Score =  315 bits (806), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 155/302 (51%), Positives = 208/302 (68%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           ++GK   N  ++++TWFRTGG AE+ +QP D  DL +FL  LP  IP+TIVG+GSN+LVR
Sbjct: 23  IKGKLTPNMDMQKVTWFRTGGLAELFYQPADEVDLAFFLQNLPESIPVTIVGIGSNLLVR 82

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GI GVV+RLS  GF  ++  +    +VGA  + K LA +AL   I GFHF++GIPG +
Sbjct: 83  DGGIPGVVIRLSAKGFGQVQQVSPTGFLVGAATADKHLAAAALEAEIAGFHFYHGIPGGL 142

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET+  VVEV+ +DR+G  H +    + Y YR   + +D I T  +L 
Sbjct: 143 GGALKMNAGANGVETAARVVEVYALDRRGQCHTLSLADMHYSYRHCAVPEDFIFTAALLE 202

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G P ++  I AA+  V  HRE+VQP++EKTGGSTF+NP   SAW++I+++GCRGL+ GGA
Sbjct: 203 GKPGNKGDIRAAMDEVALHRESVQPVREKTGGSTFRNPKDISAWRVIDEAGCRGLQIGGA 262

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVDATK 316
           ++SE+HCNFMIN   AT YDLE LGE VR +VF  S  LL+WEI+R+G F   +IV +  
Sbjct: 263 QMSEMHCNFMINTGQATAYDLEALGETVRARVFAYSSHLLQWEIQRIGQFEQGRIVSSFD 322

Query: 317 IF 318
            F
Sbjct: 323 PF 324


>gi|49475853|ref|YP_033894.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella henselae
           str. Houston-1]
 gi|49238661|emb|CAF27907.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella henselae
           str. Houston-1]
          Length = 351

 Score =  314 bits (804), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 155/302 (51%), Positives = 208/302 (68%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           ++GK   N  ++++TWFRTGG AE+ +QP D  DL +FL  LP  IP+TIVG+GSN+LVR
Sbjct: 49  IKGKLTPNMDMQKVTWFRTGGLAELFYQPADEVDLAFFLQNLPESIPVTIVGIGSNLLVR 108

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GI GVV+RLS  GF  ++  +    +VGA  + K LA +AL   I GFHF++GIPG +
Sbjct: 109 DGGIPGVVIRLSAKGFGQVQQVSPTGFLVGAATADKHLAAAALEAEIAGFHFYHGIPGGL 168

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET+  VVEV+ +DR+G  H +    + Y YR   + +D I T  +L 
Sbjct: 169 GGALKMNAGANGVETAARVVEVYALDRRGQCHTLSLADMHYSYRHCAVPEDFIFTAALLE 228

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G P ++  I AA+  V  HRE+VQP++EKTGGSTF+NP   SAW++I+++GCRGL+ GGA
Sbjct: 229 GKPGNKGDIRAAMDEVALHRESVQPVREKTGGSTFRNPKDISAWRVIDEAGCRGLQIGGA 288

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVDATK 316
           ++SE+HCNFMIN   AT YDLE LGE VR +VF  S  LL+WEI+R+G F   +IV +  
Sbjct: 289 QMSEMHCNFMINTGQATAYDLEALGETVRARVFAYSSHLLQWEIQRIGQFEQGRIVSSFD 348

Query: 317 IF 318
            F
Sbjct: 349 PF 350


>gi|239832307|ref|ZP_04680636.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Ochrobactrum
           intermedium LMG 3301]
 gi|239824574|gb|EEQ96142.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Ochrobactrum
           intermedium LMG 3301]
          Length = 320

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 157/297 (52%), Positives = 200/297 (67%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRG+   +  + +ITWFR GG A+V+FQP D  DL  FL  +P +IPI +VG+GSN+LVR
Sbjct: 18  LRGRLTADAGMDKITWFRAGGPAQVLFQPADEEDLSAFLKAVPEEIPILVVGIGSNLLVR 77

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ G V+RLS  GF  +E  +  ++  GA    K +A +AL  G+ GFHF++GIPG I
Sbjct: 78  DGGVPGFVVRLSAKGFGEVEQVSDTQLRAGAATPDKRVAAAALDAGLAGFHFYHGIPGGI 137

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET + VVEV  +DR G   V+    + Y YR S  +  LI T V+  
Sbjct: 138 GGALRMNAGANGVETRERVVEVRALDRNGEVQVLSNVDMGYAYRHSSASPGLIFTSVLFE 197

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G    ++ I  A+  V HHRETVQP++EKTGGSTFKNP G SAW+ I+K+GCRGL  GGA
Sbjct: 198 GIAGERDAIRQAMDEVQHHRETVQPVREKTGGSTFKNPEGTSAWKEIDKAGCRGLRVGGA 257

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVD 313
           ++SE+HCNFMIN   ATG DLE LGE VR +VF  SGI L WEIKRLG F + + V+
Sbjct: 258 QMSEMHCNFMINTGTATGLDLETLGETVRARVFENSGIRLHWEIKRLGLFREGEPVE 314


>gi|319899155|ref|YP_004159248.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella
           clarridgeiae 73]
 gi|319403119|emb|CBI76677.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella
           clarridgeiae 73]
          Length = 325

 Score =  313 bits (802), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 153/298 (51%), Positives = 207/298 (69%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           ++GK   N  ++++TWFRTGG AE+ +QP D  DL  F   LP  IP+TIVG+GSN+LVR
Sbjct: 23  IQGKLTPNVDMRKVTWFRTGGLAEIFYQPSDEADLVLFFQSLPESIPVTIVGIGSNLLVR 82

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GI GVV+RLS  GF  ++  +    +VGA  +GK LA +AL   + GFHF++GIPG  
Sbjct: 83  DGGIPGVVIRLSAKGFGQLKQVSSKRFLVGAAVAGKHLAAAALEAELSGFHFYHGIPGGC 142

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET++ V+EV+ +DRKG +H++    + Y YR  +I  D +    +  
Sbjct: 143 GGALKMNAGANGVETAERVIEVYALDRKGQRHILSVNDIHYSYRCCDIPDDFVFIAALFE 202

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G   ++N I AA+  V  HR+ VQPI+EKTGGSTF+NP G SAW++I+++GCRGL+ GGA
Sbjct: 203 GERGNRNYIRAAMDEVALHRQMVQPIREKTGGSTFRNPVGTSAWRVIDEAGCRGLKIGGA 262

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVDA 314
           ++S++HCNFMIN   ATGYDLE LGE VR +VF  SG LL+WEI+R+G F    IV +
Sbjct: 263 QMSKMHCNFMINTGQATGYDLEKLGEVVRARVFAHSGHLLQWEIQRIGQFEQGCIVPS 320


>gi|86749121|ref|YP_485617.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodopseudomonas
           palustris HaA2]
 gi|123408334|sp|Q2IYK4|MURB_RHOP2 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|86572149|gb|ABD06706.1| UDP-N-acetylmuramate dehydrogenase [Rhodopseudomonas palustris
           HaA2]
          Length = 309

 Score =  313 bits (801), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 150/296 (50%), Positives = 199/296 (67%), Gaps = 3/296 (1%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           L+     LRG+   N PL  +TWFR GG A+V+F P D  DL YFL+LLP+++P+  +G+
Sbjct: 9   LKAAMPDLRGRLLGNEPLAPLTWFRVGGPAQVLFTPADEDDLGYFLSLLPAEVPVLCIGV 68

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMI-VGARCSGKSLANSALRHGIGGFHF 128
           GSN++VRD G+ GVV+RL+  GF   E R+  E +  GA    K +A +A    +GG  F
Sbjct: 69  GSNLIVRDGGLPGVVIRLAPRGFG--EARSDGETVHAGAAALDKRVAETAAAAQLGGLEF 126

Query: 129 FYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL 188
           ++GIPG+IGGA  MNAGAN  ET   +++   +DR G +HVI    +++ YRSS     L
Sbjct: 127 YFGIPGTIGGALRMNAGANGRETRDVLIDATAVDRAGRRHVIDLAGMQFSYRSSGADPSL 186

Query: 189 IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGC 248
           I T    RG P S + I A +  V  HRE  QPI+EKTGGSTFKNP GHSAW+LI+ +GC
Sbjct: 187 IFTSARFRGTPASPDAIRAKMNEVQAHRELAQPIREKTGGSTFKNPPGHSAWKLIDAAGC 246

Query: 249 RGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           RGL  GGA++SE+HCNF+IN  +AT  D+E LGE VR++V  QSGI L+WEIKR+G
Sbjct: 247 RGLRIGGAQVSEMHCNFLINIGDATAADIETLGETVRERVKAQSGIELQWEIKRIG 302


>gi|146342496|ref|YP_001207544.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bradyrhizobium sp.
           ORS278]
 gi|166222825|sp|A4YZK1|MURB_BRASO RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|146195302|emb|CAL79327.1| UDP-N-acetylenolpyruvoylglucosamine reductase (MurB-like)
           [Bradyrhizobium sp. ORS278]
          Length = 307

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 149/305 (48%), Positives = 197/305 (64%), Gaps = 3/305 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  I+  L+     LRG+   N  L  +TWFR GG A+V+F P D  DL YFL  LP+
Sbjct: 1   MSFPDITPDLKAAMPALRGRLLANESLAPLTWFRVGGPAQVLFTPADADDLAYFLKHLPA 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIV-GARCSGKSLANSAL 119
           ++P+ ++G+GSN++VRD G+ GVV+RL+   F   EV+   ++I  G     K +A  A 
Sbjct: 61  ELPVYVIGVGSNMIVRDGGVPGVVIRLAPRAFG--EVKAEGDIITAGTAARDKRVAEVAA 118

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
              + G  F +GIPG+IGGA  MNAGAN  ET   +VE   IDR+G  H +    +K+ Y
Sbjct: 119 SADLAGLEFLFGIPGTIGGALRMNAGANGGETKDILVEATAIDRRGETHRLSNADMKFTY 178

Query: 180 RSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
           R+S     LI T V  RG P     I A +A V  HRET QPI+EKTGGSTFKNP GHSA
Sbjct: 179 RASGTDAALIFTAVRFRGTPSEPAAIRARMAEVQAHRETAQPIREKTGGSTFKNPPGHSA 238

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
           W+L++ +GCRGL+ GGA++SE+HCNF+IN  NAT  D+E LGE VR++V   SGI L+WE
Sbjct: 239 WKLVDAAGCRGLKVGGAQVSEMHCNFLINTGNATADDIETLGETVRERVKASSGIELQWE 298

Query: 300 IKRLG 304
           IKR+G
Sbjct: 299 IKRIG 303


>gi|27381711|ref|NP_773240.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bradyrhizobium
           japonicum USDA 110]
 gi|47605875|sp|Q89FU9|MURB_BRAJA RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|27354880|dbj|BAC51865.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bradyrhizobium
           japonicum USDA 110]
          Length = 305

 Score =  305 bits (782), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 148/304 (48%), Positives = 194/304 (63%), Gaps = 1/304 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  I+  L+     LRG+   N  L ++TWFR GG A+V+F P D  DL YFL  L S
Sbjct: 1   MSFPDITPSLKATMPDLRGRLLANQSLAELTWFRVGGPAQVLFTPADEDDLAYFLAHLAS 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           DIP+ +VG+GSN++VRD GI GVV+RL+   F          +  GA    K +A  A  
Sbjct: 61  DIPVYVVGVGSNLIVRDGGIAGVVIRLAPRAFGEASASGDI-VTAGAAALDKRVAEVAAS 119

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             IGG  F++GIPG+IGGA  MNAGAN  ET   ++E  G+ R G +HV     +K+ YR
Sbjct: 120 ANIGGLEFYFGIPGTIGGALRMNAGANGGETKDVLIEARGVGRDGTKHVFSNADMKFVYR 179

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
           +S +   +I T    RG  +  + I A +A V  HRET QPI+EKTGGSTFKNP GHSAW
Sbjct: 180 NSGVDPSIIFTSARFRGEVKDADAIRARMAEVQSHRETAQPIREKTGGSTFKNPPGHSAW 239

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +L++ +GCRGL  GGA++SE+HCNF+IN  +AT +D+E LGE VR +V   SGI L WEI
Sbjct: 240 KLVDAAGCRGLRVGGAQVSEMHCNFLINTGDATAHDIETLGETVRARVKANSGIELHWEI 299

Query: 301 KRLG 304
           KR+G
Sbjct: 300 KRIG 303


>gi|115524123|ref|YP_781034.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodopseudomonas
           palustris BisA53]
 gi|115518070|gb|ABJ06054.1| UDP-N-acetylmuramate dehydrogenase [Rhodopseudomonas palustris
           BisA53]
          Length = 321

 Score =  304 bits (779), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 151/296 (51%), Positives = 193/296 (65%), Gaps = 3/296 (1%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           L+    +LRG+   N PL  +TWFR GG A+++F P D +DL YFL  LP +IP++IVG+
Sbjct: 25  LKPAMPELRGRLLANAPLAPLTWFRVGGPAQLLFTPADENDLAYFLARLPKEIPVSIVGV 84

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMI-VGARCSGKSLANSALRHGIGGFHF 128
           GSN++VRD G+ G V+RL+  GF   E R   ++I  GA    K +A +A   GIGG  F
Sbjct: 85  GSNLIVRDGGLPGAVIRLAARGFG--ETRVDGDVIHAGAAALDKRVAETAAAAGIGGLEF 142

Query: 129 FYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL 188
            YGIPG+IGGA  MNAGAN  E    + E  GI R G+ HV     ++  YR S +   +
Sbjct: 143 LYGIPGTIGGALRMNAGANGGEIKDVLEEATGIGRDGSLHVFRNAGMRLSYRKSGVDASV 202

Query: 189 IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGC 248
           I T V LRG       I A +  V  HRET QPI+EKTGGSTFKNP G SAW+LI+++GC
Sbjct: 203 IFTSVRLRGAIAPPETIRAKMDEVQKHRETAQPIREKTGGSTFKNPPGQSAWKLIDEAGC 262

Query: 249 RGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           RGL  GGA++SELHCNF+IN  +AT  D+E LGE VR +V   SGI L+WEIKR+G
Sbjct: 263 RGLRVGGAQVSELHCNFLINTGDATAADIETLGETVRDRVKTHSGIELQWEIKRIG 318


>gi|187609777|sp|Q07PT0|MURB_RHOP5 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
          Length = 306

 Score =  304 bits (779), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 151/296 (51%), Positives = 193/296 (65%), Gaps = 3/296 (1%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           L+    +LRG+   N PL  +TWFR GG A+++F P D +DL YFL  LP +IP++IVG+
Sbjct: 10  LKPAMPELRGRLLANAPLAPLTWFRVGGPAQLLFTPADENDLAYFLARLPKEIPVSIVGV 69

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMI-VGARCSGKSLANSALRHGIGGFHF 128
           GSN++VRD G+ G V+RL+  GF   E R   ++I  GA    K +A +A   GIGG  F
Sbjct: 70  GSNLIVRDGGLPGAVIRLAARGFG--ETRVDGDVIHAGAAALDKRVAETAAAAGIGGLEF 127

Query: 129 FYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL 188
            YGIPG+IGGA  MNAGAN  E    + E  GI R G+ HV     ++  YR S +   +
Sbjct: 128 LYGIPGTIGGALRMNAGANGGEIKDVLEEATGIGRDGSLHVFRNAGMRLSYRKSGVDASV 187

Query: 189 IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGC 248
           I T V LRG       I A +  V  HRET QPI+EKTGGSTFKNP G SAW+LI+++GC
Sbjct: 188 IFTSVRLRGAIAPPETIRAKMDEVQKHRETAQPIREKTGGSTFKNPPGQSAWKLIDEAGC 247

Query: 249 RGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           RGL  GGA++SELHCNF+IN  +AT  D+E LGE VR +V   SGI L+WEIKR+G
Sbjct: 248 RGLRVGGAQVSELHCNFLINTGDATAADIETLGETVRDRVKTHSGIELQWEIKRIG 303


>gi|323137891|ref|ZP_08072966.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylocystis sp.
           ATCC 49242]
 gi|322396894|gb|EFX99420.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylocystis sp.
           ATCC 49242]
          Length = 306

 Score =  303 bits (777), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 148/299 (49%), Positives = 191/299 (63%), Gaps = 4/299 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPIT 65
           I+RL+     QLRG+   N PL   TWFR GG A+++F P D  DL YFL  LP +IP+T
Sbjct: 10  IARLM----PQLRGRVSANEPLAPYTWFRVGGPAQLLFMPADEGDLAYFLAHLPREIPVT 65

Query: 66  IVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGG 125
           ++GLGSN++VRD G+ GVV+RLS  GF  I V +HC + +GA       A +A   GI G
Sbjct: 66  VIGLGSNLIVRDGGVAGVVIRLSAKGFGEIAVEDHCRLRIGAAVPDVKAARAAADAGIDG 125

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT 185
             F+ GIPG+IGGA  MNAGA+  ET   ++E  G+DR G+  V     + Y YR     
Sbjct: 126 LAFYRGIPGAIGGALRMNAGAHGGETKDALIEARGVDRNGDIRVFANADMGYTYRHCSAP 185

Query: 186 KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEK 245
            D+I T  + +G P     I A +  +   RE  QPIKEKTGGSTFKNP GH AWQLI+ 
Sbjct: 186 DDVIFTSALYQGRPGDPKQILAEMDRITEAREASQPIKEKTGGSTFKNPDGHKAWQLIDA 245

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           +GCRGL  G A++SE+HCNF+IN   AT  D+E LGE VR++V   SG+ L+WEIKR+G
Sbjct: 246 AGCRGLVVGDAQVSEMHCNFLINRGRATAADIETLGETVRRRVRETSGVELQWEIKRIG 304


>gi|254704687|ref|ZP_05166515.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella suis bv. 3
           str. 686]
 gi|261755380|ref|ZP_05999089.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella suis bv. 3
           str. 686]
 gi|261745133|gb|EEY33059.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella suis bv. 3
           str. 686]
          Length = 294

 Score =  303 bits (775), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 149/276 (53%), Positives = 190/276 (68%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRG+   +  + +ITWFR GG A+V+FQP D  DL  FL  +P +IP+ +VG+GSN+LVR
Sbjct: 19  LRGRLTPDTGMDKITWFRAGGPAQVLFQPSDEEDLSAFLKAVPEEIPLLVVGIGSNLLVR 78

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ G V+RLS  GF  +E     ++  GA    K +A +AL  G+ GFHF++GIPG I
Sbjct: 79  DGGVPGFVVRLSAKGFGEVEQVCDTQLRAGAAAPDKRVAAAALEAGLAGFHFYHGIPGGI 138

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET + VVEV  +DRKG  HV+    + Y YR S  + DLI T V+  
Sbjct: 139 GGALRMNAGANGVETRERVVEVRALDRKGEVHVLSNADMGYAYRHSSASPDLIFTSVLFE 198

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G P  ++ I  A+  V HHRETVQP++EKTGGSTFKNP G SAW+ I+K+GCRGL  GGA
Sbjct: 199 GVPGERDDIRRAMDEVQHHRETVQPVREKTGGSTFKNPEGTSAWKEIDKAGCRGLRVGGA 258

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQS 292
           ++SE+HCNFMIN  NATG+DLE LGE VR +VF  S
Sbjct: 259 QMSEMHCNFMINTGNATGHDLETLGETVRARVFENS 294


>gi|47605804|sp|P61616|MURB_RHOPA RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
          Length = 309

 Score =  302 bits (774), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 150/305 (49%), Positives = 196/305 (64%), Gaps = 3/305 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  I+  L+    +LRG+   N PL  +TWFR GG A+V+F P D  DL YFL  LP+
Sbjct: 1   MSFPDITPELKAAMPELRGRLLSNEPLAPLTWFRVGGPAQVLFTPADEDDLGYFLPRLPA 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMI-VGARCSGKSLANSAL 119
           +IP+  +GLGSN++VRD G+ GV +RLS  GF   E R   EM+  GA    K +A +A 
Sbjct: 61  EIPVMCLGLGSNLIVRDGGLPGVAIRLSPRGFG--EHRVEGEMVHAGAAALDKRVAETAA 118

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
              +GG  F+YGIPGSIGGA  MNAGAN  ET   +++    DR G + +     +++ Y
Sbjct: 119 AAQLGGLEFYYGIPGSIGGALRMNAGANGRETKDVLIDATAYDRSGTRKLFDNAAMQFSY 178

Query: 180 RSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
           R S     LI T   LRG P + + I A +  V  HRE  QPI+EKTGGSTFKNP G SA
Sbjct: 179 RHSGADPALIFTSARLRGTPATPDHIRAKMNEVQAHRELAQPIREKTGGSTFKNPPGQSA 238

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
           W+LI+ +GCRGL+ GGA++SE+HCNF+IN   AT  D+E LGE VR +V  QSG+ L+WE
Sbjct: 239 WRLIDAAGCRGLKIGGAQVSEMHCNFLINTGEATAADIETLGETVRARVKAQSGVELQWE 298

Query: 300 IKRLG 304
           IKR+G
Sbjct: 299 IKRIG 303


>gi|39936590|ref|NP_948866.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodopseudomonas
           palustris CGA009]
 gi|39650446|emb|CAE28969.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodopseudomonas
           palustris CGA009]
          Length = 324

 Score =  301 bits (772), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 150/305 (49%), Positives = 196/305 (64%), Gaps = 3/305 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  I+  L+    +LRG+   N PL  +TWFR GG A+V+F P D  DL YFL  LP+
Sbjct: 16  MSFPDITPELKAAMPELRGRLLSNEPLAPLTWFRVGGPAQVLFTPADEDDLGYFLPRLPA 75

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMI-VGARCSGKSLANSAL 119
           +IP+  +GLGSN++VRD G+ GV +RLS  GF   E R   EM+  GA    K +A +A 
Sbjct: 76  EIPVMCLGLGSNLIVRDGGLPGVAIRLSPRGFG--EHRVEGEMVHAGAAALDKRVAETAA 133

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
              +GG  F+YGIPGSIGGA  MNAGAN  ET   +++    DR G + +     +++ Y
Sbjct: 134 AAQLGGLEFYYGIPGSIGGALRMNAGANGRETKDVLIDATAYDRSGTRKLFDNAAMQFSY 193

Query: 180 RSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
           R S     LI T   LRG P + + I A +  V  HRE  QPI+EKTGGSTFKNP G SA
Sbjct: 194 RHSGADPALIFTSARLRGTPATPDHIRAKMNEVQAHRELAQPIREKTGGSTFKNPPGQSA 253

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
           W+LI+ +GCRGL+ GGA++SE+HCNF+IN   AT  D+E LGE VR +V  QSG+ L+WE
Sbjct: 254 WRLIDAAGCRGLKIGGAQVSEMHCNFLINTGEATAADIETLGETVRARVKAQSGVELQWE 313

Query: 300 IKRLG 304
           IKR+G
Sbjct: 314 IKRIG 318


>gi|316933189|ref|YP_004108171.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodopseudomonas
           palustris DX-1]
 gi|315600903|gb|ADU43438.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodopseudomonas
           palustris DX-1]
          Length = 312

 Score =  301 bits (772), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 150/306 (49%), Positives = 197/306 (64%), Gaps = 3/306 (0%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPIT 65
           I+  L+    +LRG+   N PL  +TWFR GG A+V++ P D  DL YFL+ LP +IP+ 
Sbjct: 9   ITPELKTAMPELRGRLLGNEPLAPLTWFRVGGPAQVLYTPADEDDLGYFLSRLPPEIPLM 68

Query: 66  IVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMI-VGARCSGKSLANSALRHGIG 124
            +GLGSN++VRD G+ GV +RLS  GF   E R   E++  GA    K +A +A    +G
Sbjct: 69  CLGLGSNLIVRDGGLPGVAIRLSPRGFG--EHRVEGEVVHAGAAALDKRVAETAAAAQLG 126

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F+YGIPGSIGGA  MNAGAN  ET   +++    DR G + +     +++ YR S  
Sbjct: 127 GLEFYYGIPGSIGGALRMNAGANGRETKDVLIDATAYDRSGTRRLFDNTAMQFSYRHSGA 186

Query: 185 TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIE 244
              LI T   LRG P + + I A +  V  HRE  QPI+EKTGGSTFKNP GHSAW+LI+
Sbjct: 187 DPALIFTSARLRGTPATPDHIRAKMNEVQAHRELAQPIREKTGGSTFKNPAGHSAWRLID 246

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            +GCRGL  GGA++SE+HCNF+IN   AT  D+E LGE VR +V  QSG+ L+WEIKR+G
Sbjct: 247 AAGCRGLRIGGAQVSEMHCNFLINTGEATASDIETLGETVRARVKAQSGVELQWEIKRIG 306

Query: 305 DFFDHQ 310
              DH+
Sbjct: 307 IAPDHR 312


>gi|91977858|ref|YP_570517.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodopseudomonas
           palustris BisB5]
 gi|123735247|sp|Q133X3|MURB_RHOPS RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|91684314|gb|ABE40616.1| UDP-N-acetylmuramate dehydrogenase [Rhodopseudomonas palustris
           BisB5]
          Length = 310

 Score =  300 bits (768), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 144/309 (46%), Positives = 199/309 (64%), Gaps = 3/309 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  I+  L+     LRG+   N PL  +TWFR GG A+ +F P D  DL YFL+ LP+
Sbjct: 1   MSFPDITPDLKAAMPSLRGRLLGNEPLAPLTWFRVGGPAQALFTPADEDDLGYFLSRLPT 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMI-VGARCSGKSLANSAL 119
           ++P+  +G+GSN++VRD G+ GVV+RL+  GF   + R   E++  GA    K +A +A 
Sbjct: 61  EVPMLCIGVGSNLIVRDGGLPGVVIRLAPRGFG--DTRADGEIVYAGAAALDKRVAETAA 118

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
              +GG  F++GIPG++GGA  MNAGAN  ET   +++    DR GN+ V+    +++ Y
Sbjct: 119 AAKLGGLEFYFGIPGTVGGALRMNAGANGRETKDALIDATAFDRSGNRRVLGNADMQFSY 178

Query: 180 RSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
           R S     LI T    RG P S + I A +  V  HRE  QP++EKTGGSTFKNP  +SA
Sbjct: 179 RHSGADPALIFTSARFRGTPASPDAIRAKMNEVQAHRELAQPVREKTGGSTFKNPPDNSA 238

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
           W+LI+ +GCRGL  GGA++SE+HCNF+IN  +AT  D+E LGE VR++V  QSGI L+WE
Sbjct: 239 WKLIDAAGCRGLRVGGAQVSEMHCNFLINTSDATAADIETLGETVRERVKAQSGIELQWE 298

Query: 300 IKRLGDFFD 308
           IKR+G   D
Sbjct: 299 IKRIGVAVD 307


>gi|192292412|ref|YP_001993017.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodopseudomonas
           palustris TIE-1]
 gi|254765554|sp|B3QFM9|MURB_RHOPT RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|192286161|gb|ACF02542.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodopseudomonas
           palustris TIE-1]
          Length = 309

 Score =  300 bits (768), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 149/305 (48%), Positives = 197/305 (64%), Gaps = 3/305 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  I+  L+    +LRG+   N PL  +TWFR GG A+V+F P D  DL YFL+ LP+
Sbjct: 1   MSFPDITPDLKAAMPELRGRLLGNEPLAPLTWFRVGGPAQVLFTPADEDDLGYFLSRLPA 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMI-VGARCSGKSLANSAL 119
           +IP+  +GLGSN++VRD G+ GV +RLS  GF   E R   E++  GA    K +A +A 
Sbjct: 61  EIPVMCLGLGSNLIVRDGGLPGVAIRLSPRGFG--EHRVEGEVVHAGAAALDKRVAETAA 118

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
              +GG  F+YGIPGSIGGA  MNAGAN  ET   +++    DR G + +     +++ Y
Sbjct: 119 AAQLGGLEFYYGIPGSIGGALRMNAGANGRETKDVLIDATAYDRSGTRKLFDNAAMQFSY 178

Query: 180 RSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
           R S     LI T   LRG P + + I A +  V  HRE  QPI+EKTGGSTFKNP G SA
Sbjct: 179 RHSGADPALIFTSARLRGTPATPDHIRAKMNEVQAHRELAQPIREKTGGSTFKNPPGQSA 238

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
           W+LI+ +GCRGL+ GGA++SE+HCNF+IN   AT  D+E LGE VR +V  QSG+ L+WE
Sbjct: 239 WRLIDAAGCRGLKIGGAQVSEMHCNFLINTGEATAADIETLGETVRARVKAQSGVELQWE 298

Query: 300 IKRLG 304
           IKR+G
Sbjct: 299 IKRIG 303


>gi|148257415|ref|YP_001242000.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bradyrhizobium sp.
           BTAi1]
 gi|166222824|sp|A5EPK0|MURB_BRASB RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|146409588|gb|ABQ38094.1| UDP-N-acetylmuramate dehydrogenase [Bradyrhizobium sp. BTAi1]
          Length = 307

 Score =  300 bits (767), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 144/304 (47%), Positives = 192/304 (63%), Gaps = 1/304 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  I+  L+    +LRG+   N  L  +TWFR GG A+V+F P D  DL YFL  LP+
Sbjct: 1   MSFADITPDLKAAMPELRGRLLANEGLAPLTWFRVGGPAQVLFTPADADDLAYFLKHLPA 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           ++P+ ++G+GSN++VRD G+ GVV+RL+   F  ++V     +  G     K +A  A  
Sbjct: 61  ELPVYVIGVGSNLIVRDGGVPGVVIRLAPRAFGEVKVDGDI-VAAGTAALDKRVAEVAAS 119

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             + G  F +GIPG+IGGA  MNAGAN  ET   +VE   IDR+G  H      + + YR
Sbjct: 120 ANLTGLEFLFGIPGTIGGALRMNAGANGGETKDILVEATAIDRQGVTHHFTNADMNFTYR 179

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
           +S     LI T    RG P     I   +A V  HRET QPI+EKTGGSTFKNP GHSAW
Sbjct: 180 ASGADPSLIFTAARFRGKPSDAEAIRGRMAEVQAHRETAQPIREKTGGSTFKNPPGHSAW 239

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +L++ +GCRGL+ GGA++SE+HCNF+IN  NAT  D+E LGE VR++V   SGI L+WEI
Sbjct: 240 RLVDAAGCRGLKVGGAQVSEMHCNFLINTGNATADDIETLGETVRERVEATSGIALQWEI 299

Query: 301 KRLG 304
           KR+G
Sbjct: 300 KRIG 303


>gi|298293096|ref|YP_003695035.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Starkeya novella DSM
           506]
 gi|296929607|gb|ADH90416.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Starkeya novella DSM
           506]
          Length = 306

 Score =  298 bits (764), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 148/304 (48%), Positives = 194/304 (63%), Gaps = 1/304 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  I+  L  R  +LRG+   N  L ++TWFR GG A+V+F P D  DL YFL  LP+
Sbjct: 1   MTFPDITAELSARMPELRGRMIANQSLAELTWFRVGGPAQVLFTPADEDDLAYFLKNLPA 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           +IP+ +VGLGSN++VRD G+ GVV+RL   GFS I+V + C++ VGA       A +A  
Sbjct: 61  EIPVMVVGLGSNLIVRDGGVPGVVIRLGR-GFSEIKVEDGCKLRVGAAVPDVKAARAAAD 119

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
            GI G  F+ GIPG IGGA  MNAGA+  ET   ++E   +DR GN  +       + YR
Sbjct: 120 AGIDGLAFYRGIPGGIGGALRMNAGAHGGETKDCLIEARAVDRAGNIRLFSNGDFSFSYR 179

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
            S    D+I T  + +G P     I A +  +   RE  QPI+EKTGGSTFKNP GH AW
Sbjct: 180 HSGAPTDVIFTSALYQGRPGDSATILAEMDRITEAREASQPIREKTGGSTFKNPPGHKAW 239

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           QLI+ +GCRGL  G A++SE+HCNF+IN  +AT  D+E LGE+VR+ V  QSG+ LEWEI
Sbjct: 240 QLIDAAGCRGLTVGAAQVSEMHCNFLINTGSATAADIEGLGEEVRRSVKAQSGVELEWEI 299

Query: 301 KRLG 304
           KR+G
Sbjct: 300 KRIG 303


>gi|218674670|ref|ZP_03524339.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobium etli GR56]
          Length = 260

 Score =  295 bits (756), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 145/246 (58%), Positives = 183/246 (74%)

Query: 62  IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRH 121
           +P+T++G+GSNILVRD GI GVVLRLS  GF  +E+     ++  A   G +       H
Sbjct: 1   MPLTVIGVGSNILVRDGGIPGVVLRLSAKGFGFVELAGENRILARAHLPGTACGGDGDGH 60

Query: 122 GIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS 181
           GIGGFHF+YGIPG+IGGAA MNAGAN  ET + ++EV+ +DRKGN+HV+   ++ Y YR 
Sbjct: 61  GIGGFHFYYGIPGAIGGAARMNAGANGVETRERLIEVNAVDRKGNKHVLSNAEMGYSYRH 120

Query: 182 SEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
           S  + DLI T V+  G+PE +  I A +  V +HRETVQP++EKTGGSTFKNP GHSAW+
Sbjct: 121 SAASADLIFTSVLFEGYPEDRAQIRAEMDAVRNHRETVQPVREKTGGSTFKNPPGHSAWK 180

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           LI+++GCRGL  GGA++S LHCNFMIN   ATGYDLEYLGEQVR++VF + GI LEWEIK
Sbjct: 181 LIDEAGCRGLVIGGAQMSSLHCNFMINMGQATGYDLEYLGEQVRREVFEKEGIKLEWEIK 240

Query: 302 RLGDFF 307
           RLG F 
Sbjct: 241 RLGVFM 246


>gi|296448762|ref|ZP_06890616.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylosinus
           trichosporium OB3b]
 gi|296253736|gb|EFH00909.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylosinus
           trichosporium OB3b]
          Length = 302

 Score =  295 bits (754), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 138/289 (47%), Positives = 183/289 (63%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
            LRG+   N PL   TWFR GG A+ +F P D  DL YFL  LP DI +T +GLGSN+++
Sbjct: 12  DLRGRLSANEPLAPFTWFRVGGPAQFLFSPADEADLSYFLERLPRDIAVTTIGLGSNLII 71

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD G+ GVV+RL   GF  I++     + VGA      +A +A   GI G  F+ GIPG 
Sbjct: 72  RDGGVAGVVIRLGAKGFGEIKIEAGERLRVGAAVPDVKVARAAADGGIDGLAFYRGIPGG 131

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           +GGA  MNAGA+  ET   ++E  G+DR G  HV    ++ + YR SE  +D+I T  + 
Sbjct: 132 VGGALRMNAGAHGGETKDALLEARGVDRSGKIHVFSTAEMGFSYRHSEAPEDVIFTEALF 191

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           +G       I A +  +   RE  QPI+EKTGGSTF+NP GH AWQLI+ +GCRGL  G 
Sbjct: 192 QGRKGDPKTILAEMERITQAREASQPIREKTGGSTFQNPPGHKAWQLIDAAGCRGLTLGD 251

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           A++SE+HCNF++N   AT  ++E LGE+VR++V   SGILL WEIKR+G
Sbjct: 252 AQVSEMHCNFLVNRGKATAAEIEALGEEVRRRVQAASGILLHWEIKRIG 300


>gi|154252865|ref|YP_001413689.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Parvibaculum
           lavamentivorans DS-1]
 gi|171769614|sp|A7HVU9|MURB_PARL1 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|154156815|gb|ABS64032.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Parvibaculum
           lavamentivorans DS-1]
          Length = 310

 Score =  294 bits (753), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 141/304 (46%), Positives = 192/304 (63%), Gaps = 2/304 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M+    +  L +R  ++RG+   + PL  +TWFR GGNAEV+F+P D  DL  FL   P+
Sbjct: 1   MMAAEATAALIDRLPKVRGELVADAPLAPLTWFRAGGNAEVLFRPADADDLAAFLAGTPA 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           D+P+TI+G+GSN+LVR+ G+ GVV+RL   GF NIE+   C +  G      +++ +A  
Sbjct: 61  DVPVTIIGVGSNLLVREGGVPGVVIRLGR-GFMNIEIEGTC-VRAGTAALDVAVSRAAQE 118

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
            G+ G  F+ GIPGSIGGA  MN GA   ET   +VE   IDR G +HV+    + Y YR
Sbjct: 119 AGLAGLEFYRGIPGSIGGALRMNGGAYGRETKDVLVEAVAIDRAGKRHVLTNADMHYTYR 178

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
                 DLI    + +G P +   I   +  +   RE  QPI+ +TGGSTFKNP GH +W
Sbjct: 179 HCGAPDDLIFVEALFQGTPGNAEDILRRMNEITSSREATQPIRTRTGGSTFKNPEGHKSW 238

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           QLI+ +GCRGL  GGA++SELHCNF+IN  +AT  D+E LGE+VR +V   SG+ LEWEI
Sbjct: 239 QLIDAAGCRGLRKGGAQVSELHCNFLINTGDATASDIEDLGEEVRARVKETSGVTLEWEI 298

Query: 301 KRLG 304
           +R+G
Sbjct: 299 RRIG 302


>gi|299131923|ref|ZP_07025118.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Afipia sp. 1NLS2]
 gi|298592060|gb|EFI52260.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Afipia sp. 1NLS2]
          Length = 305

 Score =  294 bits (752), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 147/304 (48%), Positives = 196/304 (64%), Gaps = 1/304 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  IS  L+    QLRG+   N  L  +TWFR GG A+++F P D  DL YFL  LP+
Sbjct: 1   MNFPDISADLKAAMPQLRGRVLANELLGPLTWFRVGGPAQILFTPADEDDLAYFLKHLPT 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           DIP+ ++G+GSN++VRD G+ GVV+RLS  GF ++ V     +  G     K +A +A  
Sbjct: 61  DIPVYVIGVGSNLIVRDGGVEGVVIRLSPRGFGSV-VAEGDTVRAGTAALDKRVAEAAAA 119

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             IGG  F++GIPGSIGGA  MNAGAN  ET   +VE  G+ R G++      ++K+ YR
Sbjct: 120 ANIGGLEFYFGIPGSIGGALRMNAGANGGETKDVLVEARGVTRNGDKVTFSNAEMKFVYR 179

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
           S  +   +I T  + RG       I A +  V  HRET QPI+EKTGGSTFKNP GHS+W
Sbjct: 180 SHGVDPSIIFTSALYRGVVTETEKIRARMNEVQQHRETAQPIREKTGGSTFKNPPGHSSW 239

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LI+ +G RG   GGA++SE+HCNF+IN  +AT +D+E LGE VR++V  QSGI L WEI
Sbjct: 240 KLIDAAGLRGFRVGGAQVSEMHCNFLINTGDATAHDIETLGETVRERVKAQSGIELHWEI 299

Query: 301 KRLG 304
           KR+G
Sbjct: 300 KRIG 303


>gi|170748772|ref|YP_001755032.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacterium
           radiotolerans JCM 2831]
 gi|170655294|gb|ACB24349.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacterium
           radiotolerans JCM 2831]
          Length = 308

 Score =  293 bits (749), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 138/295 (46%), Positives = 184/295 (62%), Gaps = 1/295 (0%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           +R     LRG+   + PL  +TWFR GG AEV+F P D  DL   L  L  D+P+T++GL
Sbjct: 9   IRAAAPDLRGRLLADQPLADLTWFRVGGPAEVLFTPADEEDLARLLASLDPDVPVTVIGL 68

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
           GSN++VRD G+ GVV+RL    F +I +     + VG       LA +A   G+ G  F+
Sbjct: 69  GSNLIVRDGGVPGVVVRLGGKAFGSIAIDGDA-LTVGTAVPDMRLAKAAAEAGLDGLAFY 127

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLI 189
            GIPGSIGGA  MNAGA+  ET+  +VE  GIDR G         + + YR S+  +D+I
Sbjct: 128 RGIPGSIGGALRMNAGAHGGETTDVLVEARGIDRGGALRTFSHADMGFSYRHSDAPEDVI 187

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
            T  V RG    +  I A +  V   RE  QPI+E+TGGSTF NP G  AWQLI+ +GCR
Sbjct: 188 FTRAVFRGRTGDRGAIEAEMERVTAAREAAQPIRERTGGSTFANPDGGKAWQLIDAAGCR 247

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           GL  GGA++SE+HCNF+IN  +AT  D+E LGE+VR++V + SG+ L WEI+R+G
Sbjct: 248 GLRRGGAQVSEMHCNFLINTGDATAADIEGLGEEVRRRVRDTSGVELRWEIRRIG 302


>gi|218531122|ref|YP_002421938.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacterium
           chloromethanicum CM4]
 gi|254764209|sp|B7KSC5|MURB_METC4 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|218523425|gb|ACK84010.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacterium
           chloromethanicum CM4]
          Length = 309

 Score =  291 bits (744), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 141/295 (47%), Positives = 183/295 (62%), Gaps = 1/295 (0%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           +R     LRG+  EN  L  +TWFR GG A+V+F P D  DL  FL  L   +P+T++GL
Sbjct: 10  IRAAAPDLRGRLLENQSLADLTWFRVGGPAQVLFSPADEADLSAFLAALDPSVPVTVIGL 69

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
           GSN++VRD GI GV +RL    F ++E+     +  G       LA +A    + G  FF
Sbjct: 70  GSNLIVRDGGIPGVTIRLGGKAFGSVEIDGET-IRSGTAVPDMRLAKAAAEASLDGLAFF 128

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLI 189
            GIPGS+GGA  MNAGA+  ET+  +VEV GIDRKG  H     ++ ++YR S    D+I
Sbjct: 129 RGIPGSVGGALRMNAGAHGGETTDVLVEVRGIDRKGEVHRFTHAEMGFRYRHSSAPDDVI 188

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
            T    RG P  +  I A +  V   RE  QPI+E+TGGSTFKNP G  AWQLI+ +GCR
Sbjct: 189 FTGATFRGRPGDREAIEAEMERVTAAREAAQPIRERTGGSTFKNPEGGKAWQLIDAAGCR 248

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           GL  GGA++SE+HCNF+IN   AT  D+E LGE+VR++V   SG  L WEIKR+G
Sbjct: 249 GLIRGGAQVSEMHCNFLINRGGATAADIEGLGEEVRRRVREHSGFELHWEIKRIG 303


>gi|209884385|ref|YP_002288242.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Oligotropha
           carboxidovorans OM5]
 gi|209872581|gb|ACI92377.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Oligotropha
           carboxidovorans OM5]
          Length = 307

 Score =  289 bits (739), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 145/299 (48%), Positives = 189/299 (63%), Gaps = 1/299 (0%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPIT 65
           IS  L+    +LRG+   N PL  +TWFR GG A+V+F P D  DL YFL  LP+DIP+ 
Sbjct: 7   ISADLKSAMPELRGRVLANEPLGPLTWFRVGGPAQVLFTPVDEDDLAYFLAHLPADIPVY 66

Query: 66  IVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGG 125
           ++G+GSN++VRD G+ GVV+RLS  GF  I V     +  G     K +A +A    IGG
Sbjct: 67  VIGVGSNLIVRDGGVEGVVIRLSPRGFGTI-VAEGDTVRAGTAALDKRVAEAAAAANIGG 125

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT 185
             F++GIPGSIGGA  MNAGAN  ET   +VE  G+ R G        ++ + YRS  + 
Sbjct: 126 LEFYFGIPGSIGGALRMNAGANGGETKDVLVEARGVTRAGETVTFTNAEMGFVYRSHGVD 185

Query: 186 KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEK 245
             +I T  + RG       I A +  V  HRET QPI+EKTGGSTFKNP GHS+W+L++ 
Sbjct: 186 PSIIFTSALYRGTLMEPEKIRARMNEVQQHRETAQPIREKTGGSTFKNPPGHSSWKLVDA 245

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           +G RG   GGA++SE+HCNF+IN  +AT  D+E LGE VR +V   SGI L+WEIKR+G
Sbjct: 246 AGMRGFRVGGAQVSEMHCNFLINTGDATAADIETLGETVRDRVKAHSGIELQWEIKRIG 304


>gi|163852362|ref|YP_001640405.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacterium
           extorquens PA1]
 gi|254764210|sp|A9VWV7|MURB_METEP RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|163663967|gb|ABY31334.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacterium
           extorquens PA1]
          Length = 309

 Score =  288 bits (738), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 140/295 (47%), Positives = 184/295 (62%), Gaps = 1/295 (0%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           +R     LRG+  EN  L  +TWFR GG A+V+F P D  DL  FL  L   +P+T++GL
Sbjct: 10  IRAAAPDLRGRLLENQSLADLTWFRVGGPAQVLFSPADEADLSAFLAALDPAVPVTVIGL 69

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
           GSN++VRD GI GV +RL    F ++E+     +  G       LA +A    + G  FF
Sbjct: 70  GSNLIVRDGGIPGVAIRLGGKAFGSVEIDGET-IRSGTAVPDMRLAKAAAEASLDGLAFF 128

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLI 189
            GIPGS+GGA  MNAGA+  ET+  +VEV GIDRKG        ++ ++YR S    D+I
Sbjct: 129 RGIPGSVGGALRMNAGAHGGETTDVLVEVRGIDRKGEVRRFTHAEMGFRYRHSSAPDDVI 188

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
            T    RG P ++  I A +  V   RE  QPI+E+TGGSTFKNP G  AWQLI+ +GCR
Sbjct: 189 FTGATFRGRPGNREAIEAEMERVTAAREAAQPIRERTGGSTFKNPEGGKAWQLIDAAGCR 248

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           GL  GGA++SE+HCNF+IN   AT  D+E LGE+VR++V + SG  L WEIKR+G
Sbjct: 249 GLIRGGAQVSEMHCNFLINRGGATAADIEGLGEEVRRRVRDHSGFELHWEIKRIG 303


>gi|254562110|ref|YP_003069205.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacterium
           extorquens DM4]
 gi|254269388|emb|CAX25354.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacterium
           extorquens DM4]
          Length = 309

 Score =  287 bits (735), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 140/295 (47%), Positives = 182/295 (61%), Gaps = 1/295 (0%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           +R     LRG+  EN  L  +TWFR GG A+V+F P D  DL  FL  L   +P+T++GL
Sbjct: 10  IRAAAPDLRGRLLENQSLADLTWFRVGGPAQVLFSPADEADLSAFLAALDPAVPVTVIGL 69

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
           GSN++VRD GI GV +RL    F ++E+     +  G       LA +A    + G  FF
Sbjct: 70  GSNLIVRDGGIPGVTIRLGGKAFGSVEIDGET-IRSGTAVPDMRLAKAAAEASLDGLAFF 128

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLI 189
            GIPGS+GGA  MNAGA+  ET+  +VEV GIDRKG        ++ ++YR S    D+I
Sbjct: 129 RGIPGSVGGALRMNAGAHGGETTDVLVEVRGIDRKGEVRRFTHAEMGFRYRHSSAPDDVI 188

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
            T    RG P  +  I A +  V   RE  QPI+E+TGGSTFKNP G  AWQLI+ +GCR
Sbjct: 189 FTGATFRGRPGDREAIEAEMDRVTAAREAAQPIRERTGGSTFKNPEGGKAWQLIDAAGCR 248

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           GL  GGA++SE+HCNF+IN   AT  D+E LGE+VR++V   SG  L WEIKR+G
Sbjct: 249 GLIRGGAQVSEMHCNFLINRGGATAADIEGLGEEVRRRVREHSGFELHWEIKRIG 303


>gi|240139698|ref|YP_002964175.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacterium
           extorquens AM1]
 gi|240009672|gb|ACS40898.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacterium
           extorquens AM1]
          Length = 309

 Score =  287 bits (735), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 140/295 (47%), Positives = 183/295 (62%), Gaps = 1/295 (0%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           +R     LRG+  EN  L  +TWFR GG A+V+F P D  DL  FL  L   +P+T++GL
Sbjct: 10  IRAAAPDLRGRLLENQSLADLTWFRVGGPAQVLFSPADEADLSAFLAALDPAVPVTVIGL 69

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
           GSN++VRD GI GV +RL    F ++E+     +  G       LA +A    + G  FF
Sbjct: 70  GSNLIVRDGGIPGVTIRLGGKAFGSVEIDGET-IRSGTAVPDMRLAKAAAEASLDGLAFF 128

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLI 189
            GIPGS+GGA  MNAGA+  ET+  +VEV GIDRKG        ++ ++YR S    D+I
Sbjct: 129 RGIPGSVGGALRMNAGAHGGETTDVLVEVRGIDRKGEVRRFSHAEMGFRYRHSSAPDDVI 188

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
            T    RG P ++  I A +  V   RE  QPI+E+TGGSTFKNP G  AWQLI+ +GCR
Sbjct: 189 FTGATFRGRPGNREAIEAEMDRVTAAREAAQPIRERTGGSTFKNPEGGKAWQLIDAAGCR 248

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           GL  GGA++SE+HCNF+IN   AT  D+E LGE+VR++V   SG  L WEIKR+G
Sbjct: 249 GLIRGGAQVSEMHCNFLINRGGATAADIEGLGEEVRRRVREHSGFELHWEIKRIG 303


>gi|312114842|ref|YP_004012438.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311219971|gb|ADP71339.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 315

 Score =  287 bits (734), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 140/289 (48%), Positives = 186/289 (64%), Gaps = 1/289 (0%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
           +LRGK   N  + ++TW R GG A+V+F+P D  DL YFL   P+DIP+  VG+GSN+LV
Sbjct: 15  ELRGKLLPNASMSELTWLRVGGPAQVLFKPADEEDLAYFLARCPADIPVMAVGVGSNLLV 74

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD G+ GVV+RL   GF++IE  +   + VGA      LA +A + GI    F+ GIPG+
Sbjct: 75  RDGGVPGVVIRLGR-GFNDIEPLDGARIRVGAAVPDVRLAQAAAQAGIAKLAFYRGIPGT 133

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           +GGA  MNAGA+  ET   +V+   +DR G  HV     + + YR   +  D I T  V 
Sbjct: 134 VGGALRMNAGAHGGETKDVLVQARAVDRSGAVHVYDNAGMGFTYRHCGVPDDQIFTRAVF 193

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
            G P     I   +  V  +RE  QPIK +TGGSTFKNP G SAW+LI+++GCRG   GG
Sbjct: 194 EGVPGDPAEIEREMQGVAEYREANQPIKSRTGGSTFKNPPGKSAWRLIDEAGCRGFRVGG 253

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           A +SE+HCNF+IN  NAT  D+E LGE VRK+VF ++GI+L+WEIKR+G
Sbjct: 254 AHMSEMHCNFLINDQNATATDIETLGETVRKRVFEKTGIMLDWEIKRIG 302


>gi|92116838|ref|YP_576567.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrobacter
           hamburgensis X14]
 gi|122418257|sp|Q1QNU0|MURB_NITHX RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|91799732|gb|ABE62107.1| UDP-N-acetylmuramate dehydrogenase [Nitrobacter hamburgensis X14]
          Length = 305

 Score =  286 bits (733), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 144/304 (47%), Positives = 196/304 (64%), Gaps = 3/304 (0%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD 61
           ++  I+  L+ +  +LRG+   N PL  +TWFR GG A+V+F P D +DL YFL  LP +
Sbjct: 1   MFADITTKLKSQMPELRGRMLANEPLAPLTWFRVGGPAQVLFTPADENDLAYFLRHLPEE 60

Query: 62  IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMI-VGARCSGKSLANSALR 120
           IPI  +G+GSN++VRD G+ GVV+RL+  GF   EV    + +  GA    K +A +A  
Sbjct: 61  IPIYCIGVGSNLIVRDRGLPGVVIRLAPRGFG--EVTTDGDTVHAGAAALDKRVAEAAAA 118

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             IGG  F++GIPG+IGGA  MNAGAN  ET   +VE   + R+G++  +    +K++YR
Sbjct: 119 ADIGGLEFYFGIPGTIGGALRMNAGANGSETKDVLVEARAVSRRGDKITVDNAGMKFEYR 178

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
           +S I   +I T    RG       I A +  V  HRETVQPI+EKTGGSTFKNP G SAW
Sbjct: 179 NSAIYPSVIFTGGTFRGRRAEPEAIRARMNEVQSHRETVQPIREKTGGSTFKNPPGQSAW 238

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LI+ +G RG   GGA++SE+HCNF+IN   AT  D+E LGE VR +V   +G+ L+WEI
Sbjct: 239 KLIDAAGMRGHRVGGAQVSEMHCNFLINTGEATARDIETLGETVRARVKEHAGVDLQWEI 298

Query: 301 KRLG 304
           KR+G
Sbjct: 299 KRIG 302


>gi|85714978|ref|ZP_01045963.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrobacter sp.
           Nb-311A]
 gi|85698175|gb|EAQ36047.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrobacter sp.
           Nb-311A]
          Length = 317

 Score =  286 bits (731), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 143/305 (46%), Positives = 192/305 (62%), Gaps = 3/305 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  I+  L+ +  +LRG+   N PL  +TWFR GG A+V+F P D +DL YFL  LP 
Sbjct: 12  MTFPDITTKLKSQMPELRGRLLANEPLAPLTWFRVGGPAQVLFTPADENDLAYFLCHLPE 71

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMI-VGARCSGKSLANSAL 119
           +IP+  +G+GSN++VRD G+ GVV+RLS  GF   EV    +++  GA    K +A  A 
Sbjct: 72  EIPVCCLGVGSNVVVRDRGLPGVVIRLSPRGFG--EVTTDGDIVRAGAAALDKRVAEVAA 129

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
              I G  F++GIPG+IGGA  MNAGAN  ET   +VE   + R+G++       + + Y
Sbjct: 130 AVHISGLEFYFGIPGTIGGALRMNAGANGSETRDVLVEARAVGRRGDKMTFDNSGMAFDY 189

Query: 180 RSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
           R S +   +I T    RG       I A +  V  HRETVQPI+EKTGGSTFKNP G SA
Sbjct: 190 RKSGVDPSVIFTGATFRGRIAEPQTIRARMNEVQAHRETVQPIREKTGGSTFKNPPGQSA 249

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
           W+LI+ +G RG   GGA++S++HCNF+IN   AT  D+E LGE VR++V   SGI L+WE
Sbjct: 250 WKLIDAAGMRGHRVGGAQVSDMHCNFLINTGEATARDIETLGETVRERVKRHSGIELQWE 309

Query: 300 IKRLG 304
           IKR+G
Sbjct: 310 IKRIG 314


>gi|300021780|ref|YP_003754391.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299523601|gb|ADJ22070.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 326

 Score =  286 bits (731), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 142/303 (46%), Positives = 187/303 (61%), Gaps = 1/303 (0%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD 61
           ++  I+  LR    +LRG+   N  L  ITWFR GG A+V+F P D  DL YFL   P D
Sbjct: 1   MFDDITSELRALMPELRGRLIANASLADITWFRVGGPAQVLFTPADEADLAYFLKRKPRD 60

Query: 62  IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRH 121
           +P+ ++GLGSN+LVRD G+ GVV+RL   GF  I++     +  G       +A +A   
Sbjct: 61  LPVFVMGLGSNLLVRDGGVAGVVIRLGR-GFGEIKIEEGGRLRAGTAVPDVKVARAAAEA 119

Query: 122 GIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS 181
           GI G  F+ GIPGSIGGA  MNAGA+  ET   ++    +D +GN HV+    + + YR 
Sbjct: 120 GISGLAFYRGIPGSIGGALRMNAGAHGRETKDCLIGARAVDPEGNVHVLSLADMGFTYRH 179

Query: 182 SEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
           S I +  I T    +G P     I   +  V  +RE  QPIKE+TGGSTFKNP GHSAW+
Sbjct: 180 SAIPETWIFTEATYQGAPGDPAEILKEMDAVAEYREQNQPIKERTGGSTFKNPPGHSAWK 239

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           L++ +GCRGL  GGAK+SE+HCNF+IN   A+G D+E LGE VR +V  +SG+ L WEI 
Sbjct: 240 LVDDAGCRGLRVGGAKVSEMHCNFLINDRQASGEDVERLGETVRARVKAKSGVTLNWEII 299

Query: 302 RLG 304
           RLG
Sbjct: 300 RLG 302


>gi|188582369|ref|YP_001925814.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacterium
           populi BJ001]
 gi|254764213|sp|B1ZGP6|MURB_METPB RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|179345867|gb|ACB81279.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacterium
           populi BJ001]
          Length = 309

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 137/295 (46%), Positives = 179/295 (60%), Gaps = 1/295 (0%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           +R     LRG+  EN  L  +TWFR GG A+V+F P D  DL  FL  L   +P+T++GL
Sbjct: 10  IRAAAPDLRGRLLENQSLSDLTWFRVGGPAQVLFSPADEEDLAAFLAALDPSVPVTVIGL 69

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
           GSN++VRD GI GV +RL    F ++E+     +  G       LA +A    + G  FF
Sbjct: 70  GSNLIVRDGGIPGVTIRLGGKAFGSVEIDGET-IRAGTAVPDMRLAKAAAEASLDGLAFF 128

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLI 189
            GIPGS+GGA  MNAGA+  ET+  + E  GIDR G        ++ ++YR S    D+I
Sbjct: 129 RGIPGSVGGALRMNAGAHGGETTDVLTEARGIDRNGAVRSFTHAEMGFRYRHSSAPDDVI 188

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
            T    RG P  +  I A +  V   RE  QPI+E+TGGSTFKNP G  AWQLI+ +GCR
Sbjct: 189 FTSATFRGRPGDREGIEAEMERVTAAREAAQPIRERTGGSTFKNPKGGKAWQLIDAAGCR 248

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           GL  GGA++SE+HCNF+IN   AT  D+E LGE+VR++V   SG  L WEIKR+G
Sbjct: 249 GLIRGGAQVSEMHCNFLINRGGATAADIEGLGEEVRRRVREHSGFELHWEIKRIG 303


>gi|90424795|ref|YP_533165.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodopseudomonas
           palustris BisB18]
 gi|122475815|sp|Q211U0|MURB_RHOPB RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|90106809|gb|ABD88846.1| UDP-N-acetylmuramate dehydrogenase [Rhodopseudomonas palustris
           BisB18]
          Length = 308

 Score =  282 bits (722), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 144/299 (48%), Positives = 188/299 (62%), Gaps = 1/299 (0%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           L+    QLRG+   N PL  +TWFR GG A+V+F P D  DL YFL  LP DI +T+VG+
Sbjct: 11  LKAAMPQLRGRLLGNEPLAPLTWFRVGGPAQVLFTPADADDLGYFLAALPRDIDVTVVGV 70

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
           GSN++VRD G+ GVV+RL   GF          +  G+    K +A +A   G+GG  F+
Sbjct: 71  GSNLIVRDGGLPGVVIRLGGRGFGETGTDGDV-VSAGSAALDKRVAEAAAAAGLGGLEFY 129

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLI 189
           +GIPG+IGGA  MNAGAN  ET   +++   I R G  H +   ++ + YR S     LI
Sbjct: 130 HGIPGTIGGALRMNAGANGRETKDVLIDASAIARDGTLHRLSNAEMGFSYRHSGADPALI 189

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
            T    RG P  +  I A +  V  HRET QP++EKTGGSTFKNP GHSAW+LI+ +GCR
Sbjct: 190 FTSARFRGEPMDRAAIRARMDEVQRHRETAQPVREKTGGSTFKNPPGHSAWKLIDAAGCR 249

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFD 308
           GL  GGA++SE+HCNF+IN  +AT  D+E LG+ VR +V    GI L+WEIKR+G   D
Sbjct: 250 GLRVGGAQVSEMHCNFLINTGSATAQDIETLGDTVRARVKEHCGIELQWEIKRIGRALD 308


>gi|75675247|ref|YP_317668.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrobacter
           winogradskyi Nb-255]
 gi|90109780|sp|Q3STS5|MURB_NITWN RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|74420117|gb|ABA04316.1| UDP-N-acetylmuramate dehydrogenase [Nitrobacter winogradskyi
           Nb-255]
          Length = 305

 Score =  278 bits (712), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 141/304 (46%), Positives = 187/304 (61%), Gaps = 1/304 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  I   L+ R   LRG+   N  L  +TWFR GG A+ +F P D  DL YFL+ LP 
Sbjct: 1   MTFPDIVPELKSRMPDLRGRLLANESLAPLTWFRVGGPAQALFTPADEDDLAYFLSHLPE 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           +IP+  +G+GSN++VRD G+ GVV+RL   GF  I +     +  GA    K +A +A  
Sbjct: 61  EIPVCCIGVGSNLIVRDRGLPGVVIRLPPRGFGEITIDGDA-VHAGAAALDKRVAEAAAA 119

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             I G  F++GIPG+IGGA  MNAGAN  ET   +VE   + R+G +       + + YR
Sbjct: 120 ASISGLEFYFGIPGTIGGALRMNAGANGSETRDVLVEARALSRRGERMTFDNFAMAFDYR 179

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
           SS I   +I T  + RG       I A +  V  HRETVQPI+EKTGGSTFKNP G SAW
Sbjct: 180 SSGIDPSVIFTGAMFRGRIAEPQAIRARMNEVQAHRETVQPIREKTGGSTFKNPPGQSAW 239

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LI+ +G RG   GGA++S++HCNF+IN   AT  D+E LGE VR++V   SG+ L+WEI
Sbjct: 240 KLIDAAGMRGHRVGGAQVSDMHCNFLINTGEATARDIETLGESVRERVKRHSGVDLQWEI 299

Query: 301 KRLG 304
           KR+G
Sbjct: 300 KRIG 303


>gi|83312949|ref|YP_423213.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Magnetospirillum
           magneticum AMB-1]
 gi|123540759|sp|Q2W0H1|MURB_MAGMM RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|82947790|dbj|BAE52654.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Magnetospirillum
           magneticum AMB-1]
          Length = 307

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 130/294 (44%), Positives = 185/294 (62%), Gaps = 2/294 (0%)

Query: 11  RERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLG 70
           R+   +++G+   + P+   TWFR GGNAE +F+P D+ DL   L +LP  +P+T+VG+G
Sbjct: 10  RDMLPRVQGRMSFDAPMAPFTWFRVGGNAEALFRPADLDDLIAVLEVLPPQVPVTVVGVG 69

Query: 71  SNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFY 130
           SN+LVRD G+ G+V+RL+   F+ I+V     +  GA     ++A +A   G+ G  F  
Sbjct: 70  SNLLVRDGGVPGMVIRLAGP-FATIDVMGDT-ITAGAGALDLTVARTAEEAGLAGLEFLS 127

Query: 131 GIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLII 190
           G+PG+IGGA  MNAGA   E     V    +DR GN  ++  E+L + YR S + +  I 
Sbjct: 128 GVPGTIGGALRMNAGAFGAEMKDVTVSAQALDRAGNLQILGPEELGFSYRRSAVPEGWIF 187

Query: 191 THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRG 250
               L+G P     I A +A +   RE  QP+K +TGGSTF NP GHSAW+LI+ +GCRG
Sbjct: 188 LSASLKGRPGKPADIGARMAEIARVREESQPVKVRTGGSTFANPEGHSAWKLIDAAGCRG 247

Query: 251 LEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           L  GGA++SE HCNF++N  +AT  D+E LGE+VR++V   SGI L WEI+R+G
Sbjct: 248 LVMGGAQVSEKHCNFLLNTGDATAADIEDLGEEVRRRVLETSGIDLHWEIRRIG 301


>gi|158426184|ref|YP_001527476.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Azorhizobium
           caulinodans ORS 571]
 gi|187609722|sp|A8HZA5|MURB_AZOC5 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|158333073|dbj|BAF90558.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Azorhizobium
           caulinodans ORS 571]
          Length = 308

 Score =  275 bits (703), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 134/290 (46%), Positives = 184/290 (63%), Gaps = 2/290 (0%)

Query: 15  KQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNIL 74
            +LRGK   N P+  +TWFR GG A+V+FQP D  DL Y L  LP++IP+T++GLGSN++
Sbjct: 18  PELRGKLTANAPIADVTWFRVGGPAQVLFQPADEADLAYALAHLPAEIPVTVIGLGSNLI 77

Query: 75  VRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPG 134
           VRD G+ G+V+RL   GF++I V +   ++ GA      +A +A   G+ G  F  GIPG
Sbjct: 78  VRDGGVPGMVIRLGR-GFTDIAV-DGTTIVAGAGVPDVKVARAAADAGLAGLAFLRGIPG 135

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVV 194
           +IGGA  MN GA   ET   ++    +DR G  H++  + + + YR S   +D I T   
Sbjct: 136 AIGGALRMNGGAYGGETKDALMSARAVDRAGRIHILSLDDMGFTYRHSAAPEDFIFTQAT 195

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
            RG P     I A +  +   RE  QPIK +TGGSTFKNP GH AWQL++ +GCRGL  G
Sbjct: 196 FRGTPGEVAEIQAEMERITSSREATQPIKSRTGGSTFKNPPGHKAWQLVDAAGCRGLVLG 255

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            A++SE+H NF+IN   AT  ++E LGE+VR++V   SG+ LEWEIKR+G
Sbjct: 256 RAQVSEMHTNFLINLGCATAAEIEGLGEEVRRRVLETSGVTLEWEIKRIG 305


>gi|154244281|ref|YP_001415239.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Xanthobacter
           autotrophicus Py2]
 gi|154158366|gb|ABS65582.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Xanthobacter
           autotrophicus Py2]
          Length = 345

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 135/295 (45%), Positives = 187/295 (63%), Gaps = 2/295 (0%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           L+ R   LRG  + N PL + TWFR GG A+V+F P D  DL  FL  LP+++P+T++GL
Sbjct: 48  LKARLPGLRGSLKANAPLAEFTWFRAGGPAQVLFVPADEDDLATFLAGLPAEVPVTVIGL 107

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
           GSN++VRD G+ GVV+RL+  GF++I V  +  +I GA      +A +A   G+ GF F 
Sbjct: 108 GSNLIVRDGGVPGVVIRLAR-GFTDIAVEGN-RIIAGAGVPDVKVARAAADAGLAGFSFL 165

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLI 189
            GIPG++GGA  MN GA   ET   +V    + R G +      ++ + YR   +  D++
Sbjct: 166 RGIPGAVGGALRMNGGAYGGETKDVLVSADAVTRAGAKVRFTNAEMGFTYRHCGVPADVV 225

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
            T  V  G P    +I+A +A +   RE  QPIK +TGGSTFKNP G SAW+L++ +GCR
Sbjct: 226 FTRAVFEGRPGDPAVIAAEMAKITESREATQPIKSRTGGSTFKNPPGTSAWKLVDAAGCR 285

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           GL  G A++SELH NF+IN   AT  ++E LGE+VR++V  Q GI LEWEIKR+G
Sbjct: 286 GLTIGRAQVSELHTNFLINLGGATAAEIEGLGEEVRRRVKAQCGIELEWEIKRIG 340


>gi|197105783|ref|YP_002131160.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Phenylobacterium
           zucineum HLK1]
 gi|254765517|sp|B4RFG1|MURB_PHEZH RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|196479203|gb|ACG78731.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Phenylobacterium
           zucineum HLK1]
          Length = 300

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 134/296 (45%), Positives = 180/296 (60%), Gaps = 3/296 (1%)

Query: 11  RERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLG 70
           ++R   +RGK   + PL   TWFR GG A+V+F P+D  DL  FL  LP+++P+T++G+G
Sbjct: 4   KDRLPAVRGKLLRDEPLAPFTWFRVGGPADVIFLPEDEDDLAAFLKALPAEVPVTVLGVG 63

Query: 71  SNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFY 130
           SN LVRD G+ GVV+RL  A F+ +E R    +  GA      +A  A + GI G  F+ 
Sbjct: 64  SNTLVRDGGVDGVVIRLGKA-FAKVEPRGEGRLYAGAAALDAVVAREAGKAGIAGLEFYR 122

Query: 131 GIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE--ITKDL 188
           G+PG+IGGA  MNAG    ET   +VE + + R G +  +    L Y YR S     + L
Sbjct: 123 GVPGTIGGALVMNAGCYGAETKDVLVEAYALTRAGERLTLSNADLGYSYRKSARAAAEPL 182

Query: 189 IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGC 248
           I    +  G P+    I A +A +   RE  QPI+EKTGGSTFKNP GHS+W+L++++G 
Sbjct: 183 IFLGALFEGRPDDPAAIEARMAEITERREKTQPIREKTGGSTFKNPPGHSSWKLVDEAGW 242

Query: 249 RGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           RG  FGGA  S LH NF+IN   AT  DLE LGE VR  V  + G+ L+WEIKR+G
Sbjct: 243 RGKLFGGAMFSPLHSNFLINTGEATAADLEGLGEAVRADVKAKFGVDLDWEIKRIG 298


>gi|209963944|ref|YP_002296859.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodospirillum
           centenum SW]
 gi|209957410|gb|ACI98046.1| UDP-N-acetylenolpyruvoylglucosamine reductase, putative
           [Rhodospirillum centenum SW]
          Length = 317

 Score =  273 bits (697), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 135/300 (45%), Positives = 188/300 (62%), Gaps = 7/300 (2%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           L +R  ++RG+   + PL  +TWFR GG A+V+F+P D  DL  FL   P+D+P+T++G+
Sbjct: 12  LIDRLPRVRGRLTADAPLGPMTWFRVGGTADVLFRPADADDLAGFLAGCPADVPVTVIGV 71

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
            SN+LVRD G+ GVV+RL    F+ I V     ++ GA     ++A +A   G+ G  F 
Sbjct: 72  ASNLLVRDGGVPGVVIRLGGP-FAEIAVEGD-RLVAGAGALDYNVALTAQHEGLAGLEFL 129

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLI 189
            GIPG+IGGA  MNAGA   ET+  VV   GIDR G +    R  L   YR   + +D+I
Sbjct: 130 SGIPGTIGGALRMNAGAYGRETADLVVTAEGIDRAGRRLRFDRAGLHLGYRHCGVPEDVI 189

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPT-----GHSAWQLIE 244
            T  VL+G P  +  I+ A+  +   R   QP++ +TGGSTF NP      G  AWQLI+
Sbjct: 190 FTGAVLQGTPGDKAAIATAMDAIQKARADSQPVRARTGGSTFANPDPELSGGAKAWQLID 249

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           ++GCRGL+ GGA++SE HCNF++N  +AT  DLE LGE+VR++V   SGI L WEI+R+G
Sbjct: 250 RAGCRGLQIGGAQVSEKHCNFLLNLGDATAADLEGLGEEVRRRVLETSGIELRWEIRRIG 309


>gi|23014454|ref|ZP_00054269.1| COG0812: UDP-N-acetylmuramate dehydrogenase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 305

 Score =  272 bits (695), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 130/304 (42%), Positives = 186/304 (61%), Gaps = 2/304 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M+  R     R+   +++G+   + P+   TWFR GGNAE MF+P D+ DL   L +LP+
Sbjct: 1   MMTARKYSDWRDALPEVQGRMSFDAPMAPFTWFRVGGNAEAMFRPADLDDLIAVLEVLPA 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           D+P+T+VG+GSN+LVRD G+ G+V+RL+   F+ I+V     +  GA     ++A  A  
Sbjct: 61  DVPVTVVGVGSNLLVRDGGVPGMVIRLAGP-FATIDVAGDI-ITAGAGALDLTVARVAEE 118

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
            G+ G  F  G+PG+IGG   MNAGA   E     V    +DR GN H++  E+L + YR
Sbjct: 119 AGLAGLEFLSGVPGTIGGGLRMNAGAFGTEMKDVTVSAQALDRAGNLHILGPEELGFTYR 178

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
            S + +  I     L+G       I   +A +   RE  QP+K +TGGSTF NP G SAW
Sbjct: 179 RSAVPEGWIFLSASLQGRAGKPAEIGQRMAEIAKAREDSQPVKVRTGGSTFANPEGMSAW 238

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LI+ +GCRGL  GGA++SE HCNF++N  +AT  D+E LGE+VR++V   SG+ L WEI
Sbjct: 239 KLIDAAGCRGLVMGGAQVSEKHCNFLLNTGDATAADIEDLGEEVRRRVLETSGVDLHWEI 298

Query: 301 KRLG 304
           +R+G
Sbjct: 299 RRIG 302


>gi|170744730|ref|YP_001773385.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacterium sp.
           4-46]
 gi|168199004|gb|ACA20951.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacterium sp.
           4-46]
          Length = 304

 Score =  270 bits (691), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 130/287 (45%), Positives = 185/287 (64%), Gaps = 1/287 (0%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRD 77
           RG+   + PL  +TWFR GG A+++F P D  DL   L  LP+++P+T++GLGSN++VRD
Sbjct: 16  RGRLLPDHPLADLTWFRVGGPADLLFTPADEEDLAAALRALPAEVPVTVIGLGSNLIVRD 75

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G+RG+V+RL    F +IE+     +  GA      LA +A   G+ G  F+ GIPGS+G
Sbjct: 76  GGVRGLVIRLGGRAFGSIEIEGDT-VRAGAAVPDVRLARAAAEAGLDGMAFYRGIPGSVG 134

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRG 197
           GA  MNAGA+  ET+  +VE  G+ R+G        ++ + YR + + + ++ T  + RG
Sbjct: 135 GALRMNAGAHGGETTDVLVEARGVTREGEIRRFGHAEMGFSYRHAAVPESVVFTGALFRG 194

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P  +  I A +  V   RE  QPI+E+TGGSTFKNP G  AWQLI+ +GCRGL  GGA+
Sbjct: 195 RPGDRAAILAEMDRVTAAREAAQPIRERTGGSTFKNPEGRKAWQLIDAAGCRGLRRGGAQ 254

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           +SE+HCNF+IN   A+  ++E LGE+VR +V  QSG+ L WEIKR+G
Sbjct: 255 VSEMHCNFLINTGGASAAEIEGLGEEVRARVRAQSGVELHWEIKRIG 301


>gi|329888139|ref|ZP_08266737.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brevundimonas
           diminuta ATCC 11568]
 gi|328846695|gb|EGF96257.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brevundimonas
           diminuta ATCC 11568]
          Length = 302

 Score =  270 bits (691), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 131/292 (44%), Positives = 177/292 (60%), Gaps = 5/292 (1%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RGK   N PL   TWFR GG A+ +F P D  DL  FL  LP D+P+T++G+GSN++VR
Sbjct: 10  VRGKLLLNEPLGPYTWFRVGGAADALFIPADADDLADFLKTLPEDVPVTVIGVGSNLIVR 69

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ GVV+RL+   +  +   +   +  GA      +A ++ + GI G  F+ GIPGSI
Sbjct: 70  DGGVEGVVIRLAGRAWGQVTT-DGVTVTAGAGALDSMVARASAKAGIAGLEFYAGIPGSI 128

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAG    ET   +V   G++RKG +  +      Y YR S    D+I      R
Sbjct: 129 GGALTMNAGCYGSETKDVLVSAWGLNRKGERVELALADFGYTYRHSNAPADIIWVEATYR 188

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRG----LE 252
           G P++   ++A I  +   RE  QPI+EKTGGSTFKNP GHS+W+L++++G RG    + 
Sbjct: 189 GTPDAPEAVAARINEITERREKTQPIREKTGGSTFKNPEGHSSWRLVDEAGWRGKLHAVT 248

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            GGAK SELH NFMIN   AT  D+E LGE VR  V  ++G+ L WEIKR+G
Sbjct: 249 GGGAKFSELHSNFMINPGEATAADIEGLGEAVRADVLEKTGVQLNWEIKRIG 300


>gi|83592284|ref|YP_426036.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodospirillum
           rubrum ATCC 11170]
 gi|123527092|sp|Q2RVU6|MURB_RHORT RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|83575198|gb|ABC21749.1| UDP-N-acetylmuramate dehydrogenase [Rhodospirillum rubrum ATCC
           11170]
          Length = 319

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 134/313 (42%), Positives = 185/313 (59%), Gaps = 7/313 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           MI  R    L +R   +RG+   +  L  +TWFR GG AE MF+P D  DL  FL   P 
Sbjct: 1   MIALRAPTPLIDRLPAVRGRLSADVALAPVTWFRVGGPAEAMFKPADAQDLADFLAGRPR 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           D+ + ++G+ SN+LVRD G+ GVV+RL  A F+ +EV     ++ GA     ++A  A  
Sbjct: 61  DVAVRVIGVASNLLVRDGGVPGVVIRLGRA-FTGVEVVGET-LVCGASALDATVAKVAEA 118

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
            G+ G  F  GIPG++GGA  MNAGA+  E +  VV    +D  G  H +   Q+ + YR
Sbjct: 119 AGLAGLEFLSGIPGTLGGALRMNAGAHLREMADIVVLATAVDGLGQSHTLTPAQMGFSYR 178

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPT----- 235
           +  + +D I T  VL G P+ +  I+A +  +   RE  QP++ +TGGSTF NP      
Sbjct: 179 ACALPEDWIFTGCVLAGRPDERGAIAARMEALRQAREASQPLRARTGGSTFANPDPDLSG 238

Query: 236 GHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGIL 295
           G  AW+LI+ +GCRGL  GGA++SE HCNF+IN   AT  DLE LGE VR++V + SG+ 
Sbjct: 239 GRRAWELIDAAGCRGLRLGGAQVSEKHCNFLINTGEATAADLEALGETVRRRVMDTSGVA 298

Query: 296 LEWEIKRLGDFFD 308
           L WEIKR+G   D
Sbjct: 299 LRWEIKRIGIGLD 311


>gi|239947810|ref|ZP_04699563.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia
           endosymbiont of Ixodes scapularis]
 gi|239922086|gb|EER22110.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia
           endosymbiont of Ixodes scapularis]
          Length = 305

 Score =  269 bits (688), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 135/289 (46%), Positives = 188/289 (65%), Gaps = 3/289 (1%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           ++G++++++ LK +TWF+ GGNAE+ F+P D  DL  FL      +PIT  G GSNI++R
Sbjct: 7   VKGEYKKDYNLKHLTWFKVGGNAEIFFKPLDSEDLASFLIQNKQKLPITTFGAGSNIIIR 66

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D  I GVV++L    FSNIE  +   ++VG+ C   +LA     + I GF F  GIPG+I
Sbjct: 67  DGSIEGVVIKLGQ-NFSNIEFIDDNHLVVGSSCLNYNLAKFCQVNAISGFEFLVGIPGTI 125

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GG   MNAGA + E    +V++  ID  GN      E++ ++YRS+ + KDLII   V +
Sbjct: 126 GGGVAMNAGAYDSEFKDIIVKIEAIDFAGNFRAFTNEEIGFKYRSNNLPKDLIILKAVFK 185

Query: 197 -GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
               +S+NI+   +  + + R + QPIKE+TGGSTF NP G  +W+LI+K+G RG   GG
Sbjct: 186 INKGDSENIL-LRMNEINNARSSTQPIKERTGGSTFANPEGLKSWELIDKAGLRGYRIGG 244

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           A +SELHCNFMIN  +AT  DLE LG+ VR+KVF  SG+ LEWEIKR+G
Sbjct: 245 ASMSELHCNFMINNGDATAKDLEDLGDFVRQKVFENSGVKLEWEIKRIG 293


>gi|238650472|ref|YP_002916324.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia peacockii
           str. Rustic]
 gi|259509760|sp|C4K125|MURB_RICPU RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|238624570|gb|ACR47276.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia peacockii
           str. Rustic]
          Length = 295

 Score =  269 bits (688), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 140/290 (48%), Positives = 190/290 (65%), Gaps = 6/290 (2%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           ++G++++++ LK +TWF+ GGNAE+ F+P D  DLK FL      +PI   G GSNI++R
Sbjct: 7   VKGEYKKDYNLKHLTWFKVGGNAEIFFKPLDSEDLKSFLIQNKQKLPIKTFGAGSNIIIR 66

Query: 77  DAGIRGVVLRLSNAGFSNIE-VRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           D GI GVV++L    FSNIE + NH  +IVG+ C   +LA     + I GF F  GIPG+
Sbjct: 67  DGGIEGVVIKLGQ-NFSNIEFIDNH--LIVGSSCLNYNLAKFCQANAISGFEFLVGIPGT 123

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           IGG   MNAGA   E    VV++  ID  GN      E + ++YRS+ + K+LII  VV 
Sbjct: 124 IGGGVAMNAGAYGSEFKDIVVQIEAIDFAGNFLTFTNEAIGFKYRSNNLPKNLIILKVVF 183

Query: 196 R-GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
           +    +S+NI+   +  + + R + QPIKE+TGGSTF NP GH +W+LI+K+G RG   G
Sbjct: 184 KINKGDSENIL-LRMNEINNARSSTQPIKERTGGSTFANPEGHKSWELIDKAGLRGYRIG 242

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           GA +SELHCNFMIN  +AT  DLE LG+ VR+KV   SG+ LEWEIKR+G
Sbjct: 243 GASMSELHCNFMINNGDATAKDLEDLGDFVRQKVCEDSGVKLEWEIKRIG 292


>gi|91205777|ref|YP_538132.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia bellii
           RML369-C]
 gi|122425435|sp|Q1RHX1|MURB_RICBR RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|91069321|gb|ABE05043.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia bellii
           RML369-C]
          Length = 302

 Score =  269 bits (688), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 135/288 (46%), Positives = 179/288 (62%), Gaps = 1/288 (0%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           ++G++++++ LK +TWF+ GGNAE+ F+P D  DL  FL      +PIT  G GSNI++R
Sbjct: 6   VKGEYRKDYNLKHLTWFKVGGNAEIFFKPVDSEDLASFLVQNKQKLPITTFGAGSNIIIR 65

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GI GV ++L    FSNI+  +   +IVG+ C   SLA     + I GF F  GIPG+I
Sbjct: 66  DGGIEGVTIKLGQ-NFSNIDFTDDGHLIVGSSCLNFSLAKFCQVNAISGFEFLVGIPGTI 124

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GG   MNAGA  CE    +V +  ID  GN      E++ ++YR + + KDLII   V +
Sbjct: 125 GGGVAMNAGAYGCEFKDILVRIEAIDFAGNFRTFTNEEIGFKYRGNNLPKDLIILKAVFK 184

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
               +   I A +  +   R + QPIKE+TGGSTF NP G  +WQLI+K+G RG   G A
Sbjct: 185 VNKGNSEDILARMNEINAARSSTQPIKERTGGSTFANPEGFKSWQLIDKAGLRGYRIGDA 244

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            ISELHCNFMIN  NAT  +LE LG  V++KVF  SGI L WEIKR+G
Sbjct: 245 SISELHCNFMINNGNATAKELEDLGNFVQQKVFEDSGIKLNWEIKRIG 292


>gi|304321498|ref|YP_003855141.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Parvularcula
           bermudensis HTCC2503]
 gi|303300400|gb|ADM09999.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Parvularcula
           bermudensis HTCC2503]
          Length = 296

 Score =  269 bits (687), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 137/292 (46%), Positives = 181/292 (61%), Gaps = 7/292 (2%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDA 78
           GK   + PL   TW R GG A+ +F P    +L  FL  +P+D P++++G+GSN+LVRD 
Sbjct: 5   GKLLTDAPLAPYTWLRVGGPADRLFLPNTEAELSAFLADMPADEPLSVIGIGSNLLVRDG 64

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIRG V+RL  +GF  IEV   C +  GA     S+A +A R GI G  F+ GIPGSIGG
Sbjct: 65  GIRGTVIRL-GSGFGTIEVEG-CRVRAGAAALDASVAKAAGRAGITGLEFYRGIPGSIGG 122

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGF 198
           A  MNAGA   ET   +VE   +DR+GN+H++  E++ + YR S +  D I+   V  G 
Sbjct: 123 ALRMNAGAYGGETKDVLVEATVLDRRGNRHLMTAEEMGFSYRRSSLPPDWIVVSAVFEGQ 182

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPT-----GHSAWQLIEKSGCRGLEF 253
                 I A +A++   RE  QPIK +TGGSTFKNP      G S+WQLI+  G RG   
Sbjct: 183 EGDPARIEARMADIMAKREATQPIKSRTGGSTFKNPDPSRSEGRSSWQLIDAIGARGRVV 242

Query: 254 GGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           G A++S+LH NFMIN   AT  DLE LGE +R+ V ++ G+ LEWEIKR+GD
Sbjct: 243 GDAQMSDLHANFMINRGAATAADLEALGEGIRRDVKDRFGVELEWEIKRVGD 294


>gi|157827095|ref|YP_001496159.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia bellii
           OSU 85-389]
 gi|166222848|sp|A8GW95|MURB_RICB8 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|157802399|gb|ABV79122.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia bellii
           OSU 85-389]
          Length = 310

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 138/300 (46%), Positives = 182/300 (60%), Gaps = 6/300 (2%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           ++G++++++ LK +TWF+ GGNAE+ F+P D  DL  FL      +PIT  G GSNI++R
Sbjct: 6   VKGEYRKDYNLKHLTWFKVGGNAEIFFKPVDSEDLASFLVQNKQKLPITTFGAGSNIIIR 65

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GI GV ++L    FSNI   +   +IVG+ C   SLA     + I GF F  GIPG+I
Sbjct: 66  DGGIEGVTIKLGQ-NFSNIGFTDDGHLIVGSSCLNFSLAKFCQVNAISGFEFLVGIPGTI 124

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GG   MNAGA  CE    +V +  ID  GN      E++ ++YR + + KDLII   V +
Sbjct: 125 GGGVAMNAGAYGCEFKDILVRIEAIDFAGNFRTFTNEEIGFKYRGNNLPKDLIILKAVFK 184

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
               +   I A +  +   R + QPIKE+TGGSTF NP G  +WQLI+K+G RG   G A
Sbjct: 185 VNKGNSEDILARMNEINAARSSTQPIKERTGGSTFANPEGFKSWQLIDKAGLRGYRIGDA 244

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD-----FFDHQI 311
            ISELHCNFMIN  NAT  +LE LG  V++KVF  SGI L WEIKR+G      + DH I
Sbjct: 245 SISELHCNFMINNGNATAKELEDLGNFVQQKVFEDSGIKLNWEIKRIGKVSSRAWLDHGI 304


>gi|34580725|ref|ZP_00142205.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia sibirica
           246]
 gi|28262110|gb|EAA25614.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia sibirica
           246]
          Length = 295

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 138/290 (47%), Positives = 191/290 (65%), Gaps = 6/290 (2%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           ++G++++++ LK +TWF+ GGNAE+ F+P D  DLK FL      +PI   G GSN+++R
Sbjct: 7   VKGEYKKDYNLKHLTWFKVGGNAEIFFKPLDSEDLKSFLIQNKQKLPIKTFGAGSNVIIR 66

Query: 77  DAGIRGVVLRLSNAGFSNIE-VRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           D GI GVV++L    FSNIE + NH  +IVG+ C   +LA     + I GF F  GIPG+
Sbjct: 67  DGGIEGVVIKLGQ-NFSNIEFIDNH--LIVGSSCLNYNLAKFCQANAISGFEFLVGIPGT 123

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           IGG   MNAGA   E    VV++  ID  GN      E++ ++YRS+++ K+LII  VV 
Sbjct: 124 IGGGVAMNAGAYGSEFKDIVVQIEAIDFAGNFLTFTNEEIGFKYRSNDLPKNLIILKVVF 183

Query: 196 R-GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
           +    +S+NI+   +  + + R + QPIKE+TGGSTF NP G  +W+LI+K+G RG   G
Sbjct: 184 KINKGDSENIL-LRMNEINNARSSTQPIKERTGGSTFANPEGRKSWELIDKAGLRGYRIG 242

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           GA +SELHCNFMIN  +AT  DLE LG+ VR+KV   SG+ LEWEIKR+G
Sbjct: 243 GASMSELHCNFMINNGDATAKDLEDLGDFVRQKVCEDSGVKLEWEIKRIG 292


>gi|157964318|ref|YP_001499142.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia massiliae
           MTU5]
 gi|157844094|gb|ABV84595.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia massiliae
           MTU5]
          Length = 325

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 138/290 (47%), Positives = 189/290 (65%), Gaps = 6/290 (2%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           ++G++++++ LK +TWF+ GGNAE+ F+P D  DLK FL      +PI   G GSNI++R
Sbjct: 37  VKGEYKKDYNLKHLTWFKVGGNAEIFFKPLDREDLKSFLIQNKQKLPIKTFGAGSNIIIR 96

Query: 77  DAGIRGVVLRLSNAGFSNIE-VRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           D GI GVV++L    FSNIE + NH  +IVG+ C   +LA     + I GF F  GIPG+
Sbjct: 97  DGGIEGVVIKLGQ-NFSNIEFIDNH--LIVGSSCLNYNLAKFCQANAISGFEFLVGIPGT 153

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           IGG   MNAGA   E    +V++  ID  GN      E++ ++YRS+ + K+LII   V 
Sbjct: 154 IGGGVAMNAGAYGSEFKDIIVQIEAIDFAGNFLTFTNEEIGFKYRSNNLPKNLIILKAVF 213

Query: 196 R-GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
           +    +S+NI+   +  + + R + QPIKE+TGGSTF NP G  +W+LI+K G RG   G
Sbjct: 214 KINKGDSENIL-LRMNEINNARSSTQPIKERTGGSTFANPAGRKSWELIDKVGLRGYRIG 272

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           GA +SELHCNFMIN  +AT  DLE LG+ VR+KVF  SG+ LEWEIKR+G
Sbjct: 273 GASMSELHCNFMINNGDATAKDLEDLGDFVRQKVFEDSGVKLEWEIKRIG 322


>gi|187609765|sp|A8F109|MURB_RICM5 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
          Length = 295

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 138/290 (47%), Positives = 189/290 (65%), Gaps = 6/290 (2%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           ++G++++++ LK +TWF+ GGNAE+ F+P D  DLK FL      +PI   G GSNI++R
Sbjct: 7   VKGEYKKDYNLKHLTWFKVGGNAEIFFKPLDREDLKSFLIQNKQKLPIKTFGAGSNIIIR 66

Query: 77  DAGIRGVVLRLSNAGFSNIE-VRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           D GI GVV++L    FSNIE + NH  +IVG+ C   +LA     + I GF F  GIPG+
Sbjct: 67  DGGIEGVVIKLGQ-NFSNIEFIDNH--LIVGSSCLNYNLAKFCQANAISGFEFLVGIPGT 123

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           IGG   MNAGA   E    +V++  ID  GN      E++ ++YRS+ + K+LII   V 
Sbjct: 124 IGGGVAMNAGAYGSEFKDIIVQIEAIDFAGNFLTFTNEEIGFKYRSNNLPKNLIILKAVF 183

Query: 196 R-GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
           +    +S+NI+   +  + + R + QPIKE+TGGSTF NP G  +W+LI+K G RG   G
Sbjct: 184 KINKGDSENIL-LRMNEINNARSSTQPIKERTGGSTFANPAGRKSWELIDKVGLRGYRIG 242

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           GA +SELHCNFMIN  +AT  DLE LG+ VR+KVF  SG+ LEWEIKR+G
Sbjct: 243 GASMSELHCNFMINNGDATAKDLEDLGDFVRQKVFEDSGVKLEWEIKRIG 292


>gi|144897249|emb|CAM74113.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 308

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 130/294 (44%), Positives = 181/294 (61%), Gaps = 2/294 (0%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
           + RG+   + PL  +TWFR GGNAEV+F+P D+ DL  FL  LP DIP+T++G+GSN+LV
Sbjct: 16  KTRGRLTVDAPLGGLTWFRVGGNAEVLFRPADVDDLAEFLMQLPLDIPVTVIGVGSNLLV 75

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD G+ GVV+RL+ + F +I+V     +  GA     ++A +A   G+ G  F  G+PG+
Sbjct: 76  RDGGVSGVVVRLAGS-FGHIDVMGDI-ITAGAAALDMTVALTAEEAGLTGMEFLSGVPGT 133

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           IGGA  MNAGA   E     +    IDR G   ++    L   YR      + I     L
Sbjct: 134 IGGALRMNAGAFGGEMKDITLSATAIDRAGTTQLLTLPDLDMSYRHCGCPDEYIFLSATL 193

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           +G       I+A +A +   RE  QP + +TGGSTF NP G  AW+LI+K+GCRGL  GG
Sbjct: 194 QGKRGQPAAIAAKMAEIKTAREDSQPTRVRTGGSTFANPPGQKAWELIDKAGCRGLVMGG 253

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDH 309
           A++SE HCNF++N   A+  D+E LG++VR++V   SGI LEWEI+R+GD  +H
Sbjct: 254 AQVSEKHCNFLLNLGEASAADIENLGDEVRRRVLETSGIELEWEIRRIGDKGEH 307


>gi|85373188|ref|YP_457250.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Erythrobacter
           litoralis HTCC2594]
 gi|122545202|sp|Q2NCY8|MURB_ERYLH RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|84786271|gb|ABC62453.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Erythrobacter
           litoralis HTCC2594]
          Length = 323

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 125/288 (43%), Positives = 182/288 (63%), Gaps = 1/288 (0%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RGK     PL ++ WF++GG A+ +F+P D+ DLK FL  L  D+P+  +GLGSN+++R
Sbjct: 35  IRGKLTNQAPLAKLVWFKSGGAADWLFEPADLDDLKTFLARLDGDLPVMALGLGSNLIIR 94

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ GVV++L  A F+++E  +   +  GA   G  +A++A   GI G  F  GIPG+I
Sbjct: 95  DGGVPGVVIKLGKA-FASVETHDDYTVTCGAGAHGVLVASTARDAGIAGLEFMRGIPGTI 153

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GG   MNAGA   ET   +++   +   G+   +P   L+Y YR S +    ++    L+
Sbjct: 154 GGFVRMNAGAYGRETRDVLIDCDVVLPGGSFVTLPVADLQYTYRHSALPDGAVVVSARLQ 213

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G P    II A +  V   RE  QP++ KTGGSTFKNP G  AW+L++ +GCRGL  GGA
Sbjct: 214 GEPGDPEIIGAEMERVAEAREQSQPVRTKTGGSTFKNPPGKKAWELVDAAGCRGLTMGGA 273

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           ++SE H NF+IN D AT  D+E LGE+V+++V+  SG+ LEWEI+R+G
Sbjct: 274 QVSEKHTNFLINVDGATSADIEGLGEEVKRRVYAHSGVELEWEIQRVG 321


>gi|67459428|ref|YP_247052.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia felis
           URRWXCal2]
 gi|75536157|sp|Q4UKP0|MURB_RICFE RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|67004961|gb|AAY61887.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia felis
           URRWXCal2]
          Length = 295

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 136/291 (46%), Positives = 188/291 (64%), Gaps = 4/291 (1%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           ++G++++++ LK +TWF+ GGNAE+ F+P D  DL  FL      +PIT  G GSNI++R
Sbjct: 7   VKGEYKKDYSLKHLTWFKVGGNAEIFFKPFDSEDLASFLIQNKQKLPITTFGAGSNIIIR 66

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GI GV ++L    FSNIE  +   +IVG+ C   +LA     + I GF F  GIPG+I
Sbjct: 67  DGGIEGVTIKLGQ-NFSNIEFIDE-HLIVGSSCLNYNLAKFCQANAITGFEFLVGIPGTI 124

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GG   MNAGA + E    +V++  ID  GN      E++ ++YRS+ + KDLII   V +
Sbjct: 125 GGGVVMNAGAYDSEFKDIIVKIEAIDFAGNFLTFTNEEIGFKYRSNNLPKDLIILKAVFK 184

Query: 197 -GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
               +S+NI+   +  + + R   QPIKE+TGGSTF NP G  +W+LI+K+G RG   GG
Sbjct: 185 VNKGDSENIL-LRMNEINNARSATQPIKERTGGSTFANPEGLKSWELIDKAGLRGYRIGG 243

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           A +SELHCNFMIN  +AT  DLE LG+ VR+KVF  SG+ L+WEIKRLG +
Sbjct: 244 ASMSELHCNFMINNGDATAKDLEDLGDFVRQKVFEDSGVELKWEIKRLGRY 294


>gi|220927178|ref|YP_002502480.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacterium
           nodulans ORS 2060]
 gi|219951785|gb|ACL62177.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacterium
           nodulans ORS 2060]
          Length = 313

 Score =  265 bits (678), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 134/289 (46%), Positives = 184/289 (63%), Gaps = 1/289 (0%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
            LRG+   + PL  +TWFR GG A+V+F P D  DL   L  LP+D+P+T++GLGSN++V
Sbjct: 23  DLRGRLLADHPLADLTWFRVGGPAQVLFTPADEEDLAAALAALPADVPVTVIGLGSNLIV 82

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD G+ G+V+RL    F ++ V     +  GA      +A +A   G+ G  F+ GIPGS
Sbjct: 83  RDGGVPGLVVRLGGRAFGSVAVDGDT-IRAGAAVPDVKVARAAAEAGLDGLAFYRGIPGS 141

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           +GGA  MNAGA+  ET+  +VE  G+ R G   V    ++ + YR   +  D+I T  + 
Sbjct: 142 VGGALRMNAGAHGGETTDVLVEARGVTRAGEIRVFSHAEMGFSYRHCGVPADVIFTGALY 201

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           RG P  +  I A +  V   RE  QPI+E+TGGSTFKNP G  AWQLI+ +GCRGL  GG
Sbjct: 202 RGRPGDKAAILAEMDRVTAAREAAQPIRERTGGSTFKNPEGGKAWQLIDAAGCRGLRRGG 261

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           A++SE+HCNF+IN  +AT  D+E LGE+VR +V+  SG+ L WEIKR+G
Sbjct: 262 AQVSEMHCNFLINTGSATAADIEGLGEEVRARVWAASGVDLHWEIKRIG 310


>gi|307294493|ref|ZP_07574335.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sphingobium
           chlorophenolicum L-1]
 gi|306878967|gb|EFN10185.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sphingobium
           chlorophenolicum L-1]
          Length = 311

 Score =  265 bits (678), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 124/293 (42%), Positives = 181/293 (61%), Gaps = 1/293 (0%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
            +RG  + + PL  + WF+ GG A+ +F+P+D  DL  FL  L   IP+  +GLGSN++V
Sbjct: 10  SVRGSLKADAPLAPLVWFKAGGVAQWLFEPKDADDLSDFLGDLDPAIPVMALGLGSNLIV 69

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD G+ GVV+RL    F+ +E  +   +  G   SG  ++++A   GI G  F   IPG+
Sbjct: 70  RDGGVPGVVVRLGKP-FAKVEQLDATSLRCGGGASGILVSSTARDAGIAGLEFLRSIPGT 128

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           +GG   MN GA   ET   +VE   + R G +  +P + L Y YR S++ +  ++   V 
Sbjct: 129 VGGFVRMNGGAYGRETCDILVECEVVLRSGERVTLPLDALGYTYRHSKLPEGAVVVSAVF 188

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           RG P     I A +  +   RE  QP++ KTGGSTFKNP GH AW L++++GCRGL+ GG
Sbjct: 189 RGIPGESTAIQAEMDRIAAAREESQPLRSKTGGSTFKNPAGHKAWALVDEAGCRGLQLGG 248

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFD 308
           A++SE H NF++N  +AT  D+E LGE+VR++V  +SG+ LEWEI+R+G F D
Sbjct: 249 AQVSEKHTNFLLNLGDATSADIEALGEEVRRRVKAKSGVELEWEIQRVGSFAD 301


>gi|229586497|ref|YP_002844998.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia africae
           ESF-5]
 gi|228021547|gb|ACP53255.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia africae
           ESF-5]
          Length = 307

 Score =  265 bits (676), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 137/290 (47%), Positives = 189/290 (65%), Gaps = 6/290 (2%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           ++G++++++ LK +TWF+ GGNAE+ F+P D  DLK FL      +PI   G GSN+++R
Sbjct: 19  VKGEYKKDYNLKHLTWFKVGGNAEIFFKPLDSEDLKSFLIQNKQKLPIKTFGAGSNVIIR 78

Query: 77  DAGIRGVVLRLSNAGFSNIE-VRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           D GI GVV++L    FSNIE + NH  +IVG+ C   +LA     + I GF F  GIPG+
Sbjct: 79  DGGIEGVVIKLGQ-NFSNIEFIDNH--LIVGSSCLNYNLAKFCQANAISGFEFLVGIPGT 135

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           IGG   MNAGA   E    VV++  ID  GN      E++ ++YRS+ + K+LII   V 
Sbjct: 136 IGGGVAMNAGAYGSEFKDIVVQIEAIDFAGNFLTFTNEEIGFKYRSNNLPKNLIILKAVF 195

Query: 196 R-GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
           +    +S+NI+   +  + + R + QPIKE+TGGSTF NP G  +W+LI+K+G RG   G
Sbjct: 196 KINKGDSENIL-LRMNEIHNARSSTQPIKERTGGSTFANPEGRKSWELIDKAGLRGYRIG 254

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           GA +SELHCNFMIN  +AT  DLE LG+ VR+KV   SG+ LEWEIKR+G
Sbjct: 255 GASMSELHCNFMINNGDATAKDLEDLGDFVRQKVCEDSGVKLEWEIKRIG 304


>gi|20139045|sp|Q92IT8|MURB_RICCN RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
          Length = 295

 Score =  265 bits (676), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 138/290 (47%), Positives = 188/290 (64%), Gaps = 6/290 (2%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           ++G++++++ LK +TWF+ GGNAE+ F+P D  DLK FL      +PI   G GSNI++R
Sbjct: 7   VKGEYKKDYNLKHLTWFKVGGNAEIFFKPLDSEDLKSFLIQNKQKLPIKTFGAGSNIIIR 66

Query: 77  DAGIRGVVLRLSNAGFSNIE-VRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           D GI GVV++L    FSNIE V NH  +IVG+ C   +LA     + I GF F  GIPG+
Sbjct: 67  DGGIEGVVIKLGQ-NFSNIEFVDNH--LIVGSSCLNYNLAKFCQANAISGFEFLVGIPGT 123

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           IGG   MNAGA   E    VV++  ID  GN      E++ ++YRS+ + K+LII   V 
Sbjct: 124 IGGGVAMNAGAYGSEFKDIVVQIEAIDFAGNFLTFTNEEIGFKYRSNNLPKNLIILKAVF 183

Query: 196 R-GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
           +    +S+NI+   +  + + R + QPIKE+TGGSTF NP G  +W+LI+K+G RG   G
Sbjct: 184 KINKGDSENIL-LRMNEIKNARSSTQPIKERTGGSTFANPEGRKSWELIDKAGLRGYRIG 242

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           GA +SE HCNFMIN  +AT  DLE LG+ VR+KV   SG+ LEWEIKR+G
Sbjct: 243 GASMSEFHCNFMINNGDATAKDLEDLGDFVRQKVCEDSGVKLEWEIKRIG 292


>gi|254419085|ref|ZP_05032809.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brevundimonas sp.
           BAL3]
 gi|196185262|gb|EDX80238.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brevundimonas sp.
           BAL3]
          Length = 304

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 128/298 (42%), Positives = 176/298 (59%), Gaps = 5/298 (1%)

Query: 11  RERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLG 70
           R++   +RGK   + PL   TWFR GG AE +F P D  DL  FL  L   +P+T++G+G
Sbjct: 4   RDKLPTVRGKLLRDEPLAPFTWFRVGGTAEALFIPADAEDLADFLKALDEAVPVTVLGVG 63

Query: 71  SNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFY 130
           SN++VRD G+ GVV+RL+   ++ +       +  G       +A ++ + GI G  F+ 
Sbjct: 64  SNVIVRDGGVEGVVIRLAGRPWAQVTTDGDA-ITAGTGVLDSMVAKASAKAGIAGLEFYA 122

Query: 131 GIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLII 190
           GIPG++GGA  MNAG    ET   +V   G++RKG +         Y YR SE   D+I 
Sbjct: 123 GIPGTVGGALTMNAGCYGAETKDVLVSAWGLNRKGERVDYALADFGYTYRHSEAPADIIW 182

Query: 191 THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRG 250
              V RG P+    + A I  +   RET QPI+EKTGGSTFKNP GHS+W+L++++G RG
Sbjct: 183 VEAVYRGTPDEPAAVQARIDEITSRRETTQPIREKTGGSTFKNPPGHSSWKLVDEAGWRG 242

Query: 251 L----EFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
                  GGA  S+LH NFMIN   AT  D+E LGE VR  V  ++G+ L+WEIKR+G
Sbjct: 243 KLHAETGGGAMFSDLHSNFMINPGEATAADIEGLGEAVRADVLAKTGVQLDWEIKRIG 300


>gi|15892255|ref|NP_359969.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia conorii
           str. Malish 7]
 gi|15619393|gb|AAL02870.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia conorii
           str. Malish 7]
          Length = 378

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 138/290 (47%), Positives = 188/290 (64%), Gaps = 6/290 (2%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           ++G++++++ LK +TWF+ GGNAE+ F+P D  DLK FL      +PI   G GSNI++R
Sbjct: 90  VKGEYKKDYNLKHLTWFKVGGNAEIFFKPLDSEDLKSFLIQNKQKLPIKTFGAGSNIIIR 149

Query: 77  DAGIRGVVLRLSNAGFSNIE-VRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           D GI GVV++L    FSNIE V NH  +IVG+ C   +LA     + I GF F  GIPG+
Sbjct: 150 DGGIEGVVIKLGQ-NFSNIEFVDNH--LIVGSSCLNYNLAKFCQANAISGFEFLVGIPGT 206

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           IGG   MNAGA   E    VV++  ID  GN      E++ ++YRS+ + K+LII   V 
Sbjct: 207 IGGGVAMNAGAYGSEFKDIVVQIEAIDFAGNFLTFTNEEIGFKYRSNNLPKNLIILKAVF 266

Query: 196 R-GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
           +    +S+NI+   +  + + R + QPIKE+TGGSTF NP G  +W+LI+K+G RG   G
Sbjct: 267 KINKGDSENIL-LRMNEIKNARSSTQPIKERTGGSTFANPEGRKSWELIDKAGLRGYRIG 325

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           GA +SE HCNFMIN  +AT  DLE LG+ VR+KV   SG+ LEWEIKR+G
Sbjct: 326 GASMSEFHCNFMINNGDATAKDLEDLGDFVRQKVCEDSGVKLEWEIKRIG 375


>gi|51473446|ref|YP_067203.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia typhi
           str. Wilmington]
 gi|81390202|sp|Q68XC1|MURB_RICTY RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|51459758|gb|AAU03721.1| UDP-GlcNAc-enoylpyruvate reductase [Rickettsia typhi str.
           Wilmington]
          Length = 295

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 135/292 (46%), Positives = 188/292 (64%), Gaps = 6/292 (2%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           ++G++++++ LK +TWF+ GGNAE+ F+P D  DLK FL      +PIT  G GSNI++R
Sbjct: 7   IKGEYKKDYNLKHLTWFKVGGNAEIFFKPFDSADLKSFLIQNNKKLPITTFGSGSNIIIR 66

Query: 77  DAGIRGVVLRLSNAGFSNIE-VRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           D GI GVV++L    F+NIE + NH  +IVG+ C   +LA     + I GF F  GIPG+
Sbjct: 67  DGGIEGVVIKLG-KNFNNIEFLDNH--LIVGSSCLNYNLAKFCQANAISGFEFLVGIPGT 123

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           IGG   MNAGA        +V++  +D  GN      +++ ++YR + + KDLI+   + 
Sbjct: 124 IGGGVVMNAGAYGSAFQDIIVQIEALDFLGNFLTFTNKEIGFKYRGNNLPKDLILLKAIF 183

Query: 196 RGFP-ESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
           +    +SQNI+   +  +   R + QPIKE+TGGSTFKNP G  +W+LI+K+G RG   G
Sbjct: 184 KANKGDSQNIL-LKMNKINTTRSSTQPIKERTGGSTFKNPVGCKSWELIDKAGLRGYRIG 242

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           GA +SELHCNFMIN  NAT  DLE LG  VR+KVF  SG+ L WEIKR+G +
Sbjct: 243 GASMSELHCNFMINNGNATAKDLEDLGNFVRQKVFEDSGVELNWEIKRIGKY 294


>gi|94498829|ref|ZP_01305373.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sphingomonas sp.
           SKA58]
 gi|94421717|gb|EAT06774.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sphingomonas sp.
           SKA58]
          Length = 287

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 124/278 (44%), Positives = 175/278 (62%), Gaps = 1/278 (0%)

Query: 27  LKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDAGIRGVVLR 86
           L  + WF+TGG A+ +F+PQD  DL  FL  L  D+P+  +GLGSN++VRD G+ GVV+R
Sbjct: 8   LAPLVWFKTGGPAQWLFEPQDADDLSDFLAQLDPDMPVMALGLGSNLIVRDGGVPGVVVR 67

Query: 87  LSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGA 146
           L    F+ +E ++   ++ GA  SG  ++++A   GI G  F   IPG++GG   MN GA
Sbjct: 68  LGKP-FAKVERQDETTLVCGAGASGILVSSTARDAGIAGLEFLRSIPGTVGGFVRMNGGA 126

Query: 147 NNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPESQNIIS 206
              ET+  ++E   + R G Q  +    L Y YR S +T   I+     RG P     I 
Sbjct: 127 YGRETADILLECELVLRSGEQVTLLNRDLAYSYRHSNLTDGAIVVSATFRGHPGESAAIQ 186

Query: 207 AAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFM 266
           A +  +   RE  QP++ KTGGSTFKNP GH AWQL++++GCRGL+ GGA++SE H NF+
Sbjct: 187 AEMDRIAAAREESQPLRSKTGGSTFKNPDGHKAWQLVDEAGCRGLQIGGAQVSEKHTNFL 246

Query: 267 INADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           +N   AT  D+E LGE+VR++V  +SGI LEWEI+R+G
Sbjct: 247 LNTGGATSTDIEALGEEVRRRVREKSGIELEWEIQRVG 284


>gi|20141623|sp|Q9ZDS7|MURB_RICPR RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
          Length = 295

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 136/292 (46%), Positives = 187/292 (64%), Gaps = 6/292 (2%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           ++G++++++ LK +TWF+ GGNAE+ F+P D  DLK FL      +PIT  G GSNI++R
Sbjct: 7   IKGEYKKDYNLKHLTWFKVGGNAEIFFKPFDFADLKSFLIQNKQKLPITTFGSGSNIIIR 66

Query: 77  DAGIRGVVLRLSNAGFSNIE-VRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           D GI GVV++L    F+ IE + NH  +IVG+ C   +LA     + I GF F  GIPG+
Sbjct: 67  DGGIEGVVIKLG-QNFNKIEFLDNH--LIVGSSCLNYNLARFCQANAISGFEFLVGIPGT 123

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           IGG   MNAGA        +V+V  +D  GN      +++ ++YR + + KDLI+   V 
Sbjct: 124 IGGGVIMNAGAYGSAFQDIIVQVEALDFSGNFLTFTNKEIGFKYRGNNLPKDLILLKAVF 183

Query: 196 R-GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
           +    +SQNI+   +  + + R + QPIKE+TGGSTF NP G  +W+LI+K+G RG   G
Sbjct: 184 KVNKGDSQNIL-LKMNKINNTRSSTQPIKERTGGSTFINPEGRKSWELIDKAGLRGYRIG 242

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           GA ISELHCNFMIN  NAT  DLE LG  VR+KVF  SG+ L WEIKR+G +
Sbjct: 243 GASISELHCNFMINNGNATAKDLEDLGNFVRQKVFEDSGVELNWEIKRIGKY 294


>gi|15604118|ref|NP_220633.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia
           prowazekii str. Madrid E]
 gi|3860810|emb|CAA14710.1| UDP-N-ACETYLENOLPYRUVOYLGLUCOSAMINE REDUCTASE (murB) [Rickettsia
           prowazekii]
 gi|292571844|gb|ADE29759.1| UDP-N-acetylenol pyruvoyl glucosamine reductase [Rickettsia
           prowazekii Rp22]
          Length = 310

 Score =  263 bits (671), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 136/292 (46%), Positives = 187/292 (64%), Gaps = 6/292 (2%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           ++G++++++ LK +TWF+ GGNAE+ F+P D  DLK FL      +PIT  G GSNI++R
Sbjct: 22  IKGEYKKDYNLKHLTWFKVGGNAEIFFKPFDFADLKSFLIQNKQKLPITTFGSGSNIIIR 81

Query: 77  DAGIRGVVLRLSNAGFSNIE-VRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           D GI GVV++L    F+ IE + NH  +IVG+ C   +LA     + I GF F  GIPG+
Sbjct: 82  DGGIEGVVIKLG-QNFNKIEFLDNH--LIVGSSCLNYNLARFCQANAISGFEFLVGIPGT 138

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           IGG   MNAGA        +V+V  +D  GN      +++ ++YR + + KDLI+   V 
Sbjct: 139 IGGGVIMNAGAYGSAFQDIIVQVEALDFSGNFLTFTNKEIGFKYRGNNLPKDLILLKAVF 198

Query: 196 R-GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
           +    +SQNI+   +  + + R + QPIKE+TGGSTF NP G  +W+LI+K+G RG   G
Sbjct: 199 KVNKGDSQNIL-LKMNKINNTRSSTQPIKERTGGSTFINPEGRKSWELIDKAGLRGYRIG 257

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           GA ISELHCNFMIN  NAT  DLE LG  VR+KVF  SG+ L WEIKR+G +
Sbjct: 258 GASISELHCNFMINNGNATAKDLEDLGNFVRQKVFEDSGVELNWEIKRIGKY 309


>gi|157828211|ref|YP_001494453.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165932914|ref|YP_001649703.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia
           rickettsii str. Iowa]
 gi|166222850|sp|A8GRC0|MURB_RICRS RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|189028926|sp|B0BWS1|MURB_RICRO RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|157800692|gb|ABV75945.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165908001|gb|ABY72297.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia
           rickettsii str. Iowa]
          Length = 295

 Score =  263 bits (671), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 137/290 (47%), Positives = 189/290 (65%), Gaps = 6/290 (2%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           ++G++++++ LK +TWF+ GGNAE+ F+P D  DLK FL      +PI   G GSNI++R
Sbjct: 7   VKGEYKKDYNLKHLTWFKVGGNAEIFFKPLDSEDLKSFLIQNKQKLPIKTFGAGSNIIIR 66

Query: 77  DAGIRGVVLRLSNAGFSNIE-VRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           D GI GVV++L    FSNIE + NH  +IVG+ C   +LA     + I GF F  GIPG+
Sbjct: 67  DGGIEGVVIKLGQ-NFSNIEFIDNH--LIVGSSCLNYNLAKFCQANAISGFEFLVGIPGT 123

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           IGG   MNAGA   E    VV++  ID  GN      E++ ++YRS+ + K+LII  V+ 
Sbjct: 124 IGGGVAMNAGAYGSEFKDIVVQIEAIDFAGNFLTFTNEEIGFKYRSNNLPKNLIILKVIF 183

Query: 196 R-GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
           +    +S+NI+   +  + + R + QPIKE+TGGSTF NP G  +W+LI+K+G RG   G
Sbjct: 184 KINKGDSENIL-LRMNEINNARSSTQPIKERTGGSTFANPEGCKSWELIDKAGLRGYRIG 242

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           GA +SELHCNFMIN  +AT  DLE LG  V++KV   SG+ LEWEIKR+G
Sbjct: 243 GASMSELHCNFMINNGDATAKDLEDLGNFVQQKVCEDSGVKLEWEIKRIG 292


>gi|218458570|ref|ZP_03498661.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobium etli Kim
           5]
          Length = 209

 Score =  262 bits (670), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 151/194 (77%)

Query: 114 LANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPRE 173
           +A  A+ +GIGGFHF+YGIPG+IGGAA MNAGAN  ET + ++EV+ +DRKGN+HV+   
Sbjct: 2   VAAMAMDNGIGGFHFYYGIPGAIGGAARMNAGANGVETRERLIEVNAVDRKGNKHVLSNA 61

Query: 174 QLKYQYRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKN 233
           ++ Y YR S    DLI T V+  G+PE +  I A +  V +HRETVQP++EKTGGSTFKN
Sbjct: 62  EMGYSYRHSAAPADLIFTSVLFEGYPEDRAQIRAEMDAVRNHRETVQPVREKTGGSTFKN 121

Query: 234 PTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSG 293
           P GHSAW+LI+++GCRGL  GGA++S LHCNFMIN   ATGYDLEYLGEQVR++VF + G
Sbjct: 122 PPGHSAWKLIDEAGCRGLVIGGAQMSSLHCNFMINMGQATGYDLEYLGEQVRREVFEKDG 181

Query: 294 ILLEWEIKRLGDFF 307
           I LEWEIKRLG F 
Sbjct: 182 IKLEWEIKRLGVFM 195


>gi|182677687|ref|YP_001831833.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|254764133|sp|B2IGG2|MURB_BEII9 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|182633570|gb|ACB94344.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 310

 Score =  261 bits (667), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 131/295 (44%), Positives = 182/295 (61%), Gaps = 3/295 (1%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           LR+   +LRG+ Q N PL   TWF+TGG A+ ++   D+ DL YFL  L  DI I ++GL
Sbjct: 9   LRDAMPELRGELQTNVPLAPWTWFKTGGPAQCVYVAPDVEDLAYFLGNLDPDISIFVLGL 68

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
           GSNILVRD GI GVV+    + F  I +     +  GA  +   LA++A   G+GGF F 
Sbjct: 69  GSNILVRDGGIEGVVISFGPS-FHKIVIEGDT-ISAGAAVADVKLASAAAMAGLGGFAFL 126

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLI 189
            GIPG+IGGA  MNAGA     +  +V   G+DR+G  H    E++ + YR   + + +I
Sbjct: 127 RGIPGTIGGALRMNAGAFGGTIADILVSCEGLDRRGALHHFTPEEMGFSYRHCAV-EGII 185

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
            T  +  G+PE+   I   +  +   R   QP+  +TGGSTFKNP G  AW+LI+++GCR
Sbjct: 186 FTQGLFAGWPENPEKIREDMGKIAQERAKTQPVNTRTGGSTFKNPNGAKAWELIDRAGCR 245

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           GL  G A++SELHCNF++N   A+  D+E LGE VR+KV  ++G+ LEWEI R+G
Sbjct: 246 GLTLGDAQVSELHCNFLVNRGKASAADIENLGEMVRQKVLAETGVELEWEILRVG 300


>gi|254292776|ref|YP_003058799.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Hirschia baltica
           ATCC 49814]
 gi|254041307|gb|ACT58102.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Hirschia baltica
           ATCC 49814]
          Length = 305

 Score =  259 bits (662), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 134/295 (45%), Positives = 175/295 (59%), Gaps = 8/295 (2%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
           ++RGK   +  LK  TWFR GG A+V++ P D  DL  FL  LP DIPIT++G  SN +V
Sbjct: 10  EVRGKLIADAELKPFTWFRVGGKADVLYLPADPDDLADFLKALPLDIPITVLGAASNTIV 69

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD GI GVV+RL+ A F  I V+ + E++ GA      ++  A   G+ G  FF G+PG+
Sbjct: 70  RDGGIEGVVIRLTPA-FGKIRVQGN-ELVAGAAALDSKVSQKAAMFGLSGLEFFSGVPGT 127

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           IGGA  MNAG    ET+  +VE   + RKG+   +      Y YR SE  +DLI    + 
Sbjct: 128 IGGALRMNAGCYEQETADVLVEAIALTRKGDWVTLVNRDFGYSYRHSEAPEDLIFVEALF 187

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTG------HSAWQLIEKSGCR 249
           RG      I+   I  +   RE  QPI+EKTGGSTF NP           W+LI+++G R
Sbjct: 188 RGNIIEPAIVKERIEALKKRREEAQPIREKTGGSTFANPDPPGTPDQRKCWKLIDEAGMR 247

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           G   GGA++SE HCNFMIN  +AT  D+E LGE+VR KV   SG+ L WEIKR+G
Sbjct: 248 GARVGGAQVSEKHCNFMINTSDATASDIEELGEKVRAKVKENSGVDLRWEIKRIG 302


>gi|157825460|ref|YP_001493180.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia akari
           str. Hartford]
 gi|166222847|sp|A8GMP7|MURB_RICAH RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|157799418|gb|ABV74672.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia akari
           str. Hartford]
          Length = 295

 Score =  258 bits (659), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 135/292 (46%), Positives = 185/292 (63%), Gaps = 6/292 (2%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           ++G++Q+++ LK +TWF+ GG+AE+ F+P D  DL  FL      +PIT  G GSNI++R
Sbjct: 7   VKGEYQKDYNLKHLTWFKVGGDAEIFFKPLDSEDLASFLIQNRQKLPITTFGAGSNIIIR 66

Query: 77  DAGIRGVVLRLSNAGFSNIE-VRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           D GI GVV++L    FSNIE + NH  +IVG+ C   +LA     + I GF F  GIPG+
Sbjct: 67  DGGIEGVVIKLGQ-NFSNIEFIDNH--LIVGSSCLNYNLAKFCQANDISGFEFLVGIPGT 123

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           IGG   MNAGA   E    +V +  ID  GN       +  ++YR + + KDLII   V 
Sbjct: 124 IGGGVAMNAGAYGSEFKDIIVRIEAIDFAGNFRTFTNAESGFKYRGNNLPKDLIILKAVF 183

Query: 196 R-GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
           +    +S+NI+   +  + + R   QPIKE+TGGSTF NP G  +W+LI+K+G RG   G
Sbjct: 184 KVNKGDSENIL-LRMNEINNTRSLTQPIKERTGGSTFANPEGLKSWELIDKAGLRGYRIG 242

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           GA +SELHCNFMIN  +AT  DLE LG+ VR+KVF  SG+ L+WEIK +G +
Sbjct: 243 GASMSELHCNFMINNGDATSKDLEDLGDFVRQKVFEDSGVELKWEIKIIGKY 294


>gi|87199157|ref|YP_496414.1| UDP-N-acetylmuramate dehydrogenase [Novosphingobium aromaticivorans
           DSM 12444]
 gi|123490035|sp|Q2G993|MURB_NOVAD RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|87134838|gb|ABD25580.1| UDP-N-acetylmuramate dehydrogenase [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 297

 Score =  258 bits (659), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 122/289 (42%), Positives = 179/289 (61%), Gaps = 1/289 (0%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
            +RGK   + PL  + WF++GG A+ +F+P+D+ DL+ FL  L  ++P+  +GLGSN++V
Sbjct: 8   SVRGKLTPDAPLAPLVWFKSGGTADWLFEPRDVADLQDFLAGLAPEVPVMALGLGSNLIV 67

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD G+ GVV+RL  A F+ +   +   +  G   SG  ++++A  +GI G  F   IPG+
Sbjct: 68  RDGGVPGVVIRLGKA-FAKVAKVDEVTLDCGGGASGILVSSTARDNGIAGLEFLRSIPGT 126

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           +GG   MN GA   E    +V+   + R G    +P  +L Y YR S +T   I+     
Sbjct: 127 VGGFVRMNGGAYGREVKDVLVDCDVVIRSGEIVTLPLSELGYTYRHSNLTDGSIVVAARF 186

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           RG P +   I A +  +   RE  QP++ KTGGSTFKNP G  AW+L++K+GCRGL+ GG
Sbjct: 187 RGHPGNPEAIQAEMDRISAAREASQPLRSKTGGSTFKNPDGGKAWELVDKAGCRGLQIGG 246

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           A++SE H NF+IN   AT  ++E LGE+VR++V   SG+ LEWEIKR+G
Sbjct: 247 AQVSEKHTNFLINTGTATSAEIEGLGEEVRRRVKASSGVDLEWEIKRIG 295


>gi|103487363|ref|YP_616924.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sphingopyxis
           alaskensis RB2256]
 gi|123253132|sp|Q1GRY1|MURB_SPHAL RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|98977440|gb|ABF53591.1| UDP-N-acetylmuramate dehydrogenase [Sphingopyxis alaskensis RB2256]
          Length = 299

 Score =  258 bits (659), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 122/288 (42%), Positives = 177/288 (61%), Gaps = 1/288 (0%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RGK     PL  + WF++GG A+ +F+P+D+ DL  FL  L   IP+  +GLGSN++VR
Sbjct: 10  VRGKLTPQAPLAPLVWFKSGGAADWLFEPKDVDDLADFLRDLDPAIPVMALGLGSNLIVR 69

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G  GVV+RL  A F+ +E  +   +  G   SG  ++++A   GI G  F   IPG++
Sbjct: 70  DGGFPGVVVRLGKA-FAKVEPIDATTLRCGGGASGILVSSTARDAGIAGMEFLRSIPGTV 128

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GG   MN GA   E    +V+   + R G +  +    L Y YR SE+ +  ++     R
Sbjct: 129 GGFVRMNGGAYGGEVKDILVDCDVVLRSGERKTLALADLGYTYRHSELPEGAVVVGATFR 188

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G P +   I A +  +   RE  QP++ +TGGSTFKNP GH AWQL++ +GCRGL  GGA
Sbjct: 189 GRPGASAAIQAEMDRISASREASQPLRSRTGGSTFKNPAGHKAWQLVDAAGCRGLMVGGA 248

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           ++SE H NF+IN  +AT  D+E LGE+VR++V ++SGI L+WEI+R+G
Sbjct: 249 QVSEKHTNFLINTGDATSADIEALGEEVRRRVKDKSGIELQWEIQRVG 296


>gi|294012775|ref|YP_003546235.1| UDP-N-acetylmuramate dehydrogenase [Sphingobium japonicum UT26S]
 gi|292676105|dbj|BAI97623.1| UDP-N-acetylmuramate dehydrogenase [Sphingobium japonicum UT26S]
          Length = 315

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 123/288 (42%), Positives = 178/288 (61%), Gaps = 1/288 (0%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RG  + + PL  + WF+ GG A+ +F+P+D  DL  FL  L   IP+  +GLGSN++VR
Sbjct: 11  VRGSLKADAPLGPLVWFKAGGVAQWLFEPKDADDLSDFLARLDPAIPVMALGLGSNLIVR 70

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ GVV+RL    F+ +E  +   +  G   SG  ++++A   GI G  F   IPG++
Sbjct: 71  DGGVPGVVVRLGKP-FARVEQVDATSLRCGGGASGILVSSTARDAGIAGLEFLRSIPGTV 129

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GG   MN GA   ET   ++E   + R G +  +P + L Y YR S + +  ++   V R
Sbjct: 130 GGFVRMNGGAYGRETCDILLECGVVLRSGERVTMPLDALGYTYRHSILPEGAVVVSAVFR 189

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G P     I A +  +   RE  QP++ KTGGSTFKNP GH AWQL++++GCRGL  GGA
Sbjct: 190 GVPGEPAAIQAEMDRIAAAREESQPLRSKTGGSTFKNPDGHKAWQLVDEAGCRGLRLGGA 249

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           ++SE H NF++N  +AT  D+E LGE+VR++V  +SGI LEWEI+R+G
Sbjct: 250 QVSEKHTNFLLNLGDATSADIEALGEEVRRRVKAKSGIDLEWEIQRVG 297


>gi|329849872|ref|ZP_08264718.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Asticcacaulis
           biprosthecum C19]
 gi|328841783|gb|EGF91353.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Asticcacaulis
           biprosthecum C19]
          Length = 299

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 128/294 (43%), Positives = 169/294 (57%), Gaps = 1/294 (0%)

Query: 11  RERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLG 70
           R+    +RGK   +  L   TWFR GG AEV+F P D  DL  FL  L   +P+  +G+G
Sbjct: 4   RDNLPTVRGKIARDTALAPFTWFRVGGPAEVLFIPADPQDLSDFLRALDPAVPVIYLGVG 63

Query: 71  SNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFY 130
           SN+++RD G+ GVV+RL+   F+ I V+    +  G       +A +A + G+ G  F+ 
Sbjct: 64  SNVIIRDGGVDGVVVRLAGKAFAEISVQGEL-ITAGPGALDSMVARTAAKAGLAGLEFYA 122

Query: 131 GIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLII 190
           GIPG+IGGA  MNAG    ET   +V   G DR G +         + YR ++I  D++ 
Sbjct: 123 GIPGTIGGALTMNAGCYGRETKDVLVSAWGYDRTGARREFQNADFGFTYRHTQIPGDIVW 182

Query: 191 THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRG 250
                RG P+    + A I  +   RE  QPI+EKTGGSTFKNP G SAWQ ++++G RG
Sbjct: 183 MQATFRGTPDDPVAVQARIDEITSRRERTQPIREKTGGSTFKNPQGRSAWQCVDEAGWRG 242

Query: 251 LEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
              GGAK SELH NFMIN   AT  DLE LGE VR  V  + G+ L WEIKR+G
Sbjct: 243 KLHGGAKFSELHANFMINTGEATAADLEGLGEAVRADVLTKLGVELNWEIKRIG 296


>gi|149186200|ref|ZP_01864514.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Erythrobacter sp.
           SD-21]
 gi|148830231|gb|EDL48668.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Erythrobacter sp.
           SD-21]
          Length = 323

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 117/289 (40%), Positives = 181/289 (62%), Gaps = 2/289 (0%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           L+GK   + PL ++ WF++GG A+ +F+P+D+ DLK FL  L  D+P+  +GLGSN++VR
Sbjct: 34  LKGKLTPDAPLAKLVWFKSGGKADWLFEPEDLADLKEFLRRLDGDLPVMALGLGSNMIVR 93

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNH-CEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           D G+ GVV++L    F+++ + +  C +  G    G  +A++A   G+ G  F  GIPG+
Sbjct: 94  DGGVPGVVIKLGKP-FADVAIDDESCVVDCGGGAHGILVASAARDCGVAGLEFMRGIPGT 152

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           +GG   MN GA   E S  +++   +   G  H +P   L+Y YR S +    ++     
Sbjct: 153 VGGFVRMNGGAYGREVSDVLIDCEVVMPDGQFHTLPASDLQYSYRHSALPAGAVVIRARF 212

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           +G P    +I A +  +   RE  QP++ KTGGSTFKNP G  AW+L++ +GCRGL  GG
Sbjct: 213 KGEPGDPEVIGAKMDEIAGARENSQPLRTKTGGSTFKNPPGRKAWELVDAAGCRGLTMGG 272

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           A++SE H NF++N  +AT  D+E LGE+V+++V+  SG+ LEWEI+R+G
Sbjct: 273 AQVSEKHTNFLLNTGDATSADIEGLGEEVKRRVYEHSGVELEWEIQRVG 321


>gi|288958925|ref|YP_003449266.1| UDP-N-acetylmuramate dehydrogenase [Azospirillum sp. B510]
 gi|288911233|dbj|BAI72722.1| UDP-N-acetylmuramate dehydrogenase [Azospirillum sp. B510]
          Length = 324

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 131/303 (43%), Positives = 179/303 (59%), Gaps = 9/303 (2%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           L +R   +RG+   +  L  +TWFR GG AEVMF+P D  DL  FL  LP+++P+T++G+
Sbjct: 14  LIQRMPAVRGRLTADAALAPVTWFRVGGPAEVMFRPADADDLADFLAALPAEVPVTVIGV 73

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL---RHGIGGF 126
            SN+LVRD G+ GV +RL   GF++I      + +  A  +     N A+     GI G 
Sbjct: 74  ASNLLVRDGGVPGVTIRLGR-GFTDITAAGTGDGMTLAAGAAALDLNVAMVARDAGIAGL 132

Query: 127 HFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK 186
            F  GIPG+IGGA  MN GA   E +  +V    + R G +       + + YR S   +
Sbjct: 133 EFLSGIPGTIGGALRMNGGAYGRELADVLVGASAVARDGRRLEFNHAAMGFTYRHSAAPE 192

Query: 187 DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPT-----GHSAWQ 241
           D I T  VLRG P +   I+  +A +   R   QP++ +TGGSTFKNP      G  AW+
Sbjct: 193 DCIFTGAVLRGEPGNPLEIARRMAEISDKRADSQPVRSRTGGSTFKNPAPEISGGLKAWE 252

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           LI+K+GCRGL  G A++SE HCNF+IN   AT   LE LGE+VR++VF  SG+ LEWEIK
Sbjct: 253 LIDKAGCRGLSIGDAQVSEKHCNFLINNGAATAAQLEALGEEVRRRVFEASGVTLEWEIK 312

Query: 302 RLG 304
           R+G
Sbjct: 313 RIG 315


>gi|217979593|ref|YP_002363740.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylocella
           silvestris BL2]
 gi|217504969|gb|ACK52378.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylocella
           silvestris BL2]
          Length = 315

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 132/305 (43%), Positives = 174/305 (57%), Gaps = 2/305 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  ++  LR     LRG    N PL  +T+FRTGG A+++F+P D  DL YFL  L  
Sbjct: 1   MAFPDLTPELRRAMPDLRGAISPNAPLSGLTFFRTGGPAQILFEPADEADLAYFLQRLDP 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           ++ +  +G GSN+LVRD GI+GVV+RL    F  I +     +  GA      LA  A R
Sbjct: 61  NLNVMTLGAGSNLLVRDGGIKGVVIRLGRP-FEEIAIEG-LRVTAGAAARDMKLALVAGR 118

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
            G+ G  F  G+PGSIGGA  MNAGA   E    ++    +DR G         + + YR
Sbjct: 119 AGVAGLSFLRGVPGSIGGALRMNAGAYGSEIKDRLICCRVVDRAGKIIEFANADMGFSYR 178

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
            S I  D+I T     G P     + A +A +   R   QP+  +TGGSTFKNP GH AW
Sbjct: 179 HSAIGPDVIFTGATFEGLPGEPEKLMAEMAEITAERGKTQPVNSRTGGSTFKNPPGHKAW 238

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
            LI+ +GCRGL  G A+IS+LHCNF+IN  +A   DLE LGE+VR +V   SG+ LEWEI
Sbjct: 239 ALIDAAGCRGLTIGDAQISQLHCNFLINQGSAAAADLEALGEEVRTRVKATSGVSLEWEI 298

Query: 301 KRLGD 305
            R+G+
Sbjct: 299 LRVGE 303


>gi|260752696|ref|YP_003225589.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
 gi|258552059|gb|ACV75005.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
          Length = 310

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 120/293 (40%), Positives = 181/293 (61%), Gaps = 1/293 (0%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
            +RG+ + N PL  +TWFR GGNAE +  P D  DL  FL  +   +P+ ++G+GSN+++
Sbjct: 15  SIRGEIEANAPLAPLTWFRVGGNAEWLVSPYDTEDLSDFLKKIDPSMPVRVLGIGSNVII 74

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD G+ GV++RL    FS ++      +  G    G  ++  A    +    F  GIPGS
Sbjct: 75  RDGGVSGVIIRLPRR-FSWVKREEGNRLRCGGSTLGMMISKVAAAESLTNLEFMRGIPGS 133

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           IGG   MNAGA   + S+ +++V  + R G+  + P E+L + YR SE+ +D I+T  + 
Sbjct: 134 IGGMIRMNAGAYGGDISKILIQVTLVRRNGDIEIWPVEKLNFAYRYSELPEDAIVTEALF 193

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           +G P  ++ I A +  +   RE  QP++ +TGGSTFKNP G+ AW+LI+++GCRGL+ G 
Sbjct: 194 QGQPGDKDKIEAQMNKIIAEREASQPVRSRTGGSTFKNPEGYKAWELIDEAGCRGLKIGD 253

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFD 308
           A++S  H NF++N  +AT  D+E LGE+VR +V  + GI LEWEIKR+G   D
Sbjct: 254 AEVSTKHANFLLNLGDATAADIENLGEEVRARVKAKFGITLEWEIKRIGHKLD 306


>gi|56551729|ref|YP_162568.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|29336989|sp|Q9RNM8|MURB_ZYMMO RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|5834368|gb|AAD53934.1|AF179611_18 UDP-N-acetylenolpyruvoylglucosamine reductase [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|56543303|gb|AAV89457.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Zymomonas mobilis
           subsp. mobilis ZM4]
          Length = 310

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 120/293 (40%), Positives = 181/293 (61%), Gaps = 1/293 (0%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
            +RG+ + N PL  +TWFR GGNAE +  P D  DL  FL  +   +P+ ++G+GSN+++
Sbjct: 15  SIRGEIEANAPLAPLTWFRVGGNAEWLVSPYDTEDLSDFLKKIDPSMPVRVLGIGSNVII 74

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD G+ GV++RL    FS ++      +  G    G  ++  A    +    F  GIPGS
Sbjct: 75  RDGGVSGVIIRLPRR-FSWVKREEGNRLRCGGSTLGMMISKVAAAESLTNLEFMRGIPGS 133

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           IGG   MNAGA   + S+ +++V  + R G+  + P E+L + YR SE+ +D I+T  + 
Sbjct: 134 IGGMIRMNAGAYGGDISKILIQVTLVRRNGDIEIWPVEKLNFAYRYSELPEDAIVTEALF 193

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           +G P  ++ I A +  +   RE  QP++ +TGGSTFKNP G+ AW+LI+++GCRGL+ G 
Sbjct: 194 QGQPGDKDKIEAQMNKIIAEREASQPVRSRTGGSTFKNPEGYKAWELIDEAGCRGLKIGD 253

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFD 308
           A++S  H NF++N  +AT  D+E LGE+VR +V  + GI LEWEIKR+G   D
Sbjct: 254 AEVSTKHANFLLNLGDATAADIENLGEEVRARVKAKFGITLEWEIKRIGHKLD 306


>gi|241762279|ref|ZP_04760360.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|241373182|gb|EER62812.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
          Length = 310

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 120/293 (40%), Positives = 181/293 (61%), Gaps = 1/293 (0%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
            +RG+ + N PL  +TWFR GGNAE +  P D  DL  FL  +   +P+ ++G+GSN+++
Sbjct: 15  SIRGEIEANAPLAPLTWFRVGGNAEWLVSPYDTEDLSDFLKKIDQSMPVRVLGIGSNVII 74

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD G+ GV++RL    FS ++      +  G    G  ++  A    +    F  GIPGS
Sbjct: 75  RDGGVSGVIIRLPRR-FSWVKREEGNRLRCGGSTLGMMISKVAAAESLTNLEFMRGIPGS 133

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           IGG   MNAGA   + S+ +++V  + R G+  + P E+L + YR SE+ +D I+T  + 
Sbjct: 134 IGGMIRMNAGAYGGDISKILIQVTLVRRNGDIEIWPVEKLNFAYRYSELPEDAIVTEALF 193

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           +G P  ++ I A +  +   RE  QP++ +TGGSTFKNP G+ AW+LI+++GCRGL+ G 
Sbjct: 194 QGQPGDKDKIEAQMNKIIAEREASQPVRSRTGGSTFKNPEGYKAWELIDEAGCRGLKIGD 253

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFD 308
           A++S  H NF++N  +AT  D+E LGE+VR +V  + GI LEWEIKR+G   D
Sbjct: 254 AEVSTKHANFLLNLGDATAADIENLGEEVRARVKAKFGITLEWEIKRIGHKLD 306


>gi|148556845|ref|YP_001264427.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sphingomonas
           wittichii RW1]
 gi|172048241|sp|A5VDC3|MURB_SPHWW RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|148502035|gb|ABQ70289.1| UDP-N-acetylmuramate dehydrogenase [Sphingomonas wittichii RW1]
          Length = 306

 Score =  255 bits (652), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 120/288 (41%), Positives = 176/288 (61%), Gaps = 1/288 (0%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RG+     PL  + WF++GG AE +F+P D+ DL  FL  L   +P+  +GLGSN++VR
Sbjct: 17  VRGRLTAGAPLAPLVWFKSGGAAEWLFEPADVDDLSDFLAALDPAVPVMGLGLGSNLIVR 76

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ GVV+RL    F+ +E  +   +  G   SG  ++++A   GIGG  F   IPG++
Sbjct: 77  DGGVPGVVVRLGKP-FARVERLDATTLRCGGGASGILVSSTARDAGIGGVEFLRSIPGTV 135

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GG   MN GA   E    +VE   + R G + V+   +L Y YR S + +  I+     R
Sbjct: 136 GGFVRMNGGAYGREVKDVLVEGEVVLRSGERRVLSLAELGYTYRHSALPEGAIVVAATFR 195

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G  E+  ++ A +  +   RE  QP++ +TGGSTFKNP GH AWQL++ +GCRGL  G A
Sbjct: 196 GHAEAPAVVQAEMDRIAAEREASQPLRSRTGGSTFKNPQGHKAWQLVDAAGCRGLTRGDA 255

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           ++SE HCNF++N   A+  D+E LGE+VR++V   SG+ LEWEI+R+G
Sbjct: 256 QVSEKHCNFLLNLGTASSADIEGLGEEVRERVKANSGVTLEWEIQRVG 303


>gi|85707768|ref|ZP_01038834.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Erythrobacter sp.
           NAP1]
 gi|85689302|gb|EAQ29305.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Erythrobacter sp.
           NAP1]
          Length = 324

 Score =  255 bits (652), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 121/288 (42%), Positives = 175/288 (60%), Gaps = 1/288 (0%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RG+  +N PL +  WF++GGNA+ +F+P D+ DL+ FL  L   +P+  +G+GSN+++R
Sbjct: 36  IRGELTQNAPLAKHVWFQSGGNADWLFEPADLEDLRTFLDRLDGRMPVMALGVGSNMIIR 95

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ GVV++L    F +IE+     +  GA      +A  A + GI G  F+ GIPGS+
Sbjct: 96  DGGVPGVVIKLGKP-FMDIEITGDTTLKAGAAVPVSMVARRAAKAGIDGLSFYVGIPGSV 154

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GG   MN G    ET Q + +   +   G    +    L+Y YR S +    ++  V   
Sbjct: 155 GGVTRMNGGCYGRETCQVLTDCDVLMPNGELVTLSNADLQYSYRHSALPDGAVVVEVRFE 214

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           GFP   + I   +  +   R+  QPI  +TGGSTFKNP GHS+W+LI+ +G RG + GGA
Sbjct: 215 GFPGDPDTIKEEMDRISSQRKDSQPIGSRTGGSTFKNPDGHSSWKLIDDAGLRGFKHGGA 274

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           ++SE HCNF+IN  +AT  D+E LGE VR+KV+  SGI LEWEIKR+G
Sbjct: 275 QVSEKHCNFLINTGDATSSDIEGLGELVREKVYANSGIQLEWEIKRVG 322


>gi|16126784|ref|NP_421348.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Caulobacter
           crescentus CB15]
 gi|221235564|ref|YP_002518001.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Caulobacter
           crescentus NA1000]
 gi|29336914|sp|Q9A5A7|MURB_CAUCR RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|254764141|sp|B8H085|MURB_CAUCN RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|13424108|gb|AAK24516.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Caulobacter
           crescentus CB15]
 gi|220964737|gb|ACL96093.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Caulobacter
           crescentus NA1000]
          Length = 301

 Score =  255 bits (652), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 129/289 (44%), Positives = 171/289 (59%), Gaps = 3/289 (1%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRD 77
           RGK   +  L   TWFR GG A+V+F P D  DL  FL  L   +P+  +G+GSN+LVRD
Sbjct: 11  RGKLLIDEALAPFTWFRVGGPADVVFLPADEQDLSDFLKGLDPSVPVMAIGVGSNLLVRD 70

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G+ GVV+RL   GF+ +E      +  G+      LA  A   GI G  F+ G+PG+IG
Sbjct: 71  GGVDGVVIRLGK-GFNGVEALGDNRIKAGSAVPDAILARKAAEAGIAGLEFYVGVPGTIG 129

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT--KDLIITHVVL 195
           GA  MNAG    ET   V  V  ++R G    +  E L Y YR S +   + +I+   + 
Sbjct: 130 GAVIMNAGCYGAETVNVVKSVRVMNRAGVVRELSVEDLHYTYRHSALQDGEPVIVLDAIF 189

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
            G P+    I A +A +   RET QPI+EKTGGSTFKNP GHS+W+L++++G RG  +GG
Sbjct: 190 EGTPDEPEAIKARMAEITARRETTQPIREKTGGSTFKNPPGHSSWKLVDEAGWRGKPYGG 249

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           A  S LH NF+IN   AT  DLE LGE VR  V  ++G+ L+WEIKR+G
Sbjct: 250 AMFSPLHSNFLINTGEATAADLEGLGEAVRADVLAKTGVQLDWEIKRIG 298


>gi|330994421|ref|ZP_08318346.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Gluconacetobacter
           sp. SXCC-1]
 gi|329758421|gb|EGG74940.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Gluconacetobacter
           sp. SXCC-1]
          Length = 321

 Score =  255 bits (651), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 125/302 (41%), Positives = 177/302 (58%), Gaps = 6/302 (1%)

Query: 7   SRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITI 66
           +R L     + RG+      L   TWFR GG AE++FQP    DL   +  LP ++P+  
Sbjct: 11  ARALDTDACRPRGRLTPQAALGARTWFRVGGAAELLFQPASAEDLAQVMQCLPLEVPVLP 70

Query: 67  VGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGF 126
           +G  SN++VRD GI G+V+RL+  GF+ +  R    ++ GA C   ++A  A   G+ G 
Sbjct: 71  LGACSNVIVRDGGIDGLVVRLAR-GFATL-TREGDGLVAGAACLDMTVAEHAAEAGLAGL 128

Query: 127 HFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK 186
            F  GIPGSIGGA  MNAGA   + +  +  V  + R G    +P   L + YR + +  
Sbjct: 129 EFLAGIPGSIGGAVAMNAGAYGSDMAAVLDWVEVVTRDGRLLRLPAASLDFSYRHATLPP 188

Query: 187 DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNP----TGHSAWQL 242
             ++  V L G P S  +I   IA +   RE  QP++ +TGGSTF+NP    +G  AW+L
Sbjct: 189 QSVVVRVRLAGLPASPAVIRQRIAEIRTAREAAQPVRARTGGSTFRNPDPDESGRKAWEL 248

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           I+ +GCRGL  GGA++SE HCNFM+N DNAT  DLE LG+ VR++V   +G+ L WEI+R
Sbjct: 249 IDAAGCRGLRLGGAQMSEKHCNFMLNTDNATAADLEGLGDAVRQRVHAHTGVTLRWEIRR 308

Query: 303 LG 304
           +G
Sbjct: 309 IG 310


>gi|163794529|ref|ZP_02188500.1| UDP-N-acetylenolpyruvoylglucosamine reductase [alpha
           proteobacterium BAL199]
 gi|159180253|gb|EDP64776.1| UDP-N-acetylenolpyruvoylglucosamine reductase [alpha
           proteobacterium BAL199]
          Length = 318

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 126/295 (42%), Positives = 179/295 (60%), Gaps = 2/295 (0%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           L ER   +RG+++ +  + Q+TWFR GG AEV+F+P D  DL  FL   P D+P+T++G+
Sbjct: 16  LIERLPPVRGEYRVDASIAQLTWFRVGGPAEVLFRPADEADLIDFLAGRPGDVPVTVLGV 75

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
           GSN L+RD GI GVV+RL  A F++  V     ++ GA     ++A +A R G+ G  F 
Sbjct: 76  GSNTLIRDGGIPGVVIRLGKA-FASAMVDGE-RIMAGAGALDVTVAATAQRAGLTGLEFL 133

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLI 189
            GIPG+IGG   MNAGA   E    ++    ID  G+ H +    +   YR   + ++ I
Sbjct: 134 SGIPGTIGGGLRMNAGAYGSEIRDVLISARAIDPLGHVHTLAPADMGLSYRHCGVPEEWI 193

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
            T  V +        I+ A+ ++   RE  QP + +TGGSTF NP G  AWQLI+ +GCR
Sbjct: 194 FTSAVFQARTGDSATIAQAMTDIRDAREDTQPRRVRTGGSTFANPEGRKAWQLIDAAGCR 253

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           GL  G A++SE HCNF++N  +AT  D+E LGE+VR++V   SGI L WEI+R+G
Sbjct: 254 GLRIGDAQVSEKHCNFLLNIGDATAEDIESLGEEVRRRVRESSGITLRWEIRRIG 308


>gi|295688571|ref|YP_003592264.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Caulobacter segnis
           ATCC 21756]
 gi|295430474|gb|ADG09646.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Caulobacter segnis
           ATCC 21756]
          Length = 301

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 131/290 (45%), Positives = 171/290 (58%), Gaps = 3/290 (1%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RGK   +  L   TWFR GG A+V+F P D  DL  FL  L   +P+  +G+GSN+LVR
Sbjct: 10  VRGKLLIDEALAPFTWFRVGGPADVVFLPADEQDLSDFLKALDPAVPVMAIGVGSNLLVR 69

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ GV++RL   GF+ +E      +  G+      LA  A   GI G  F+ GIPG+I
Sbjct: 70  DGGVDGVIIRLGK-GFNTVEPLGDNRIKAGSAVPDAILARKAAEAGIAGLEFYAGIPGTI 128

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT--KDLIITHVV 194
           GGA  MNAG    ET   V  V  +DR G    +  E L Y YR S +   + +I+   V
Sbjct: 129 GGAVIMNAGCYGSETVNVVKSVRVMDRAGVVRELAVEDLHYTYRHSALQDGETVIVLDAV 188

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
             G  +    I A +A +   RET QPI+EKTGGSTFKNP GHS+W+L++++G RG  FG
Sbjct: 189 FEGTADEPEAIKARMAEITARRETTQPIREKTGGSTFKNPPGHSSWKLVDEAGWRGKLFG 248

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           GA  S LH NF+IN   AT  DLE LGE VR  V  ++G+ L+WEIKR+G
Sbjct: 249 GAMFSPLHSNFLINTGEATAADLEGLGEAVRADVKAKTGVQLDWEIKRIG 298


>gi|326388920|ref|ZP_08210502.1| UDP-N-acetylmuramate dehydrogenase [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326206520|gb|EGD57355.1| UDP-N-acetylmuramate dehydrogenase [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 298

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 121/296 (40%), Positives = 178/296 (60%), Gaps = 1/296 (0%)

Query: 15  KQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNIL 74
           K  RGK   + PL  + WF+ GG A+ +F+P D  DL+ FL  L  +IP+  +GLGSN++
Sbjct: 2   KAPRGKLTADAPLAPLVWFKAGGAAQWLFEPADTADLQDFLAFLAPEIPVMALGLGSNLI 61

Query: 75  VRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPG 134
           VRD G+ GVV+RL  A F+ ++  +   +  G   SG  ++++A  +GI G  F   IPG
Sbjct: 62  VRDGGVPGVVVRLGKA-FAGVKALDGVTLECGGGASGVLVSSTARDNGIAGLEFLRSIPG 120

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVV 194
           ++GG   MN GA   E    +V+   + R G    +    L Y YR S++ +  I+    
Sbjct: 121 TVGGFVRMNGGAYGREVKDILVDCDVVLRSGALVTLSLADLGYAYRHSDLAEGAIVVAAR 180

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
            RG P     I A +  +   RE  QP++ +TGGSTFKNP GH AW+L++++GCRGLE G
Sbjct: 181 FRGEPGDPAAIQAEMERIAAAREASQPLRTRTGGSTFKNPDGHRAWELVDRAGCRGLELG 240

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQ 310
           GA++SE H NF+IN   AT  ++E LGE VR++V + +G+ L WEIKR+G+  + Q
Sbjct: 241 GAQVSEKHTNFLINTGEATSAEIEALGELVRQRVKDATGVELHWEIKRVGNKSEDQ 296


>gi|302383798|ref|YP_003819621.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302194426|gb|ADL01998.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 303

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 131/298 (43%), Positives = 178/298 (59%), Gaps = 5/298 (1%)

Query: 11  RERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLG 70
           R+    +RGK   + PL   TWFR GG A+V+F P D  DL  FL  L   +P+TI+G+G
Sbjct: 4   RDTLPTVRGKLLRDEPLAPFTWFRVGGAADVLFIPADADDLADFLKALDPAVPVTILGVG 63

Query: 71  SNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFY 130
           SN++VRD G+ GVV+RL+   F+ I       +  GA      +A ++ + G+ G  F+ 
Sbjct: 64  SNVIVRDGGVEGVVIRLAGRPFAGISTDGET-ITAGAGALDAMVAKASAKAGLAGLEFYA 122

Query: 131 GIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLII 190
           GIPG+IGGA  MNAG    ET   VV   G+ R G       +   Y YR ++  +D++ 
Sbjct: 123 GIPGTIGGALVMNAGCYGSETKDVVVSARGVTRTGELRDFSVDDFGYSYRHNDYDEDILW 182

Query: 191 THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRG 250
                RG P+    ++A IA +   RET QPI+EKTGGSTFKNP GHS+W+L++++G RG
Sbjct: 183 VEATYRGTPDDPEAVAARIAAITARRETTQPIREKTGGSTFKNPPGHSSWKLVDEAGWRG 242

Query: 251 ----LEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
               +  GGA  S+LH NFMIN   AT  D+E LGE VR  V ++ G+ LEWEIKRLG
Sbjct: 243 KLHAVTGGGAMFSDLHSNFMINPGEATAADIEGLGETVRADVQSKLGVNLEWEIKRLG 300


>gi|315498793|ref|YP_004087597.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Asticcacaulis
           excentricus CB 48]
 gi|315416805|gb|ADU13446.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Asticcacaulis
           excentricus CB 48]
          Length = 300

 Score =  252 bits (643), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 137/292 (46%), Positives = 182/292 (62%), Gaps = 8/292 (2%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RGK  +   L   TWFR GG A+V+F P+D  DL  FL  L   +P+T +G+GSN+LVR
Sbjct: 11  VRGKIVKQAELAPFTWFRVGGPADVLFLPEDEADLATFLKGLDPAVPVTPIGVGSNLLVR 70

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ GVV+RL    F+ I V +   +  GA      +A  A R G+ G  F+ GIPG++
Sbjct: 71  DGGLEGVVVRLGR-NFAQI-VTDDWGLTAGAAALDAQVAKVAARAGLAGLEFYAGIPGTV 128

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLII---TH 192
           GGA  MNAG    ET   ++    +DR GN   +   +L++ YR S +  K+ I+    +
Sbjct: 129 GGAVTMNAGCYGRETKDALLSARIMDRSGNVVTLSNAELQFAYRHSILQEKNWIVLGAAY 188

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
            +  G   S+ I  A I  +   RET QPI+EKTGGSTFKNP GHSAW+L++++G RG  
Sbjct: 189 ELQEGNDPSEVI--ARIEEITAKRETSQPIREKTGGSTFKNPEGHSAWKLVDEAGWRGKF 246

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           FGGAK SELH NFMINADNAT  DLE LG+ VR +V ++ GI L WEIKR+G
Sbjct: 247 FGGAKFSELHSNFMINADNATAADLEGLGDTVRAEVKDKFGIDLHWEIKRIG 298


>gi|167647624|ref|YP_001685287.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Caulobacter sp. K31]
 gi|189028919|sp|B0T826|MURB_CAUSK RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|167350054|gb|ABZ72789.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Caulobacter sp. K31]
          Length = 307

 Score =  251 bits (642), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 127/296 (42%), Positives = 172/296 (58%), Gaps = 9/296 (3%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RGK   +  L   TWFR GG A+V+F P D  DL  FL  L   +P+  +G+GSN+LVR
Sbjct: 10  VRGKLLVDEALAPFTWFRVGGPADVVFLPADEQDLADFLKALDPAVPVLAIGVGSNLLVR 69

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ GVV+RL   GF+ +E      +  G+      LA  A   GI G  F+ GIPG++
Sbjct: 70  DGGVEGVVIRLGK-GFNTVEALGDNRIKAGSAVPDAILARKAAEAGIAGLEFYAGIPGTV 128

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVL 195
           GGA  MNAG    ET+  ++    +DR+G    +   +L + YR S +    LI+   V 
Sbjct: 129 GGATIMNAGCYGSETANILISARVMDRRGQVRELTAAELHFTYRHSALQDAGLIVLDAVF 188

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEF-- 253
            G  +    I A +A +   RET QPI+EKTGGSTFKNP GHS+W+L++++G RG  F  
Sbjct: 189 EGLADDPAAIKARMAEITSRRETTQPIREKTGGSTFKNPPGHSSWKLVDEAGWRGKRFSA 248

Query: 254 -----GGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
                GGA  S LH NF+IN   AT  DLE LG+ VR  V  ++G+ L+WEIKR+G
Sbjct: 249 SGKEGGGAMFSPLHSNFLINTGEATAADLEGLGDTVRADVLAKTGVQLDWEIKRIG 304


>gi|296284496|ref|ZP_06862494.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Citromicrobium
           bathyomarinum JL354]
          Length = 303

 Score =  251 bits (642), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 123/296 (41%), Positives = 179/296 (60%), Gaps = 1/296 (0%)

Query: 9   LLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVG 68
           L  E+   +RGK  ++ PL ++ WF+ GG A+ +F+P D+ DL  F+  L   +P+  +G
Sbjct: 7   LPAEKLPDVRGKLTQHAPLAKLVWFKAGGAADWLFEPADVDDLCAFVRDLDPAVPLLPLG 66

Query: 69  LGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHF 128
           LGSN++VRD G+ GV +RL  + F+ IE      +  GA   G  +A++A  +GI G  F
Sbjct: 67  LGSNLIVRDGGVPGVTIRLGKS-FAKIETAGDHTLHSGAGAHGVLIASTARDNGIAGLEF 125

Query: 129 FYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL 188
             GIPG++GG   MN GA   ET+  +V+   + R G+   +P  +L Y YR S++ +  
Sbjct: 126 LRGIPGTLGGFVRMNGGAYGRETADVLVDCDVVLRDGSLKTLPVAELGYTYRHSQLPEGA 185

Query: 189 IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGC 248
           ++    L+G       I A +  +   RE  QP++ KTGGSTFKNP G  AWQL++ +GC
Sbjct: 186 VVVAARLKGEAGDPEAIGAEMERIAQAREESQPVRTKTGGSTFKNPPGEKAWQLVDAAGC 245

Query: 249 RGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           RG+  GGA++SE H NF+IN   AT  D+E LGE VR KV   SG+ LEWEI+R+G
Sbjct: 246 RGMMRGGAQVSEKHTNFLINTGTATSEDIEQLGEDVRAKVRANSGVELEWEIQRVG 301


>gi|58038645|ref|YP_190609.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Gluconobacter
           oxydans 621H]
 gi|81352634|sp|Q5FUJ3|MURB_GLUOX RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|58001059|gb|AAW59953.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Gluconobacter
           oxydans 621H]
          Length = 306

 Score =  251 bits (642), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 128/290 (44%), Positives = 184/290 (63%), Gaps = 2/290 (0%)

Query: 15  KQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNIL 74
           K LRG+   N PL    WFR GG A+ +F P+D  DL  FL   P+ +P+T++G  SN++
Sbjct: 10  KGLRGRLTPNAPLGPRAWFRVGGPADWLFVPEDQDDLALFLREKPATMPVTVLGACSNVI 69

Query: 75  VRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPG 134
           +RD GI G V+RL+  GF++I V+ +  +IVGA     ++A  A   G+ G  F  GIPG
Sbjct: 70  IRDGGIAGTVIRLAR-GFADITVQGNS-LIVGAAALDITVAEHAAAAGLAGLEFLAGIPG 127

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVV 194
           SIGGA  MNAGA   + +        +  +G    +  ++L + YR SE+ +  ++    
Sbjct: 128 SIGGAVRMNAGAYGSDINAVFEWADILTAEGELRRLSHDELGFAYRHSELPEGSVVIRAS 187

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
           LRG P++ + I + IA++   RE  QP++ +TGGSTF+NP GH AWQLI+++GCRGL+ G
Sbjct: 188 LRGTPDNADAIRSRIADIRASREASQPVRARTGGSTFRNPDGHKAWQLIDEAGCRGLQIG 247

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            A++SE HCNF++N   A+  DLE LGE VR+KV  QSG+ L WEIKR+G
Sbjct: 248 DAQVSEKHCNFLLNLGQASSADLETLGETVREKVLAQSGVDLHWEIKRIG 297


>gi|332187117|ref|ZP_08388857.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sphingomonas sp.
           S17]
 gi|332012817|gb|EGI54882.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sphingomonas sp.
           S17]
          Length = 295

 Score =  248 bits (634), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 119/286 (41%), Positives = 167/286 (58%), Gaps = 1/286 (0%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDA 78
           G+     PL  + WF+ GG AE + +P+D+ DL  FL  L  ++P+  +GLGSN++VRD 
Sbjct: 8   GRLTPAAPLAPLVWFKAGGPAEYLLEPKDVDDLSAFLKALGGEVPVMALGLGSNLIVRDG 67

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           G+ GVV+RL    FS         +  G   SG  ++++A   GIGG  F   IPG++GG
Sbjct: 68  GVPGVVVRLGKP-FSYARAGEEHLITCGGGTSGILVSSNARDAGIGGLEFLRSIPGTVGG 126

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGF 198
              MN GA   E +  +V    + R G    +    L+Y YR S +T   ++     +G 
Sbjct: 127 FVRMNGGAYGREVADVLVSATVVRRDGTVETLGVADLEYTYRHSNLTDGTVVVEATFQGQ 186

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
                II A +  +   RE  QP++ KTGGSTFKNP GH AW L++ +GCRGL  G A++
Sbjct: 187 AAEPEIIQAEMDRIAAAREASQPLRSKTGGSTFKNPEGHKAWALVDAAGCRGLTLGDAQV 246

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           SE HCNF++N  NAT  ++E LGE+VR KV  QSG+ LEWEI+R+G
Sbjct: 247 SEKHCNFLLNLGNATAAEIEALGEEVRAKVKAQSGVTLEWEIQRVG 292


>gi|83858913|ref|ZP_00952435.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Oceanicaulis
           alexandrii HTCC2633]
 gi|83853736|gb|EAP91588.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Oceanicaulis
           alexandrii HTCC2633]
          Length = 307

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 132/301 (43%), Positives = 177/301 (58%), Gaps = 6/301 (1%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           L +R   +RGK  EN  L  ITW R GG A+V+F P D  DL  FL   P DI + ++G 
Sbjct: 6   LLDRLPSVRGKLIENASLADITWLRVGGPAQVLFLPADAADLARFLAETPRDIDVRVLGA 65

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
           GSN LVRD G+ GV ++L+ A F  +E   +  +  GA    K +A +A + GI G  F+
Sbjct: 66  GSNTLVRDGGLPGVTVKLTPA-FGKVEALENNRIRAGAAALDKMVAKAAAKAGIAGLEFY 124

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLI 189
            G+PG+IGGA  MNAG    ET   +VE   +DR G + + P E+L Y YR S+  +D I
Sbjct: 125 VGVPGAIGGALRMNAGCYGTETKDVLVEAVALDRTGRRIIAPVEELGYAYRHSDAPEDWI 184

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPT-----GHSAWQLIE 244
               V  G  +    ++  +  +   RE  QPI+EKT GSTFKNP      G SAWQL++
Sbjct: 185 FIEAVFEGQADDPEAVTERMNAITERREASQPIREKTSGSTFKNPDPETSGGRSAWQLVD 244

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            +G RG   GGA+ SE HCNF+IN   AT  DLE LGE VR +V ++ G+ L WE+KR+G
Sbjct: 245 AAGWRGKPIGGARFSEQHCNFLINDGTATASDLETLGETVRAEVKDKFGVQLHWEVKRIG 304

Query: 305 D 305
           +
Sbjct: 305 E 305


>gi|329115579|ref|ZP_08244301.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acetobacter pomorum
           DM001]
 gi|326695007|gb|EGE46726.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acetobacter pomorum
           DM001]
          Length = 345

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 126/292 (43%), Positives = 172/292 (58%), Gaps = 6/292 (2%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RG+     PL   TWFR GG AE +FQP D  DL   L  L  ++PIT +G  SN+++R
Sbjct: 49  MRGRLTPQAPLGPRTWFRVGGAAEWLFQPADAEDLAGVLQRLSPELPITALGACSNVIIR 108

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ GVV+R++  GF++I V     +I G  C   ++A  A + G+ G  F  GIPGSI
Sbjct: 109 DGGLEGVVVRMAR-GFADITVEAD-GIIAGCACLDATVAEHAAQAGLAGLEFLAGIPGSI 166

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGA   + +  +     I R G+   +    L++ YR S + +   +    LR
Sbjct: 167 GGAVRMNAGAYGSDIANVLDWAEIITRDGSLIRLDNAALRFGYRRSGLPEGAFVIRARLR 226

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNP----TGHSAWQLIEKSGCRGLE 252
           G P +   ++  IA V   RE  QP++ +TGGSTF+NP    +   AW+LI+ +GCRGL 
Sbjct: 227 GTPANAQDVANRIAEVRAARELSQPVRARTGGSTFRNPDAETSARKAWELIDAAGCRGLR 286

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            G A++SE HCNF+IN  NAT  DLE LGE VR +V   SG+ L WEIKRLG
Sbjct: 287 HGDAQVSEKHCNFLINLGNATATDLEELGEDVRTRVAQNSGVSLHWEIKRLG 338


>gi|258542972|ref|YP_003188405.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256634050|dbj|BAI00026.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256637110|dbj|BAI03079.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256640162|dbj|BAI06124.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256643219|dbj|BAI09174.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256646274|dbj|BAI12222.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256649327|dbj|BAI15268.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256652313|dbj|BAI18247.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256655371|dbj|BAI21298.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 314

 Score =  241 bits (616), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 125/292 (42%), Positives = 171/292 (58%), Gaps = 6/292 (2%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RG+     PL   TWFR GG AE +FQP D  DL   L  L  ++PIT +G  SN+++R
Sbjct: 18  MRGRLTPQAPLGPRTWFRVGGAAEWLFQPADAEDLAGVLQRLSPELPITALGACSNVIIR 77

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ GVV+R++  GF++I V     +I G  C   ++A  A + G+ G  F  GIPGSI
Sbjct: 78  DGGLEGVVVRMAR-GFADITVEAD-GIIAGCACLDATVAEHAAQAGLSGLEFLAGIPGSI 135

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGA   + +  +     I R G+   +    L++ YR S + +   +    LR
Sbjct: 136 GGAVRMNAGAYGSDIANVLDWAEIITRDGSLIRLDNAALRFGYRRSGLPEGAFVIRARLR 195

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS----AWQLIEKSGCRGLE 252
             P +   ++  IA V   RE  QP++ +TGGSTF+NP   +    AW+LI+ +GCRGL 
Sbjct: 196 SIPANPQDVANRIAEVRAARELSQPVRARTGGSTFRNPDAETSSRKAWELIDAAGCRGLR 255

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            G A++SE HCNF+IN  NAT  DLE LGE VR +V   SG+ L WEIKRLG
Sbjct: 256 CGDAQVSEKHCNFLINLGNATAADLEGLGEDVRTRVAQNSGVSLHWEIKRLG 307


>gi|209545284|ref|YP_002277513.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209532961|gb|ACI52898.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 312

 Score =  241 bits (616), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 128/292 (43%), Positives = 172/292 (58%), Gaps = 6/292 (2%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRG+  +  PL   TWFR GG AE++ QP D  DL   L  LP D+P+T++G  SN+++R
Sbjct: 5   LRGRLTQGAPLGPRTWFRVGGPAEILLQPADTQDLADALHRLPPDVPVTVLGACSNVIIR 64

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GI GVV+RL   GF++I V     ++VGA C    +A  A   G+ G  F  GIPGSI
Sbjct: 65  DGGIDGVVIRLGG-GFADI-VAEPDGLVVGAACLDMVVAERAAEAGLKGLEFLAGIPGSI 122

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGA+  + +  +     I R GN   +    L + YR S +    ++    LR
Sbjct: 123 GGAVAMNAGAHGSDVATVLDWADIITRDGNSVRLSGPALGFGYRRSALPAGAVVVRARLR 182

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNP----TGHSAWQLIEKSGCRGLE 252
             P +   I  AIA +   RE  QP + +TGGSTF+NP    T   AW+LI+ +GCRGL 
Sbjct: 183 AAPAAPADIRQAIAAIRQSREESQPTRARTGGSTFRNPDPSVTDRKAWELIDSAGCRGLT 242

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
             GA++S  HCNF++N  +AT   LE LGE VRK+V   +G+ LEWEIKR+G
Sbjct: 243 MDGAQVSTKHCNFILNTGDATAAALERLGESVRKRVRVHTGVTLEWEIKRIG 294


>gi|296116439|ref|ZP_06835053.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295977032|gb|EFG83796.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 339

 Score =  241 bits (616), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 122/298 (40%), Positives = 174/298 (58%), Gaps = 6/298 (2%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
             RG+   + PL   TWFR GG AE++ QP D  DL   L  +P ++P+ ++G  SN ++
Sbjct: 27  DFRGRLTPDAPLGPRTWFRVGGAAELLVQPADARDLALALRHIPLEVPVRVLGACSNTII 86

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD GI GVV+RL   GF++I   +   +I GA C   ++A  A   G+ G  F  GIPG+
Sbjct: 87  RDGGIDGVVIRLGR-GFADI-AHDGNGLIAGAACLDMTVAEHAATCGLAGMEFLAGIPGA 144

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           +GGA  MNAGA   + S  +  V  I R G    +P   LK+ YR + + +  ++    L
Sbjct: 145 LGGAVSMNAGAYGSDISNILDWVEIITRDGEALRLPGGALKFSYRHALVPQGAVVVRTRL 204

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNP----TGHSAWQLIEKSGCRGL 251
            G P +   I   IA +   RE  QP++ +TGGSTF+NP    +   AW+LI+ +GCRGL
Sbjct: 205 CGQPSNGTAIRERIAQIRAAREAAQPVRARTGGSTFRNPAPDISDRKAWELIDAAGCRGL 264

Query: 252 EFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDH 309
             GGA++SE HCNF++N   AT  +LE LGE+VR +V   +G+ LEWEI+R+G    H
Sbjct: 265 TLGGAQVSEKHCNFLLNTGAATAAELEELGERVRARVREHTGVTLEWEIRRIGRPAAH 322


>gi|157803466|ref|YP_001492015.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia
           canadensis str. McKiel]
 gi|166222849|sp|A8EXZ7|MURB_RICCK RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|157784729|gb|ABV73230.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia
           canadensis str. McKiel]
          Length = 297

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 132/292 (45%), Positives = 184/292 (63%), Gaps = 4/292 (1%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           ++G++++++ LK +TWF+ GGNAE+ F+P D  DL  FL      +PIT  G GSNI++R
Sbjct: 7   VKGEYKKDYNLKHLTWFKVGGNAEIFFKPFDSEDLASFLRQNKQKLPITTFGAGSNIIIR 66

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GI GV ++L  + FSNI+  +   ++VG+ C   +LA     + I GF F  GIPG+I
Sbjct: 67  DGGIEGVTIKLGQS-FSNIDFIDDNHLVVGSSCLNYNLAKFCQANAISGFEFLVGIPGTI 125

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GG A MNAGA   E    +V +  ID  GN      E++ ++YRS+ + K+LII   + +
Sbjct: 126 GGGAAMNAGAYGSEFKDIIVRIEAIDFAGNFLTFTNEEIGFKYRSNNLPKNLIILKAIFK 185

Query: 197 -GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGH-SAWQLIEKSGCRGLEFG 254
               +S+NI+   +  +   R   QPIKE+TGGSTF NP G   +WQLI+K+G RG   G
Sbjct: 186 VNKGDSENIL-LRMNEINATRSRTQPIKERTGGSTFANPEGGLKSWQLIDKAGLRGYRIG 244

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           GA +SELHCNFMIN  +AT  DLE LG  VR+ VF  SG+ L WEIKR+G +
Sbjct: 245 GASVSELHCNFMINNGDATAKDLEDLGNFVRQNVFEDSGVKLNWEIKRIGKY 296


>gi|56696093|ref|YP_166447.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Ruegeria pomeroyi
           DSS-3]
 gi|81350283|sp|Q5LU58|MURB_SILPO RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|56677830|gb|AAV94496.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Ruegeria pomeroyi
           DSS-3]
          Length = 308

 Score =  239 bits (609), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 124/304 (40%), Positives = 175/304 (57%), Gaps = 15/304 (4%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RGK   N  L ++TW R GG A+ +FQP DI DL+ FL +LP+DI +  +G+GSN++VR
Sbjct: 7   IRGKLTPNRDLSELTWLRVGGPADWLFQPADIDDLQTFLRMLPADIAVFPMGVGSNLIVR 66

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+R VV+RL   GF+ I+V     +  GA      +A  A   G+    F   IPGSI
Sbjct: 67  DGGLRAVVIRLGR-GFNAIDVAGDT-VTAGAAALDAHVARKAADAGVD-LTFLRTIPGSI 123

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAG     T+        + R G    +   +L ++YR S++ +  ++    L+
Sbjct: 124 GGAVRMNAGCYGSYTADVFRSAQVVLRSGELATLGAAELNFRYRQSDLPEGAVLVSASLQ 183

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLIE 244
           G P     + A +      R+  QP KE++ GSTF+NP G S            AW++I+
Sbjct: 184 GVPGDPEALHARMQAQLDKRDQTQPTKERSAGSTFRNPAGFSSTGRADDTHELKAWKVID 243

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           ++G RG   GGA++SE+H NF+IN   AT  DLE LGE+VRKKV++ SGI LEWEI R+G
Sbjct: 244 EAGMRGARLGGAQMSEMHSNFLINTGGATAADLEGLGEEVRKKVYDTSGITLEWEIMRVG 303

Query: 305 DFFD 308
           D  D
Sbjct: 304 DPLD 307


>gi|163732129|ref|ZP_02139575.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Roseobacter
           litoralis Och 149]
 gi|161394427|gb|EDQ18750.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Roseobacter
           litoralis Och 149]
          Length = 309

 Score =  238 bits (607), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 125/304 (41%), Positives = 179/304 (58%), Gaps = 21/304 (6%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RG+  +  PL  +TW R GG A+ +FQP D+ DL  FL  LP D+ +  +G+GSN++VR
Sbjct: 7   VRGRLTQGRPLSDLTWLRVGGPADWLFQPADMQDLYAFLVSLPPDVEVFPMGVGSNLIVR 66

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+R VV+RL   GF+ IE+     ++ GA      +A  A   G+    F   IPGSI
Sbjct: 67  DGGLRCVVIRLGR-GFNQIEI-TGSRVVAGAAALDAHVARKAADAGLD-LTFLRTIPGSI 123

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL- 195
           GGA  MNAG     T+  +VEV  + R G    +    L + YR S +T+  ++T  +  
Sbjct: 124 GGAVRMNAGCYGSYTADVLVEVQVVSRTGEVSTLSASDLHFGYRHSTLTEGAVLTKAIFD 183

Query: 196 --RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQ 241
             RG P++   + A +A+    R+  QP KE++ GSTF+NP+G S            AW+
Sbjct: 184 APRGDPDT---LHARMADQLAKRDATQPTKERSAGSTFRNPSGFSSTGRSDDVHDLKAWK 240

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           +I+ +G RG   GGA++SE+H NFM+N   AT  DLE LGE+VRKKV++ SGI LEWEI 
Sbjct: 241 VIDDAGMRGARLGGAQMSEMHSNFMVNTGRATAADLEGLGEEVRKKVYDSSGITLEWEIM 300

Query: 302 RLGD 305
           R+G+
Sbjct: 301 RIGE 304


>gi|260576895|ref|ZP_05844878.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodobacter sp. SW2]
 gi|259020932|gb|EEW24245.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodobacter sp. SW2]
          Length = 316

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 124/300 (41%), Positives = 172/300 (57%), Gaps = 15/300 (5%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRD 77
           RG      PL  +TW R GG AE +FQP D+ DL+ FL  L   +P+  +G+GSN++VRD
Sbjct: 8   RGTLTAKKPLADLTWLRVGGPAEWVFQPADLADLRGFLAELDPGVPVFPIGVGSNLIVRD 67

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G+RGVV+RL   GF+ I V++   +I GA      +A  A   G+    F   IPG+IG
Sbjct: 68  GGMRGVVVRLGR-GFNEIAVQDGT-VIAGAAALDGHVARRAAEAGVD-LTFLRTIPGAIG 124

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRG 197
           GA  MNAG      + ++VE+  + R+G    IP   L  +YR S++ +  IIT    R 
Sbjct: 125 GAVKMNAGCYGAYVADHLVEIQVVTRQGEVITIPAADLHLRYRQSDLPEGCIITRATFRA 184

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLIEK 245
                  + A +A     R+  QP K+++ GSTF+NP GHS            AW++I++
Sbjct: 185 AKADPAALEARMAEQIAKRDASQPTKDRSAGSTFRNPVGHSSTGRADDSHELKAWKVIDE 244

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +G RG   GGA+IS +H NF+IN   AT  DLE LGE VRK+VF  SG+ LEWEI R+G+
Sbjct: 245 AGMRGARLGGAQISPMHSNFLINTGGATAADLEDLGEAVRKRVFETSGLTLEWEIMRVGE 304


>gi|189183855|ref|YP_001937640.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Orientia
           tsutsugamushi str. Ikeda]
 gi|254765516|sp|B3CSQ9|MURB_ORITI RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|189180626|dbj|BAG40406.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Orientia
           tsutsugamushi str. Ikeda]
          Length = 303

 Score =  237 bits (605), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 131/292 (44%), Positives = 183/292 (62%), Gaps = 4/292 (1%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
           ++ G++++NF L  +TWF+ GG ++V ++P+D HDL YFL  L S+I IT++G GSN+L+
Sbjct: 9   KVNGEYRKNFKLSHLTWFKVGGISQVFYKPKDEHDLSYFLANLQSNIKITVLGAGSNLLI 68

Query: 76  RDAGIRGVVLRLSNAGFSNIEV--RNHCEMI-VGARCSGKSLANSALRHGIGGFHFFYGI 132
           RD GI GV ++L  + F+ I     NH  +I VGA      +A   L+H +GG  F  GI
Sbjct: 69  RDNGIDGVTIKLGRS-FNEINFVKNNHYNIISVGAGTLNYDVAKFCLQHNLGGLEFLVGI 127

Query: 133 PGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITH 192
           PG+IGG   MNAGA   E    V  V  +DR GN+H+   + L ++YR   +   LI T 
Sbjct: 128 PGTIGGGIAMNAGAYGQEFKDVVYSVEALDRSGNKHIFLSKDLNFEYRQCIVNGFLIFTK 187

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
             L  + +S+  IS  +  +   R+  QPI +KT GS F+N   + AWQLI+K G RG  
Sbjct: 188 TNLICYNDSKPSISQKLQKIQTVRKLTQPINQKTAGSAFRNTNNYKAWQLIDKVGLRGHS 247

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            GGA++S LHCNF+IN  NAT  D+E LGE +RKKVF+ +GI LEWEIK +G
Sbjct: 248 IGGAQVSNLHCNFLINNGNATASDIENLGELIRKKVFDHTGITLEWEIKIVG 299


>gi|114570626|ref|YP_757306.1| UDP-N-acetylmuramate dehydrogenase [Maricaulis maris MCS10]
 gi|122315582|sp|Q0AMW9|MURB_MARMM RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|114341088|gb|ABI66368.1| UDP-N-acetylmuramate dehydrogenase [Maricaulis maris MCS10]
          Length = 315

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 130/294 (44%), Positives = 176/294 (59%), Gaps = 7/294 (2%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RGK+ E  PLK +TW R GG A+V++ P D  DL  FL   P +IP+T++G GSN LVR
Sbjct: 10  VRGKYIEAAPLKGLTWLRVGGPADVLYLPADESDLCRFLAETPDEIPVTVLGAGSNTLVR 69

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ GVV+RL+ A F+  E  +   +  GA    K +A +A + GIGG  +  G+PG+I
Sbjct: 70  DGGVPGVVIRLAGA-FAKTEALDGYRLRAGAGALDKMVAKAAAKAGIGGLEYLVGVPGTI 128

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAG  + ETS  VVEV  +DR G + +   ++L Y YR  E  +D I T  V +
Sbjct: 129 GGALRMNAGCYDQETSDVVVEVIALDRMGRRIIASPDELAYSYRHCEAPEDWIFTGAVFQ 188

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTG------HSAWQLIEKSGCRG 250
           G  +  + I+  +  +   RET QPI+EKT GSTF NP          +W+LI+  G RG
Sbjct: 189 GQADDPDAITKRMNAITARRETTQPIREKTSGSTFANPDPPGTPNQRKSWELIDSVGGRG 248

Query: 251 LEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
              GGA  SE HCNF+IN   A+  DLE +GE VR +V  Q  I L WE++R+G
Sbjct: 249 YRVGGAHFSEQHCNFLINDGTASAADLEQVGEDVRARVRQQHDIELRWEVRRIG 302


>gi|114799112|ref|YP_759127.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Hyphomonas neptunium
           ATCC 15444]
 gi|123028401|sp|Q0C566|MURB_HYPNA RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|114739286|gb|ABI77411.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Hyphomonas neptunium
           ATCC 15444]
          Length = 323

 Score =  236 bits (602), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 130/309 (42%), Positives = 177/309 (57%), Gaps = 24/309 (7%)

Query: 15  KQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNIL 74
             +RGK      L   TWFR GG A+ +F P D  DL+ FL  L   IP+T +G+GSN++
Sbjct: 15  PDVRGKLLRGAELAPYTWFRVGGPADALFLPADEEDLEAFLKALDPAIPVTPLGVGSNLI 74

Query: 75  VRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPG 134
           VRD GI G+V+RL    +  IE  +   +   A     ++A +A  +GI G  F  GIPG
Sbjct: 75  VRDGGIPGIVIRLMGKYWGEIEALDGITLTARAGALDLAVAKAAAANGITGLEFLSGIPG 134

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQ---------HVIPREQLKYQYRSSEIT 185
           S+GGA   NAG    E    +V +HG  R G++           +P  +  + YR +++ 
Sbjct: 135 SLGGATRTNAGCYGSELRDRLVALHGFRRDGSRVAYRGPGKPGALP--EAHFSYRHTDLP 192

Query: 186 KDLIITHVVLRGF----PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTG----- 236
            DLI+T ++L G     PE+   ISA IA +   R   QPIKEKT GSTF NP       
Sbjct: 193 DDLIVTRLILEGTGAGDPEA---ISADIAALQARRAQTQPIKEKTSGSTFANPDPPGTPD 249

Query: 237 -HSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGIL 295
             SAW+LI+ +GCRGL+ GGA++S LHCNF+IN  +AT  DLE LGE VR +V   SG+ 
Sbjct: 250 QRSAWKLIDAAGCRGLKVGGAQVSPLHCNFLINTGDATAADLEALGELVRARVLENSGVE 309

Query: 296 LEWEIKRLG 304
           L WE++R+G
Sbjct: 310 LRWEVRRMG 318


>gi|99080526|ref|YP_612680.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Ruegeria sp. TM1040]
 gi|123252509|sp|Q1GIU8|MURB_SILST RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|99036806|gb|ABF63418.1| UDP-N-acetylmuramate dehydrogenase [Ruegeria sp. TM1040]
          Length = 308

 Score =  234 bits (598), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 122/301 (40%), Positives = 172/301 (57%), Gaps = 15/301 (4%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RG+   N  L  +TW R GG A+ +FQP D+ DL+ FL  LP+D+ +  +G+GSN++VR
Sbjct: 7   VRGRLTPNRDLSDLTWLRVGGPADYLFQPADLEDLQEFLRNLPADMDVFPMGVGSNLIVR 66

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+R VV+RL   GF+ IEV     +  GA      +A  +   G+    F   IPGSI
Sbjct: 67  DGGLRSVVIRLGR-GFNGIEVDGDT-VTAGAAALDAHVARKSAEAGVD-LTFLRTIPGSI 123

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAG      +   +    + R G+   +  E L+++YR +E+    ++    LR
Sbjct: 124 GGAVRMNAGCYGSYVADVFMSAQVVLRDGSLATLSAEDLQFKYRQTELAPGAVLVSATLR 183

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLIE 244
           G     + ++A + +    R+  QP KE++ GSTF+NP G S            AW++I+
Sbjct: 184 GPKGDPDALAARMEDQLRKRDETQPTKERSAGSTFRNPAGFSSTGKADDVMDLKAWKVID 243

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            +G RG   GGA++SE H NFMINA  AT  DLE LGE VRKKV+  SGI LEWEI R+G
Sbjct: 244 NAGLRGATLGGAQMSEKHSNFMINAGGATAADLEGLGENVRKKVYADSGIWLEWEIMRVG 303

Query: 305 D 305
           D
Sbjct: 304 D 304


>gi|296532818|ref|ZP_06895493.1| UDP-N-acetylmuramate dehydrogenase [Roseomonas cervicalis ATCC
           49957]
 gi|296266855|gb|EFH12805.1| UDP-N-acetylmuramate dehydrogenase [Roseomonas cervicalis ATCC
           49957]
          Length = 308

 Score =  234 bits (596), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 125/289 (43%), Positives = 176/289 (60%), Gaps = 3/289 (1%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRG+ Q+   L  +TWFRTGG AE + +P D+ DL   L   P  +P+T++G  SN+LVR
Sbjct: 20  LRGRVQQGAALAPLTWFRTGGPAEWLVRPADVDDLLLLLRDRPRTLPLTVIGAASNLLVR 79

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+RG+V++L+  GFS+I V     ++ GA     ++A  A   G+GG  F  GIPG+I
Sbjct: 80  DGGVRGIVVKLAR-GFSDIVVEPDG-IVAGAAALDATVAEHAAAAGLGGLEFLCGIPGAI 137

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGA   E    V++   +        +  E+L + YR S +  D I+     R
Sbjct: 138 GGAVAMNAGAYGAEVKD-VLDWAEVATPDGLLRLTAEELGFTYRHSALPPDGIVVRARFR 196

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
             P     I+A +  +   RE  QP++ +TGGSTFKNP GH AW LI+ +GCRGL  G A
Sbjct: 197 AAPGDGAAIAAKMNAIRAAREESQPVRARTGGSTFKNPDGHKAWALIDAAGCRGLRQGDA 256

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           ++SE HCNF++N   AT  +LE LGE VR +V  +SG++LEWEI+R+G+
Sbjct: 257 QVSEKHCNFLLNLGVATASELESLGEAVRARVAARSGVMLEWEIRRIGE 305


>gi|110680529|ref|YP_683536.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Roseobacter
           denitrificans OCh 114]
 gi|123172201|sp|Q163J3|MURB_ROSDO RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|109456645|gb|ABG32850.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Roseobacter
           denitrificans OCh 114]
          Length = 309

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 123/305 (40%), Positives = 178/305 (58%), Gaps = 21/305 (6%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
           ++RG+  +  PL  +TW R GG A+ +FQP D+ DL  FL  LP ++ +  +G+GSN++V
Sbjct: 6   KVRGRLTQARPLSDLTWLRVGGPADWLFQPADVEDLSDFLARLPEEVAVFPMGVGSNLIV 65

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD G+R VV+RL   GF+ I++ +   ++ GA      +A  A   G+    F   IPGS
Sbjct: 66  RDGGLRCVVIRLGR-GFNQIDI-SGTRVVAGAAALDAHVARKAADAGLD-LTFLRTIPGS 122

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           IGGA  MNAG     T+  +VEV  + R G    +    L+  YR S + +  ++T  V 
Sbjct: 123 IGGAVRMNAGCYGSYTADVLVEVQVVSRTGEVTTLAARDLQLGYRHSTLAEGAVLTKAVF 182

Query: 196 ---RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AW 240
              RG PE+   + A + +    R+  QP KE++ GSTF+NP G S            AW
Sbjct: 183 EAPRGDPET---LHARMTDQLARRDATQPTKERSAGSTFRNPAGFSSTGRSDDVHDLKAW 239

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           ++I+ +G RG   GGA++SE+H NFM+N   AT  DLE LGE+VRKKV++ SGI LEWEI
Sbjct: 240 KVIDDAGMRGARRGGAQMSEMHSNFMVNTGRATAADLEGLGEEVRKKVYDSSGITLEWEI 299

Query: 301 KRLGD 305
            R+G+
Sbjct: 300 MRVGE 304


>gi|255263903|ref|ZP_05343245.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thalassiobium sp.
           R2A62]
 gi|255106238|gb|EET48912.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thalassiobium sp.
           R2A62]
          Length = 308

 Score =  233 bits (593), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 121/301 (40%), Positives = 173/301 (57%), Gaps = 15/301 (4%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RG+   +  L  +TW R GG A+V+FQP D+ DL  FL+ LPSD+P+  +G+GSN++VR
Sbjct: 8   VRGRLTPDRSLDDLTWLRVGGPADVLFQPADVEDLADFLSALPSDVPVFPMGVGSNLIVR 67

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GIRGVV+RL   GF+ IE+ +  ++  GA      +A  A   G+    F   IPGSI
Sbjct: 68  DGGIRGVVIRLGR-GFNGIEI-DGLKVTAGAAALDVHVARRAADAGV-DLTFLRTIPGSI 124

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAG      +        + R G    +    L++ YR +E+ +  ++   VL+
Sbjct: 125 GGAVRMNAGCYGSYVADVFESATVVLRDGTIKTLSANDLQFAYRQTELPQGAVLISAVLK 184

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLIE 244
           G       ++  +A     R+  QP K++T GSTF+NP G S            AW++I+
Sbjct: 185 GVAGDAETLNDRMAAQLAKRDETQPTKDRTAGSTFRNPAGFSSTGRADDSQELKAWKVIQ 244

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            +G RG   GGA ++E+H NF+ NA  AT  DLE LGE VRKKV++ SGI LEWEI R+G
Sbjct: 245 DAGMRGAIRGGAVMNEMHANFLTNAGGATAADLEGLGEDVRKKVYDSSGITLEWEIMRVG 304

Query: 305 D 305
           +
Sbjct: 305 E 305


>gi|86137676|ref|ZP_01056253.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Roseobacter sp.
           MED193]
 gi|85826011|gb|EAQ46209.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Roseobacter sp.
           MED193]
          Length = 314

 Score =  231 bits (589), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 124/317 (39%), Positives = 177/317 (55%), Gaps = 15/317 (4%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPIT 65
           +S L  +    +RG+  EN  L  +TW R GG A+ +FQP D+ DL++FL  LP+++ + 
Sbjct: 1   MSELKTKTMPSVRGRLTENRSLSDLTWLRVGGAADYLFQPADVEDLRHFLAELPAEVVVF 60

Query: 66  IVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGG 125
            +G+GSN++VRD G+R VV+RL   GF+ IE  N  ++  GA      +A  A   G+  
Sbjct: 61  PMGVGSNLIVRDGGLRAVVVRLGR-GFNAIET-NGNQVTAGAAALDAHVARKAADAGLD- 117

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT 185
             F   IPGSIGGA  MNAG      + + V    + R+G    I  E+L++QYR + + 
Sbjct: 118 LTFLRTIPGSIGGAVRMNAGCYGSYIADHFVSAQIVTRQGELRQITAEELQFQYRQTALP 177

Query: 186 KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------- 238
           +  ++    LR        + A +      R+  QP KE++ GSTF+NP G S       
Sbjct: 178 EGAVLVSACLRAEVAEPEALHARMEAQLKKRDETQPTKERSAGSTFRNPAGFSSTGRADD 237

Query: 239 -----AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSG 293
                AW++I+ +G RG   GGA++SE H NFMIN   AT  DLE LGE VRKKV+  SG
Sbjct: 238 VQDLKAWKVIDDAGLRGARIGGAQMSEKHSNFMINTGGATAADLETLGEDVRKKVYANSG 297

Query: 294 ILLEWEIKRLGDFFDHQ 310
           I L+WEI R+G+    Q
Sbjct: 298 IELQWEIMRVGEPLLEQ 314


>gi|259419210|ref|ZP_05743127.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Silicibacter sp.
           TrichCH4B]
 gi|259345432|gb|EEW57286.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Silicibacter sp.
           TrichCH4B]
          Length = 308

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 120/301 (39%), Positives = 170/301 (56%), Gaps = 15/301 (4%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RG+   N  L  +TW R GG A+ +FQP D+ DL+ FL  LP+D+ +  +G+GSN++VR
Sbjct: 7   VRGRLTPNRDLSDLTWLRVGGPADYLFQPADLEDLQSFLRDLPADVDVFPMGVGSNLIVR 66

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+R VV+RL   GF+ IEV     +  GA      +A  +   G+    F   IPGSI
Sbjct: 67  DGGLRAVVIRLGR-GFNTIEVEGET-VTAGAAALDAHVARKSAEAGVD-LTFLRTIPGSI 123

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAG      +   V    + R G+  ++  + L +QYR +++ +  ++    LR
Sbjct: 124 GGAVRMNAGCYGSYVADVFVSAQVVLRDGSLKMLTADDLNFQYRQTDLPEGAVLVSATLR 183

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLIE 244
           G     + ++  +      R+  QP KE++ GSTF+NP G S            AW++I+
Sbjct: 184 GPEGDPDALATRMEEQLRKRDESQPTKERSAGSTFRNPAGFSSTGKADDVMDLKAWKVID 243

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            +G RG   GGA++S  H NFMINA  AT  DLE LGE VRKKV+  SGI LEWEI R+G
Sbjct: 244 NAGLRGATLGGAQMSVKHSNFMINAGGATAADLEGLGENVRKKVYADSGIWLEWEIMRVG 303

Query: 305 D 305
           D
Sbjct: 304 D 304


>gi|148284351|ref|YP_001248441.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Orientia
           tsutsugamushi str. Boryong]
 gi|187609733|sp|A5CD21|MURB_ORITB RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|146739790|emb|CAM79665.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Orientia
           tsutsugamushi str. Boryong]
          Length = 303

 Score =  230 bits (587), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 129/292 (44%), Positives = 180/292 (61%), Gaps = 4/292 (1%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
           ++ G++++NF L Q+TWF+ GG ++V ++P+D  DL  FL  L  DI IT++G GSN+L+
Sbjct: 9   KINGEYRKNFKLSQLTWFKVGGISQVFYKPKDEEDLSCFLKNLQFDIQITVLGAGSNLLI 68

Query: 76  RDAGIRGVVLRLSNAGFSNIEV--RNHCEMI-VGARCSGKSLANSALRHGIGGFHFFYGI 132
           RD GI GV ++L  + F+ I     NH  +I VGA      +A   L+H +GG  F  GI
Sbjct: 69  RDNGIDGVTIKLGRS-FNEINFVKNNHYNIISVGAGTLNYDVAKFCLQHNLGGLEFLVGI 127

Query: 133 PGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITH 192
           PG+IGG   MNAGA   E    V  V  +DR GN+H+   + L ++YR   +   LI T 
Sbjct: 128 PGTIGGGIAMNAGAYGQEFKDVVYSVEALDRLGNKHIFLSKDLNFEYRQCIVNGFLIFTK 187

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
             L  + +S+  IS  +  +   R+  QPI +KT GS F+N   + AWQLI+K G RG  
Sbjct: 188 TNLICYNDSKTSISQKLQKIQTVRKLTQPINQKTAGSAFRNTNNYKAWQLIDKVGLRGHS 247

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            GGA++S LHCNF+IN  NAT  D+E LGE +RK VF+ +GI LEWEIK +G
Sbjct: 248 IGGAQVSNLHCNFLINNGNATASDIENLGELIRKNVFDHTGITLEWEIKIVG 299


>gi|83942738|ref|ZP_00955199.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sulfitobacter sp.
           EE-36]
 gi|83846831|gb|EAP84707.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sulfitobacter sp.
           EE-36]
          Length = 309

 Score =  228 bits (582), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 118/302 (39%), Positives = 167/302 (55%), Gaps = 15/302 (4%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
            +RGK  +N PL  +TW R GG A+  +QP D  DL  F+T LP+D+ +  +G+GSN++V
Sbjct: 10  DMRGKLTQNRPLADLTWLRVGGPADYFYQPADADDLAAFMTALPADVVVMPMGVGSNVIV 69

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD G+R VV+RL   GF+ I   +   +  GA      +A  A   G+    F   IPGS
Sbjct: 70  RDGGLRAVVIRLGR-GFNTISCEDGI-VTAGAAALDAHVARKAADAGLD-LTFLRTIPGS 126

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           IGGA  MNAG     T+ Y +    I R G +  +  E L++ YR + +    +IT    
Sbjct: 127 IGGAVRMNAGCYGAYTADYFISADAITRTGEKVTLGPEDLQFAYRQTALPDGYVITAARF 186

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLI 243
                    + A + +    R+  QP K+++ GSTF+NP G S            AW++I
Sbjct: 187 APPKGEAEALHARMEDQLRKRDETQPTKDRSAGSTFRNPAGFSSTGQADDRHDLKAWKVI 246

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           + +G RG   GGA++S  H NF+IN  +AT  DLE LGE VRKKV++ SGI LEWEI R+
Sbjct: 247 DDAGLRGATLGGAQMSPKHPNFLINTGSATAADLEALGEMVRKKVYDSSGITLEWEIMRI 306

Query: 304 GD 305
           G+
Sbjct: 307 GE 308


>gi|83953977|ref|ZP_00962698.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sulfitobacter sp.
           NAS-14.1]
 gi|83841922|gb|EAP81091.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sulfitobacter sp.
           NAS-14.1]
          Length = 309

 Score =  227 bits (579), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 118/302 (39%), Positives = 167/302 (55%), Gaps = 15/302 (4%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
            +RGK  +N PL  +TW R GG A+  +QP D  DL  F+  LP+D+ I  +G+GSN++V
Sbjct: 10  DMRGKLTQNRPLADLTWLRVGGPADYFYQPADADDLAAFMQALPADVVIMPMGVGSNVIV 69

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD G+R VV+RL   GF+ I   +   +  GA      +A  A   G+    F   IPGS
Sbjct: 70  RDGGLRAVVIRLGR-GFNTISCEDGI-VTAGAAALDAHVARKAADAGLD-LTFLRTIPGS 126

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           IGGA  MNAG     T+ Y +    I R G +  +  + L++ YR S +    +IT    
Sbjct: 127 IGGAVRMNAGCYGAYTADYFISADAITRTGEKVTLGPDDLQFAYRQSALPDGYVITAARF 186

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLI 243
                +   + A + +    R+  QP K+++ GSTF+NP G S            AW++I
Sbjct: 187 APPKGAAQALHARMEDQLRKRDETQPTKDRSAGSTFRNPAGFSSTGQADDRHDLKAWKII 246

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           + +G RG   GGA++S  H NF+IN  +AT  DLE LGE VRKKV++ SGI LEWEI R+
Sbjct: 247 DDAGLRGATLGGAQMSPKHPNFLINTGSATAADLEALGEMVRKKVYDSSGITLEWEIMRI 306

Query: 304 GD 305
           G+
Sbjct: 307 GE 308


>gi|254511412|ref|ZP_05123479.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodobacteraceae
           bacterium KLH11]
 gi|221535123|gb|EEE38111.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodobacteraceae
           bacterium KLH11]
          Length = 308

 Score =  226 bits (577), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 118/300 (39%), Positives = 170/300 (56%), Gaps = 15/300 (5%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRD 77
           RG+  EN PL  +TW R GG A+ +FQP D  DL+ FL  LP+D P+  +G+GSN++VRD
Sbjct: 8   RGRLTENRPLNDLTWLRVGGPADYLFQPADTEDLQAFLRDLPADTPVFPMGVGSNLIVRD 67

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G+R VV+RL   GF+ I +  +  +  GA      +A  A   G+    F   IPGS+G
Sbjct: 68  GGLRAVVIRLGR-GFNGIAIDGNT-VTAGAAALDAHVARKAADAGV-DLTFLRTIPGSVG 124

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRG 197
           GA  MNAG     T+  + +   + R+G    +  E L ++YR +++ +  ++      G
Sbjct: 125 GAVRMNAGCYGSYTADVLQKASIVTRQGEIKDLTPEDLNFRYRQTDLPEGAVLISATFEG 184

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLIEK 245
                  + A +A     R+  QP K+++ GSTF+NP G S            AW++I+ 
Sbjct: 185 PKGDPAELHARMAAQLKKRDETQPTKDRSAGSTFRNPAGFSSTGKADDVHDLKAWKVIDD 244

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +G RG   GGA++S  H NF+IN  +AT  DLE LGE+VRKKV+  SGI LEWEI R+GD
Sbjct: 245 AGMRGATKGGAQMSPKHSNFLINTGDATAADLEGLGEEVRKKVYETSGITLEWEIMRVGD 304


>gi|149914531|ref|ZP_01903061.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Roseobacter sp.
           AzwK-3b]
 gi|149811324|gb|EDM71159.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Roseobacter sp.
           AzwK-3b]
          Length = 306

 Score =  226 bits (576), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 118/302 (39%), Positives = 167/302 (55%), Gaps = 15/302 (4%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
           + RGK  EN  L  +TW R GG A+ +FQP DI DL  FL  L  D+ +  +G+GSN++V
Sbjct: 5   ETRGKLTENRSLSDLTWLRVGGPADWLFQPADIDDLAGFLAALDRDVSVFPMGVGSNLIV 64

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD G+R VV+RL   GF+ I++ +   +  GA      +A  A + G+    F   IPGS
Sbjct: 65  RDGGLRAVVIRLGR-GFNQIDI-DGSRVTAGAAALDAHVARKAAQAGLD-LTFLRTIPGS 121

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           IGGA  MNAG     T+   V    + R G    +  E L + YR +++    ++     
Sbjct: 122 IGGAVRMNAGCYGTYTADRFVSARAVSRDGQIVTLQAEDLNFGYRHTDLPDGWVLVEATF 181

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLI 243
                    + A +      R+  QP K++T GSTF+NP+GHS            AW++I
Sbjct: 182 EAPSGDPAALQARMDEQLAKRDATQPTKDRTAGSTFRNPSGHSSTGRADDVHDFKAWKVI 241

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           + +G RG   GGA++SE+H NF++N  NAT  DLE LGE+VRK+VF  SGI L WEI R+
Sbjct: 242 DDAGMRGARRGGAQMSEMHSNFLVNTGNATAADLEGLGEEVRKRVFQNSGIELHWEIMRV 301

Query: 304 GD 305
           G+
Sbjct: 302 GE 303


>gi|114327091|ref|YP_744248.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Granulibacter
           bethesdensis CGDNIH1]
 gi|122327927|sp|Q0BV27|MURB_GRABC RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|114315265|gb|ABI61325.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Granulibacter
           bethesdensis CGDNIH1]
          Length = 309

 Score =  226 bits (576), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 115/293 (39%), Positives = 167/293 (56%), Gaps = 3/293 (1%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRG+     PL   TWFR GG AE +F+P D  DL      + + +P+TI+G  SN+++R
Sbjct: 15  LRGRVTHAAPLAPQTWFRVGGQAETLFRPADTDDLCTLQRRVSNLVPMTIIGAASNLIIR 74

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ G+ ++L   GF+ I       MI GA     ++A  A + G+ G  F  GIPG+I
Sbjct: 75  DGGLPGITVKLGR-GFNEITTDGD-GMIAGAAALDATVAEHAAQAGLAGLEFLCGIPGTI 132

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGA   + +  +  V  +   G+   +   +L   YR + +     +    LR
Sbjct: 133 GGAIAMNAGAYGSDIASVLDWVE-LALDGDIARLEASRLSLSYRHAALPPGCAVVRARLR 191

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
             P +   I A + ++   R+  QP++ +TGGSTF+NP G  AW+LI+ +GCRGL  GGA
Sbjct: 192 TRPGNTADIIARMQDIRAARDAAQPVRARTGGSTFRNPDGQKAWELIDAAGCRGLSRGGA 251

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDH 309
           ++SE HCNF++N   AT  DLE LGE++R++V    G  L WEIKR+G  F H
Sbjct: 252 QVSEKHCNFLLNTGEATAADLEALGEEIRQRVQASCGTTLHWEIKRIGIPFHH 304


>gi|254486726|ref|ZP_05099931.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Roseobacter sp.
           GAI101]
 gi|214043595|gb|EEB84233.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Roseobacter sp.
           GAI101]
          Length = 316

 Score =  225 bits (574), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 121/305 (39%), Positives = 169/305 (55%), Gaps = 21/305 (6%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
            +RGK     PL ++TW R GG A+ ++QP D  DL  F+  +P DI I  +G+GSN++V
Sbjct: 17  DMRGKLTPQRPLNELTWLRVGGAADYLYQPADAEDLAAFMRAVPQDIAIFPMGVGSNLIV 76

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD G+R VV+RL   GF+ IE+     +  GA      +A  A   G+    F   IPGS
Sbjct: 77  RDGGLRAVVIRLGR-GFNGIEISGD-RVTAGAAALDAHVARKAADAGLD-LTFLRTIPGS 133

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           IGGA  MNAG     T+ + V    I R G+   +  E L++QYR + +    +I     
Sbjct: 134 IGGAVRMNAGCYGSYTADHFVSAEAITRAGDYITLTAEDLQFQYRQTALEDGCVIVSATF 193

Query: 196 ---RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AW 240
              +G PE    + + +      R+  QP K+++ GSTF+NP G S            AW
Sbjct: 194 HPPKGEPEE---LHSRMEEQLRKRDETQPTKDRSAGSTFRNPAGFSSTGEADDSHALKAW 250

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           ++I+ +G RG   GGA++S  H NF+IN  NAT  DLE LGE VRKKV++ SGI LEWEI
Sbjct: 251 KVIDDAGMRGATIGGAQMSPKHPNFLINTGNATAADLEALGEDVRKKVYDSSGITLEWEI 310

Query: 301 KRLGD 305
            R+G+
Sbjct: 311 MRIGE 315


>gi|114766764|ref|ZP_01445701.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Pelagibaca
           bermudensis HTCC2601]
 gi|114541021|gb|EAU44078.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Roseovarius sp.
           HTCC2601]
          Length = 314

 Score =  225 bits (574), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 120/302 (39%), Positives = 171/302 (56%), Gaps = 15/302 (4%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
            +RG+   N  L  +TW R GG A+V+FQP D+ DL+ FL  LP +  +  +G+GSN++V
Sbjct: 12  DVRGRLTPNRDLSALTWLRVGGPADVLFQPADLEDLQQFLRALPPEREVFPMGVGSNLIV 71

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD G+R VV+RL   GF+ IE+ +   + VGA       A  A   G+    F   IPGS
Sbjct: 72  RDGGLRAVVIRLGR-GFNGIEI-DGTRVTVGAAMLDAQAAKRAAAEGVD-LTFLRTIPGS 128

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           IGGA  MNAG      + +++E+  + R G+   + ++ LK  YR SE+ +  +I   V 
Sbjct: 129 IGGAVRMNAGCYGTYVADHLIEIRAVTRAGDLVTLSKDALKLGYRHSELPEGCVIVEAVF 188

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLI 243
            G       ++A +      R+  QP K++T GSTF+NP G S            AW++I
Sbjct: 189 EGTTGDAEELAARMDAQVKKRDETQPTKDRTAGSTFRNPAGFSSTGREDDVHDLKAWKVI 248

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           + +G RG   GGA++S  H NF++N   AT  DLE LGE+VRKKVF  SGI L WEI R+
Sbjct: 249 DDAGMRGATLGGAQMSPKHSNFLVNTGEATAADLEGLGEEVRKKVFQDSGIELHWEIMRV 308

Query: 304 GD 305
           G+
Sbjct: 309 GE 310


>gi|254461318|ref|ZP_05074734.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodobacterales
           bacterium HTCC2083]
 gi|206677907|gb|EDZ42394.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 307

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 120/301 (39%), Positives = 169/301 (56%), Gaps = 15/301 (4%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RGK   + PL  +TW R GG AE+ FQP D  DL+ FL  LP +  +  +G+GSN++VR
Sbjct: 7   VRGKITMDRPLADLTWLRVGGPAEMFFQPVDKDDLQSFLKALPIETSVFPMGVGSNLIVR 66

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GI+G V+R+   GF++IEV     M VG       +A  A   G+    F   IPG+I
Sbjct: 67  DGGIKGAVIRMGR-GFNHIEVEGET-MRVGVAALDAHVARKAADAGLD-LTFLRTIPGAI 123

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAG      + + V+   + R G +  I  ++L++ YR S + +  ++T VVLR
Sbjct: 124 GGAVRMNAGCYGSYVADHFVQATAVTRAGEEVRISTDELEFAYRQSSLPEGYVLTEVVLR 183

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLIE 244
                   + A +      R+  QP K++T GSTF+NP G S            AW++I+
Sbjct: 184 AERGDPETLHARMEEQLRKRDETQPTKDRTAGSTFRNPAGFSSTGQADDTHELKAWKVID 243

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            +G RG  FGGA++S  H NF+IN   AT  DLE LGE VRKKVF    I L+WE+ R+G
Sbjct: 244 DAGMRGATFGGAQMSTKHPNFLINTGGATAADLEGLGEMVRKKVFQTQSIELDWEVLRIG 303

Query: 305 D 305
           +
Sbjct: 304 E 304


>gi|310814885|ref|YP_003962849.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Ketogulonicigenium
           vulgare Y25]
 gi|308753620|gb|ADO41549.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Ketogulonicigenium
           vulgare Y25]
          Length = 310

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 118/302 (39%), Positives = 167/302 (55%), Gaps = 14/302 (4%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
            +RG    + PL  +TW R GG A+ +FQP D  DL  FL+ LP+D+P+  +G+GSN++V
Sbjct: 6   SVRGTLTADRPLGDLTWMRVGGPADWLFQPADHDDLADFLSALPADVPVFTMGVGSNLIV 65

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD G+RGVV+R+   GF+ I +     +  GA      +A  A   G+    F   IPG+
Sbjct: 66  RDGGMRGVVIRMGR-GFNGITIEEGGVVRAGAAALDSFVARKAADAGL-DLTFLRTIPGT 123

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           IGGA  MNAG      +  ++EV  I R G + VI  + L   YR S +    ++   V 
Sbjct: 124 IGGAVAMNAGCYGQYVADRLIEVTVITRTGERQVIAAKGLGLAYRQSALPDGAVVVEAVF 183

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLI 243
                +   + A +      R+  QP K++T GSTF+NP G S            AW+LI
Sbjct: 184 NAPAAAPEDLHATMDAQLKKRDETQPSKDRTAGSTFRNPAGFSSTGKADDVHDLKAWKLI 243

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           + +G RG   GGA ++  H NF+ NA  A+  DLE LGE+VRK V++ SGI LEWEIKR+
Sbjct: 244 DDAGMRGATLGGAIMNPKHANFLTNAGGASAADLEGLGERVRKAVYDASGITLEWEIKRV 303

Query: 304 GD 305
           G+
Sbjct: 304 GE 305


>gi|148259086|ref|YP_001233213.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acidiphilium cryptum
           JF-5]
 gi|326402237|ref|YP_004282318.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acidiphilium
           multivorum AIU301]
 gi|166222821|sp|A5FUL2|MURB_ACICJ RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|146400767|gb|ABQ29294.1| UDP-N-acetylmuramate dehydrogenase [Acidiphilium cryptum JF-5]
 gi|325049098|dbj|BAJ79436.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acidiphilium
           multivorum AIU301]
          Length = 309

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 124/290 (42%), Positives = 175/290 (60%), Gaps = 2/290 (0%)

Query: 15  KQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNIL 74
            ++RG+   + PL  +TWFR GG AEVMF+P DI DL  FL  L  ++P+  +G  SN++
Sbjct: 15  PEVRGRIGFDVPLGPVTWFRVGGPAEVMFRPADIEDLSRFLAALAPEVPVLPIGAASNLI 74

Query: 75  VRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPG 134
           VRD GI GVV+RL   GF++IEV+    ++ GA     ++A  A   G+ G  F  GIPG
Sbjct: 75  VRDGGIAGVVVRLVR-GFADIEVQPDG-IVAGAAALDATIAEHAAAAGLTGLEFLSGIPG 132

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVV 194
           S+GGA  MNAGA   E    +     + R G         L   YR + + +  I+    
Sbjct: 133 SLGGAVAMNAGAYGAEIRDVLDWAEIVGRDGTVARYAAGDLALTYRHARLPEGGIVVRAR 192

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
           L   P     I+A +A++   RE  QP++ +TGGSTF+NP G  AW+LI+++GCRGL  G
Sbjct: 193 LHARPGEAAAIAARMADIRASREATQPVRARTGGSTFRNPEGDKAWRLIDEAGCRGLIHG 252

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           GA++SE HCNF+IN   AT  D+E LGE VR++V  ++G+ L WEI+R+G
Sbjct: 253 GAQVSEKHCNFLINLGEATAADIEGLGETVRRRVRERTGVELIWEIRRVG 302


>gi|149202201|ref|ZP_01879174.1| UDP-N-acetylenolpyruvoylglucosamine reductase/dehydrogenase
           [Roseovarius sp. TM1035]
 gi|149144299|gb|EDM32330.1| UDP-N-acetylenolpyruvoylglucosamine reductase/dehydrogenase
           [Roseovarius sp. TM1035]
          Length = 311

 Score =  223 bits (567), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 118/302 (39%), Positives = 166/302 (54%), Gaps = 15/302 (4%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
           Q RG    + PL  +TW R GG A+ +FQP D+ DL  FL  L   +P+  +G+GSN++V
Sbjct: 3   QTRGALTPDRPLADLTWLRVGGPADWLFQPADLDDLAGFLAGLDPSLPVFPMGVGSNLIV 62

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD G+  VV+RL   GF++I V     +I GA      +A  A   G+    F   IPGS
Sbjct: 63  RDGGVHAVVIRLGR-GFNSIRVEG-SRVIAGAAALDAHVARRAAEAGVD-LTFLRTIPGS 119

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           IGGA  MNAG      + +++E   + R G    +  + L + YR S +    +I     
Sbjct: 120 IGGAVRMNAGCYGAYVADHLIEAKAVTRGGEVVTLAHDALHFAYRHSAVPDGWVIVEATF 179

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLI 243
            G     + + A +A+    R+  QP KE++ GSTF+NP G S            AW++I
Sbjct: 180 EGGLGDPSALEAKMADQIAKRDATQPTKERSAGSTFRNPAGFSSTGRADDVHDLKAWKVI 239

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           +++G RG   GGA++SE+H NF+IN   A+  DLE LGE VRKKVF   GI LEWEI R+
Sbjct: 240 DEAGLRGTRRGGAQMSEMHPNFLINTGGASAADLEGLGEDVRKKVFQMRGIELEWEIMRV 299

Query: 304 GD 305
           G+
Sbjct: 300 GE 301


>gi|84686343|ref|ZP_01014237.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84665526|gb|EAQ12002.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodobacterales
           bacterium HTCC2654]
          Length = 309

 Score =  222 bits (565), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 119/302 (39%), Positives = 167/302 (55%), Gaps = 15/302 (4%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
           + RG   EN  L  +TW R GG A+ +FQP D  DL  FL  L   +P+  +G+GSN++V
Sbjct: 7   ETRGTLTENRDLASLTWMRVGGPADWLFQPADEDDLAAFLRDLDPSVPVFPMGVGSNLIV 66

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD GIRGVV+RL   GF+ I+++    +  GA      +A  A   G+    F   IPG+
Sbjct: 67  RDGGIRGVVVRLGR-GFNGIDIQGTT-VTAGAAALDAHVARKAAEAGVD-LTFLRTIPGT 123

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           IGGA  MNAG     T         I R G    +  E L ++YR S++ + +I+T   L
Sbjct: 124 IGGAVRMNAGCYGSYTGDVFQSARAITRSGEVVTLMSEDLNFRYRQSDVPEGMILTSATL 183

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLI 243
           RG   +   ++A +      R+  QP K++T GSTF+NP G S            AW++I
Sbjct: 184 RGGEGAPEELAARMEAQLAKRDETQPTKDRTAGSTFRNPAGFSSTGREDDTHELKAWKVI 243

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           + +G RG   GGA+++  H NF+ N   AT  DLE LGE+VRKKV+  SG+ LEWEI R+
Sbjct: 244 DDAGMRGAVIGGAQMNMKHSNFLTNTGGATAQDLESLGEEVRKKVYETSGLTLEWEIMRV 303

Query: 304 GD 305
           G+
Sbjct: 304 GE 305


>gi|56416852|ref|YP_153926.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Anaplasma marginale
           str. St. Maries]
 gi|222475217|ref|YP_002563633.1| UDP-N-acetylenolpyruvoylglucosamine reductase (murB) [Anaplasma
           marginale str. Florida]
 gi|254995041|ref|ZP_05277231.1| UDP-N-acetylenolpyruvoylglucosamine reductase (murB) [Anaplasma
           marginale str. Mississippi]
 gi|255003193|ref|ZP_05278157.1| UDP-N-acetylenolpyruvoylglucosamine reductase (murB) [Anaplasma
           marginale str. Puerto Rico]
 gi|255004323|ref|ZP_05279124.1| UDP-N-acetylenolpyruvoylglucosamine reductase (murB) [Anaplasma
           marginale str. Virginia]
 gi|269958733|ref|YP_003328520.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Anaplasma centrale
           str. Israel]
 gi|81359049|sp|Q5PAK9|MURB_ANAMM RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|254764129|sp|B9KIR5|MURB_ANAMF RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|56388084|gb|AAV86671.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Anaplasma marginale
           str. St. Maries]
 gi|222419354|gb|ACM49377.1| UDP-N-acetylenolpyruvoylglucosamine reductase (murB) [Anaplasma
           marginale str. Florida]
 gi|269848562|gb|ACZ49206.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Anaplasma centrale
           str. Israel]
          Length = 299

 Score =  222 bits (565), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 117/306 (38%), Positives = 177/306 (57%), Gaps = 12/306 (3%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M YG ++  L     +++G ++    +   TWF  GG AEV+F+P  + DL  F+    +
Sbjct: 1   MSYGFVAYNL----PKVQGTYRRGVKMHNATWFNVGGVAEVVFKPSSVEDLAAFVR--DT 54

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSG--KSLANSA 118
           ++PI++VG+ SN++VRD  ++GVV++L    FS I    +   I+ A C+    +LA +A
Sbjct: 55  NLPISVVGVASNLIVRDGIVKGVVVKLGRE-FSYINCNGN---IITAGCATLLSNLAVAA 110

Query: 119 LRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQ 178
              GI G  FF GIPG++GGA  MNAGA   + +  +  V  ++  G    +  + ++Y 
Sbjct: 111 QESGISGLEFFVGIPGTVGGAIEMNAGAYGGDVASVLRSVRAVNEHGEICTLSNDDMRYS 170

Query: 179 YRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           YR   +    I       G    ++ I   +      R   QP++ +TGGSTFKNP GH 
Sbjct: 171 YREHGLVGKWIFVDATFVGACGDRDAIKGTMREFIARRNDSQPVRGRTGGSTFKNPEGHQ 230

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           AW+LI+K+GCRGL+ GGA++SE HCNF++N   AT  DLE LG ++R +V +  GI LEW
Sbjct: 231 AWELIDKAGCRGLQIGGAQVSEKHCNFLLNCGGATAKDLEDLGNEIRCRVHSMFGIKLEW 290

Query: 299 EIKRLG 304
           EI+ LG
Sbjct: 291 EIRFLG 296


>gi|294085899|ref|YP_003552659.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292665474|gb|ADE40575.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 309

 Score =  219 bits (559), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 116/297 (39%), Positives = 162/297 (54%), Gaps = 6/297 (2%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           L  R  ++RG +     +   TWF  GG A+V+F P D  DL +FL    +DIPI  +G 
Sbjct: 4   LITRLPKVRGDYAMKDAMSAHTWFGVGGPADVIFSPVDEDDLSHFLAHCDADIPILPIGA 63

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSG--KSLANSALRHGIGGFH 127
           GSN+LVRD G+ GVV++L++    +++  +H   +V A+       +A  A + G+ G  
Sbjct: 64  GSNLLVRDGGVSGVVIKLTD----HMKHIHHDGTVVTAQTGALDAEVARYASKAGLTGLE 119

Query: 128 FFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD 187
           F  GIPG++GG   MNAGA   E     +  HG DR GN       ++   YR S+   D
Sbjct: 120 FLIGIPGTVGGGLRMNAGAYGSEFKDITMIAHGFDRAGNPISATPTEMGMAYRHSDAPAD 179

Query: 188 LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSG 247
            I T   ++  P     I   +  +   R   QP   +TGGSTF NP G  AWQ I+++G
Sbjct: 180 WIFTSASMQARPGDHAAIRTRMKEIVTSRGDAQPRGVRTGGSTFANPDGGKAWQEIDRAG 239

Query: 248 CRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           CRGL  G A++SE HCNF+IN   AT  ++E LGE VR +V    G  L WEI+R+G
Sbjct: 240 CRGLAVGAAQVSEKHCNFLINNGGATAEEIETLGETVRARVLASGGPDLRWEIRRIG 296


>gi|126741303|ref|ZP_01756981.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Roseobacter sp.
           SK209-2-6]
 gi|126717621|gb|EBA14345.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Roseobacter sp.
           SK209-2-6]
          Length = 308

 Score =  219 bits (558), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 118/301 (39%), Positives = 167/301 (55%), Gaps = 15/301 (4%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RGK   +  L  +TW R GG A+ +FQP DI DL+ FL  LP+++ +  +G+GSN++VR
Sbjct: 6   IRGKLTPSRDLSGLTWLRVGGPADYLFQPADIEDLRNFLRQLPAEVQVFPMGVGSNLIVR 65

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+R VV+RL   GF+ IE + +  +  GA      +A  A   G+    F   IPGSI
Sbjct: 66  DGGLRAVVIRLGR-GFNGIECQGNT-VTAGAAALDAHVAKKAADAGLD-LTFLRTIPGSI 122

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAG      + + V    + R G    +  E L++QYR +      ++     R
Sbjct: 123 GGAVRMNAGCYGSYVADHFVSAQIVTRSGELLELGAEDLQFQYRQTTFPDGAVLVSATFR 182

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLIE 244
             P   + + + +      R+  QP K++T GSTF+NP G S            AW++I+
Sbjct: 183 AEPGEPDELHSRMDAQLKKRDETQPTKDRTAGSTFRNPAGFSSTGRVDDVQDLKAWKVID 242

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            SG RG   GGA++SE H NF+IN   AT  DLE LGE+VRKKV+  SGI L WEI R+G
Sbjct: 243 NSGMRGARIGGAQMSEKHSNFLINTGGATAADLEALGEEVRKKVYEDSGITLIWEIMRVG 302

Query: 305 D 305
           +
Sbjct: 303 E 303


>gi|221638519|ref|YP_002524781.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodobacter
           sphaeroides KD131]
 gi|254765557|sp|B9KNK2|MURB_RHOSK RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|221159300|gb|ACM00280.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodobacter
           sphaeroides KD131]
          Length = 308

 Score =  219 bits (558), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 117/302 (38%), Positives = 168/302 (55%), Gaps = 15/302 (4%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RG   E   L  +TW R GG A+ +FQP D  DL+ FL  L   +P+  +G+GSN++VR
Sbjct: 5   VRGTLTEGRILADLTWLRVGGPADWLFQPADEADLEQFLAALDPAVPVFPMGVGSNLIVR 64

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+R VV+RL   GF+ I +     +I GA      +A  A   G     F   IPGSI
Sbjct: 65  DGGLRAVVIRLGR-GFNAIRIEGD-RVIAGAAALDAHVARRAADAGRD-LTFLRTIPGSI 121

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAG      + +++EV  + R+G   ++P  +L   YR S + +  ++T    R
Sbjct: 122 GGAVRMNAGCYGSYVADHLIEVRAVTREGRAVILPAAELGLAYRQSALPEGCVLTEATFR 181

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLIE 244
                   ++  +      R++ QP +E++ GSTF+NP G S            AW+LI+
Sbjct: 182 AEAGDPAELARRMEEQIARRDSSQPTRERSAGSTFRNPAGFSSTGRADDTHELKAWKLID 241

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           ++G RG   GGA++SE+H NF+IN   AT  DLE LGE+V K+VF  SGI LEWEI R+G
Sbjct: 242 EAGMRGARRGGAQMSEMHSNFLINTGGATAADLEGLGEEVIKRVFQSSGIRLEWEIMRVG 301

Query: 305 DF 306
           + 
Sbjct: 302 EL 303


>gi|114773357|ref|ZP_01450561.1| UDP-N-acetylenolpyruvoylglucosamine reductase [alpha
           proteobacterium HTCC2255]
 gi|114546291|gb|EAU49202.1| UDP-N-acetylenolpyruvoylglucosamine reductase [alpha
           proteobacterium HTCC2255]
          Length = 311

 Score =  219 bits (557), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 119/301 (39%), Positives = 174/301 (57%), Gaps = 14/301 (4%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RG    N  +  ++W + GG A+ ++QP D  DL  FL+  P +IP+ I+G+ SN++VR
Sbjct: 9   VRGTIVANRLMSDLSWLKVGGMADYLYQPADKDDLSNFLSNTPKNIPVFIIGVCSNLIVR 68

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GIRGVV++L   GF+NI++ ++ ++ VGA      +A  A   GI    F   IPG+I
Sbjct: 69  DGGIRGVVIKLGR-GFNNIDILDNNKISVGAAALDSHVARKAADVGID-LTFLRTIPGTI 126

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAG               + R+G    + +E + + YRSSEI K  IIT+V+L+
Sbjct: 127 GGAVKMNAGCYGSYIEDVFESASVVTREGKLITLNKEDMHFDYRSSEIPKGSIITNVILK 186

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLIE 244
           G  ++   +   + +    R   QPI  ++ GSTF+NP+G S            AW++I+
Sbjct: 187 GNHKTSVELKNKMQSALDKRSESQPIDARSCGSTFRNPSGFSSTGKIDDVHDLKAWKVID 246

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            +G  G   GGAK+S  H NFMIN  +AT  DLE LG++V KKV+  SGI LEWEI R+G
Sbjct: 247 NAGMSGASIGGAKMSNKHSNFMINIGDATAADLENLGKEVIKKVYADSGIKLEWEIMRVG 306

Query: 305 D 305
           +
Sbjct: 307 E 307


>gi|260428193|ref|ZP_05782172.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Citreicella sp.
           SE45]
 gi|260422685|gb|EEX15936.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Citreicella sp.
           SE45]
          Length = 309

 Score =  219 bits (557), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 118/302 (39%), Positives = 166/302 (54%), Gaps = 15/302 (4%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
           ++RG+   +  L  +TW R GG A++ FQP D+ DL+ FL  LP    +  +G+GSN++V
Sbjct: 7   EVRGRLVPDRALSDLTWLRVGGPADLFFQPADLADLQAFLAALPPGRAVFPMGVGSNLIV 66

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD GIR VV+RL   GF+ I V +   +  GA      +A  A   G+    F   IPGS
Sbjct: 67  RDGGIRAVVIRLGR-GFNGISV-DGTRVTAGAAALDAHVAKRAAAGGVD-LTFLRTIPGS 123

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           IGGA  MNAG      +  +VEV  + R G    +   +L+  YR SE+ +  +I   + 
Sbjct: 124 IGGAVRMNAGCYGTYVADRLVEVRVVTRDGRLETLSPGELRLAYRQSELPEGWVIVEAIF 183

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLI 243
            G       + A ++     R+  QP K++T GSTF+NP G S            AW++I
Sbjct: 184 EGPAGDTAELEARMSAQLARRDETQPTKDRTAGSTFRNPAGFSSTGREDDSHELKAWKVI 243

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           +++G RG   GGA++S  H NF++N   AT  DLE LGE VRKKVF  SGI L WEI R+
Sbjct: 244 DEAGLRGATLGGAQMSPKHSNFLVNTGEATAADLEGLGEDVRKKVFQHSGIELHWEIMRV 303

Query: 304 GD 305
           G+
Sbjct: 304 GE 305


>gi|77462662|ref|YP_352166.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodobacter
           sphaeroides 2.4.1]
 gi|119369491|sp|Q3J4L9|MURB_RHOS4 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|77387080|gb|ABA78265.1| UDP-N-acetylmuramate dehydrogenase [Rhodobacter sphaeroides 2.4.1]
          Length = 308

 Score =  218 bits (556), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 118/302 (39%), Positives = 167/302 (55%), Gaps = 15/302 (4%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RG   +   L  +TW R GG A+ +FQP D  DL  FL  L   +P+  +G+GSN++VR
Sbjct: 5   VRGTLTQGRSLADLTWLRVGGPADWLFQPADEADLVQFLGALDPAVPVFPMGVGSNLIVR 64

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+R VV+RL   GF+ I +     +I GA      +A  A   G     F   IPGSI
Sbjct: 65  DGGLRAVVIRLGR-GFNAIRIEGD-RVIAGAAALDAHVARHAADAGRD-LTFLRTIPGSI 121

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAG      + +++EV  + R+G    +P  +L   YR S + +  ++T    R
Sbjct: 122 GGAVRMNAGCYGSYVADHLIEVRAVTREGRPVTLPAAELGLAYRQSALPEGCVLTEATFR 181

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLIE 244
                   ++  +      R++ QP KE++ GSTF+NP G S            AW+LI+
Sbjct: 182 AEAGDPAALARRMDEQIARRDSSQPTKERSAGSTFRNPAGFSSTGRADDTHELKAWKLID 241

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           ++G RG   GGA++SE+H NF+INA  AT  DLE LGE+V K+VF  SGI LEWEI R+G
Sbjct: 242 EAGLRGARRGGAQMSEMHSNFLINAGGATAADLEGLGEEVIKRVFQSSGIRLEWEIMRVG 301

Query: 305 DF 306
           + 
Sbjct: 302 EL 303


>gi|254450818|ref|ZP_05064255.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Octadecabacter
           antarcticus 238]
 gi|198265224|gb|EDY89494.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Octadecabacter
           antarcticus 238]
          Length = 311

 Score =  218 bits (555), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 123/302 (40%), Positives = 167/302 (55%), Gaps = 17/302 (5%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RG    N  L  +TW R GG A+V+FQP D  DL+ FLT LP D+P+ ++G+GSN++VR
Sbjct: 9   VRGVLTPNRDLSGLTWMRVGGPADVLFQPADEDDLRSFLTALPLDVPVFVMGVGSNLIVR 68

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+RGVV+RL   GF  IE      +  GA      +A  A   G+    F   IPGSI
Sbjct: 69  DGGVRGVVIRLGR-GFKGIEFDGDL-VRAGAATLDAHVARKAAALGL-NLTFLRTIPGSI 125

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAG      +  + +V  + R G+   +    L  +YRSS + +  +I    L+
Sbjct: 126 GGAVAMNAGCYGHYMADLLQDVRAVMRDGSVQTLAVADLDLKYRSSTLPEGAVIVSATLK 185

Query: 197 GFPES-QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLI 243
              E  Q +    IA +    ET QP K++T GSTF+NP G S            AW++I
Sbjct: 186 AVREDVQTLEDRMIAQLAKRDET-QPTKDRTAGSTFRNPAGFSSTGQADDTHDLKAWKVI 244

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           + +G RG   GGA ++  H NF+ NA  AT  DL  LGE VRKKV+  SG+ LEWEI R+
Sbjct: 245 DDAGMRGATRGGAVMNTKHSNFLTNAGGATAADLIGLGEDVRKKVYETSGLTLEWEIMRV 304

Query: 304 GD 305
           G+
Sbjct: 305 GE 306


>gi|225677335|ref|ZP_03788310.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
 gi|225590621|gb|EEH11873.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
          Length = 295

 Score =  218 bits (554), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 108/292 (36%), Positives = 170/292 (58%), Gaps = 4/292 (1%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
           ++RG ++ +  + + TW   GG A+++F+P+DI DL   +    +++PI ++G  SNI+V
Sbjct: 7   KVRGVYRYDILMSKATWLNVGGRADILFKPRDIEDLTCLIK--NTELPINVIGATSNIIV 64

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD+GIRG++++L    FS I+ + +  ++ G     ++LA  A    IGG  F  GIPG+
Sbjct: 65  RDSGIRGIIVKLGKE-FSYIKSKGNNSIVAGGAALLRNLAYFAGEQQIGGLEFLVGIPGT 123

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGID-RKGNQHVIPREQLKYQYRSSEITKDLIITHVV 194
           +GG   MNAGA   + +  V  +  ++   GN +    E++ Y YR   +  + I     
Sbjct: 124 VGGGIEMNAGAYGSDIASVVQSIKAVNLEDGNLYEFSSEEMGYFYRGHSLKGNWIFVEAE 183

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
            +G      +I   +  V   +   QPI+ KT G  FKNP  + AW+LI+KSGC GL  G
Sbjct: 184 FKGVNSEYELILQRLKEVIERKNKSQPIRGKTAGCIFKNPKNYRAWELIDKSGCLGLNIG 243

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           GA+IS+ HCNF++N DNAT  DLE LG +V+  V ++  + LEWEI+ LG +
Sbjct: 244 GARISKKHCNFLLNYDNATASDLENLGNKVKDAVKDKFNVELEWEIRVLGSY 295


>gi|126461555|ref|YP_001042669.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodobacter
           sphaeroides ATCC 17029]
 gi|166222845|sp|A3PHT1|MURB_RHOS1 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|126103219|gb|ABN75897.1| UDP-N-acetylmuramate dehydrogenase [Rhodobacter sphaeroides ATCC
           17029]
          Length = 308

 Score =  218 bits (554), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 118/302 (39%), Positives = 167/302 (55%), Gaps = 15/302 (4%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RG   +   L  +TW R GG A+ +FQP D  DL  FL  L   +P+  +G+GSN++VR
Sbjct: 5   VRGTLTQGRILADLTWLRVGGPADWLFQPADEADLVQFLGALDPAVPVFPMGVGSNLIVR 64

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+R VV+RL   GF+ I +     +I GA      +A  A   G     F   IPGSI
Sbjct: 65  DGGLRAVVIRLGR-GFNAIRIEGD-RVIAGAAALDAHVARRAAEAGRD-LTFLRTIPGSI 121

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAG      + +++EV  + R+G    +P  +L   YR S + +  ++T    R
Sbjct: 122 GGAVRMNAGCYGSYVADHLIEVRAVTREGRAVTLPAAELGLAYRQSALPEGCVLTEATFR 181

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLIE 244
                   ++  +      R++ QP KE++ GSTF+NP G S            AW+LI+
Sbjct: 182 AEAGDPAELARRMDEQIARRDSSQPTKERSAGSTFRNPAGFSSTGRADDTHELKAWKLID 241

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           ++G RG   GGA++SE+H NF+INA  AT  DLE LGE+V K+VF  SGI LEWEI R+G
Sbjct: 242 EAGLRGARRGGAQMSEMHSNFLINAGGATAADLEGLGEEVIKRVFQSSGIRLEWEIMRVG 301

Query: 305 DF 306
           + 
Sbjct: 302 EL 303


>gi|332557544|ref|ZP_08411866.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodobacter
           sphaeroides WS8N]
 gi|332275256|gb|EGJ20571.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodobacter
           sphaeroides WS8N]
          Length = 308

 Score =  218 bits (554), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 118/302 (39%), Positives = 166/302 (54%), Gaps = 15/302 (4%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RG   E   L  +TW R GG A+ +FQP D  DL  FL  L   +P+  +G+GSN++VR
Sbjct: 5   VRGTLTEGRSLADLTWLRVGGPADWLFQPADEADLVQFLGALDPAVPVFPMGVGSNLIVR 64

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+R VV+RL   GF+ I +     +I GA      +A  A   G     F   IPGSI
Sbjct: 65  DGGLRAVVIRLGR-GFNAIRIEGD-RVIAGAAALDAHVARRAADAGRD-LTFLRTIPGSI 121

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAG      + +++EV  + R+G    +P  +L   YR S + +  ++T    R
Sbjct: 122 GGAVRMNAGCYGSYVADHLIEVRAVTREGRPVTLPAAELGLAYRQSALPEGCVLTEATFR 181

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLIE 244
                   ++  +      R++ QP KE++ GSTF+NP G S            AW+LI+
Sbjct: 182 AEAGDPAELARRMDEQIARRDSSQPTKERSAGSTFRNPAGFSSTGRADDTHELKAWKLID 241

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           ++G RG   GGA++SE+H NF+IN   AT  DLE LGE+V K+VF  SGI LEWEI R+G
Sbjct: 242 EAGLRGARRGGAQMSEMHSNFLINTGGATAADLEGLGEEVIKRVFQSSGIRLEWEIMRVG 301

Query: 305 DF 306
           + 
Sbjct: 302 EL 303


>gi|260434244|ref|ZP_05788215.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260418072|gb|EEX11331.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 308

 Score =  217 bits (553), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 116/300 (38%), Positives = 167/300 (55%), Gaps = 15/300 (5%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRD 77
           RG+      L  +TW R GG A+ +FQP D+ DL+ FL  LP+++P+  +G+GSN++VRD
Sbjct: 8   RGRLTVARALNDLTWLRVGGPADYLFQPADLEDLQAFLRDLPAEVPVFPMGVGSNLIVRD 67

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G+R VV+RL   GF+ I V +   +  GA      +A  A   G+    F   IPGSIG
Sbjct: 68  GGLRAVVIRLGR-GFNGIAV-DGTTVTAGAAALDAHVARKAADAGVD-LTFLRTIPGSIG 124

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRG 197
           GA  MNAG     T+  +     + R+G    +    L ++YR S++ +  ++     +G
Sbjct: 125 GAVRMNAGCYGSYTADVLQSATIVTRQGEVVELTPADLNFRYRQSDLPEGAVLVSATFQG 184

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLIEK 245
                  + A +      R+  QP K+++ GSTF+NP G S            AW++I+ 
Sbjct: 185 PAGDPADLHARMEAQLKKRDETQPTKDRSAGSTFRNPAGFSSTGRADDVHDLKAWKVIDD 244

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +G RG   GGA++S  H NF+IN  NAT  DLE LGE+VRKKV+  SGI LEWEI R+GD
Sbjct: 245 AGMRGARRGGAQMSPKHSNFLINTGNATAADLEGLGEEVRKKVYETSGITLEWEIMRVGD 304


>gi|159044961|ref|YP_001533755.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Dinoroseobacter
           shibae DFL 12]
 gi|187609719|sp|A8LS61|MURB_DINSH RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|157912721|gb|ABV94154.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Dinoroseobacter
           shibae DFL 12]
          Length = 307

 Score =  217 bits (552), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 119/303 (39%), Positives = 167/303 (55%), Gaps = 20/303 (6%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDI--PITIVGLGSNI 73
            LRG   EN PL  +TW R GG A++ FQP D  DL  FL    +D+  P+ ++G+GSN+
Sbjct: 3   DLRGTLTENRPLADLTWLRVGGPADLFFQPADADDLAAFLR---ADLARPVFVMGVGSNL 59

Query: 74  LVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           +VRD G+R  V+RL   GF+ I + +   +  GA      +A  A   G+    F   IP
Sbjct: 60  IVRDGGLRAAVIRLGR-GFNGIRI-DGTRVRAGAAALDAHVARKAAAAGVD-LTFLRTIP 116

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHV 193
           G+IGGA  MNAG      +   VE   + R G    + RE L ++YR S++    +IT V
Sbjct: 117 GTIGGAVAMNAGCYGTYMADVFVEATALTRAGEAITLTREDLNFRYRQSDLPPGTVITEV 176

Query: 194 VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQ 241
           V+ G P +   + A +A+    RE  QP K++T GSTF+NP G S            AW 
Sbjct: 177 VMEGPPGAPEALEARMADQLAKREATQPTKDRTAGSTFRNPAGFSSTGRADDTHEAKAWA 236

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           +I+ +G RG   G A++S  H NF++N   AT  +LE LGE+VRKKVF  +G  L WE+ 
Sbjct: 237 VIDAAGMRGAMRGAAQMSPKHPNFLVNTGGATAAELESLGEEVRKKVFQATGHSLHWEVI 296

Query: 302 RLG 304
           R+G
Sbjct: 297 RIG 299


>gi|163746136|ref|ZP_02153495.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Oceanibulbus
           indolifex HEL-45]
 gi|161380881|gb|EDQ05291.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Oceanibulbus
           indolifex HEL-45]
          Length = 315

 Score =  217 bits (552), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 119/305 (39%), Positives = 171/305 (56%), Gaps = 21/305 (6%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
            LRG+   N  L  +TW R GG A+ +FQP DI DL  F+  LP  + +  +G+GSN++V
Sbjct: 8   DLRGRLTPNRDLSDLTWLRVGGPADYLFQPADIEDLCLFMRRLPQAVSVFPMGVGSNLIV 67

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD G+R VV+RL   GF+ IE+ +   +  GA      +A  A   G+    F   IPGS
Sbjct: 68  RDGGLRAVVIRLGR-GFNGIEIEDD-RVTAGAAALDAHVARKAADAGLD-LTFLRTIPGS 124

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLII---TH 192
           IGGA  MNAG     T+ + V    + R G    +  + L ++YR S+++   ++   T 
Sbjct: 125 IGGALRMNAGCYGTYTADHFVSAQAVTRAGEVVTLTADDLNFRYRQSDLSPGAVLIGATF 184

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AW 240
              +G PE+   + A +      R+  QP K+++ GSTF+NP G S            AW
Sbjct: 185 APPKGEPEA---LHARMEEQLAKRDETQPTKDRSAGSTFRNPAGFSSTGKADDVHDLKAW 241

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           ++I+ +G RG   GGA++S  H NF+IN  +AT  DLE LGE+VRKKV+  SGI LEWEI
Sbjct: 242 KVIDDAGMRGATVGGAQMSPKHSNFLINTGDATANDLETLGEEVRKKVYALSGIGLEWEI 301

Query: 301 KRLGD 305
            R+G+
Sbjct: 302 MRIGE 306


>gi|163741567|ref|ZP_02148958.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Phaeobacter
           gallaeciensis 2.10]
 gi|161385301|gb|EDQ09679.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Phaeobacter
           gallaeciensis 2.10]
          Length = 307

 Score =  216 bits (551), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 119/301 (39%), Positives = 164/301 (54%), Gaps = 15/301 (4%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRGK   N  L  +TW + GG A+ +FQP D+ DL + L  L   +P+  +G+GSN++VR
Sbjct: 6   LRGKLHPNRDLSGLTWLQVGGPADYLFQPADVEDLSHMLRSLDPSVPVFPMGVGSNLIVR 65

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+R +V+RL   GF+ IEV     +  GA      +A  A   GI    F   IPGSI
Sbjct: 66  DGGLRALVIRLGR-GFNAIEVEGDT-VTAGAAALDGHVARKAADAGID-LTFLRTIPGSI 122

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAG      +        + R G    +  E LK+ YR S++ +  ++   VLR
Sbjct: 123 GGAVRMNAGCYGSYMADVFQSATVVLRSGEVVTLRGEDLKFAYRQSDLPEGAVLVSAVLR 182

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLIE 244
           G     + + A +      R+  QP K+++ GSTF+NP G S            AW++I+
Sbjct: 183 GPKGDPDALHARMEEQLAKRDATQPTKDRSAGSTFRNPAGFSSTGQADDVHDLKAWKVID 242

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            +G RG   G A++SE H NF+IN   A+  DLE LGE VRKKV+  SGI LEWEI R+G
Sbjct: 243 DAGMRGARRGAAQMSEKHSNFLINTGGASAADLEGLGEDVRKKVYANSGITLEWEIMRVG 302

Query: 305 D 305
           D
Sbjct: 303 D 303


>gi|163738722|ref|ZP_02146136.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Phaeobacter
           gallaeciensis BS107]
 gi|161388050|gb|EDQ12405.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Phaeobacter
           gallaeciensis BS107]
          Length = 307

 Score =  216 bits (551), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 118/301 (39%), Positives = 165/301 (54%), Gaps = 15/301 (4%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRGK   N  L  +TW + GG A+ +FQP DI DL + L  L   +P+  +G+GSN++VR
Sbjct: 6   LRGKLHPNRDLSGLTWLQVGGPADYLFQPVDIEDLSHMLRSLDPSVPVFPMGVGSNLIVR 65

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+R +V+RL   GF+ IE+ +   ++ GA      +A  A   GI    F   IPGSI
Sbjct: 66  DGGLRALVIRLGR-GFNTIEIADDT-VVAGAAALDGHVARKAADAGID-LTFLRTIPGSI 122

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAG      +        + R G    +  + LK+ YR S++ +  ++   VLR
Sbjct: 123 GGAVRMNAGCYGSYMADVFQSATVVLRSGEVVTLRGDDLKFAYRQSDLPEGAVLVSAVLR 182

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLIE 244
           G       + A +      R+  QP K+++ GSTF+NP G S            AW++I+
Sbjct: 183 GPKGDPEALHARMEEQLAKRDATQPTKDRSAGSTFRNPAGFSSTGQADDVHDLKAWKVID 242

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            +G RG   G A++SE H NF+IN   A+  DLE LGE VRKKV+  SGI LEWEI R+G
Sbjct: 243 DAGMRGARRGAAQMSEKHSNFLINTGGASAADLEGLGEDVRKKVYANSGITLEWEIMRVG 302

Query: 305 D 305
           D
Sbjct: 303 D 303


>gi|89055245|ref|YP_510696.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Jannaschia sp. CCS1]
 gi|122498272|sp|Q28NP1|MURB_JANSC RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|88864794|gb|ABD55671.1| UDP-N-acetylmuramate dehydrogenase [Jannaschia sp. CCS1]
          Length = 309

 Score =  216 bits (550), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 115/299 (38%), Positives = 164/299 (54%), Gaps = 15/299 (5%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRD 77
           RG+   +  L  +TW R GG A+ +FQP D+ DL  F+  L   +P+  +G+GSN++VRD
Sbjct: 9   RGRLTPDKDLSGLTWLRVGGPADWLFQPADVDDLCAFMAELDPAVPVFPMGVGSNLIVRD 68

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G+RGVV++L    F +I V     +  GA      LA  A   G+    F   IPGS+G
Sbjct: 69  GGLRGVVIKLGRP-FMDISVEGD-RITAGAAVLDARLAKEAADAGVD-LTFLRTIPGSLG 125

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRG 197
           GA  MNAG      + + V    + R G Q  + R+ + + YR ++I + + IT V L+G
Sbjct: 126 GALKMNAGCYGSYVADHFVGAQAVLRDGTQVTLTRDDITFAYRQTDIPEGVTITSVTLQG 185

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLIEK 245
             E   ++   +      R+  QP K  T GSTF+NP G S            AW++I+ 
Sbjct: 186 NREDSRVLHTRMEEQLAKRDATQPTKALTAGSTFRNPAGFSSTGQADDTHELKAWKVIDD 245

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           +G RG   GGA++SE+H NF++N   AT  DLE LGE+VRK+VF   GI L WEI R+G
Sbjct: 246 AGMRGATRGGAQMSEMHSNFLVNKGGATAADLEGLGEEVRKRVFQTQGIDLVWEIMRVG 304


>gi|294676379|ref|YP_003576994.1| UDP-N-acetylmuramate dehydrogenase [Rhodobacter capsulatus SB 1003]
 gi|294475199|gb|ADE84587.1| UDP-N-acetylmuramate dehydrogenase [Rhodobacter capsulatus SB 1003]
          Length = 306

 Score =  216 bits (550), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 118/301 (39%), Positives = 162/301 (53%), Gaps = 15/301 (4%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRD 77
           RG    N+PL  +TW R GG A+ +FQP D  DL   L  LP+D+ +  +G+GSN++VRD
Sbjct: 9   RGALTPNYPLADLTWLRVGGPADWLFQPADEADLSACLAALPADVTVFPMGVGSNLIVRD 68

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G+R VV+RL   GF+ I V     +  GA      +A  A   G     F   IPG+IG
Sbjct: 69  GGLRAVVIRLGR-GFNAISVMGET-VTAGAAALDAHVARRAAEAG-RDLTFLRTIPGAIG 125

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRG 197
           GA  MNAG      + +++ V  + R G    +  E L   YRSS +    +I     R 
Sbjct: 126 GAVRMNAGCYGAYVADHLISVRVVLRTGEVVEMAAEDLHLAYRSSTLPDQAVIVSATFRA 185

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLIEK 245
                  ++A +      R+  QP K ++ GSTF+NP+G S            AW++I+ 
Sbjct: 186 AAGDPAALAARMEEQIAKRDASQPTKARSAGSTFRNPSGASSTGRADDSQELKAWKVIDA 245

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +G RG   GGA+IS +H NF+INA  AT  DLE LGE+VRKKV    GI LEWEI R+G+
Sbjct: 246 AGMRGATLGGAQISPMHSNFLINAGGATARDLETLGEEVRKKVLQTQGISLEWEIMRVGE 305

Query: 306 F 306
           +
Sbjct: 306 Y 306


>gi|218680674|ref|ZP_03528571.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobium etli CIAT
           894]
          Length = 202

 Score =  216 bits (550), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 130/183 (71%)

Query: 15  KQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNIL 74
           K +RG+   + P+ ++TWFR GG AE+MFQP DI DL  FL +LP ++P+T+VG+GSNIL
Sbjct: 18  KDIRGRITPDAPMDRVTWFRAGGLAELMFQPHDIDDLVAFLKILPEEVPLTVVGVGSNIL 77

Query: 75  VRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPG 134
           VRD GI GVVLRLS  GF  +E+     ++ G  C  K +A  A+ +GIGGFHFFYGIPG
Sbjct: 78  VRDGGIPGVVLRLSAKGFGFVELAGENRILAGTICPDKHVAAMAMDNGIGGFHFFYGIPG 137

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVV 194
           SIGGAA MNAGAN  ET + ++EV+ +DR+GN+HV+   ++ Y YR S    DLI T V 
Sbjct: 138 SIGGAARMNAGANGVETRERLIEVNAVDRRGNKHVLSNAEMGYSYRHSSAPADLIFTSVA 197

Query: 195 LRG 197
           +RG
Sbjct: 198 VRG 200


>gi|126729255|ref|ZP_01745069.1| UDP-N-acetylenolpyruvoylglucosamine reductase/dehydrogenase
           [Sagittula stellata E-37]
 gi|126710245|gb|EBA09297.1| UDP-N-acetylenolpyruvoylglucosamine reductase/dehydrogenase
           [Sagittula stellata E-37]
          Length = 307

 Score =  216 bits (550), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 115/302 (38%), Positives = 165/302 (54%), Gaps = 15/302 (4%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
           + RG+   + PL  +TW R GG A+  FQP D  DL  FL  L  ++P+  +G+GSN++V
Sbjct: 7   ETRGRLTPDRPLNDLTWLRVGGPADWFFQPADHDDLCAFLGALDPNVPVFPMGVGSNLIV 66

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD G+R VV+RL   GF+ I V +   +  GA      +A  A + G+    F   IPGS
Sbjct: 67  RDGGVRAVVIRLGR-GFNGISV-DGTRVTCGAAALDAHVAKRAAQAGVD-LTFLRTIPGS 123

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           IGGA  MNAG      + ++VE   + R G    +  + L + YRSS +    ++   V 
Sbjct: 124 IGGAVRMNAGCYGSYVADHLVEARAVTRDGKLVSLSPDALAFGYRSSNLPDGWVLVEAVF 183

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLI 243
            G      ++ A +      R+  QP+K+++ GSTF+NP G S            AW++I
Sbjct: 184 EGAAGDPEVLEARMEEQLAKRDATQPVKDRSAGSTFRNPAGFSSTGRADDTHELKAWKVI 243

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           + +G RG   GGA++S  H NF++N   AT  DLE LGE VR KV +QSGI L WE+ R+
Sbjct: 244 DDAGMRGATRGGAQMSPKHSNFLVNTGGATAADLEGLGEDVRAKVRDQSGIELVWEVIRI 303

Query: 304 GD 305
           GD
Sbjct: 304 GD 305


>gi|254465112|ref|ZP_05078523.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodobacterales
           bacterium Y4I]
 gi|206686020|gb|EDZ46502.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodobacterales
           bacterium Y4I]
          Length = 313

 Score =  216 bits (549), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 119/300 (39%), Positives = 164/300 (54%), Gaps = 15/300 (5%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRD 77
           RG+      L ++TW R GG A+ +FQP D+ DL  FL  L   + +  +G+GSN++VRD
Sbjct: 13  RGRLTRQKLLAELTWLRVGGPADHLFQPADVEDLADFLRQLDPGVQVFPMGVGSNLIVRD 72

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G+R VV+RL   GF++IE      +  GA      +A  A   GI    F   IPGSIG
Sbjct: 73  GGLRAVVIRLGR-GFNSIETEGDM-VTAGAAALDAHVAKKAADAGID-LTFLRTIPGSIG 129

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRG 197
           GA  MNAG     TS   V    + R+G    I  ++L +QYR ++  +  ++    LRG
Sbjct: 130 GAVRMNAGCYGSYTSDVFVSATIVTRQGEIREITADELGFQYRQTDFPEGAVLVSATLRG 189

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLIEK 245
                  + A +      R+  QP+K+++ GSTF+NP G S            AW++I+ 
Sbjct: 190 PKGDPAELHARMEAQLQKRDETQPVKDRSAGSTFRNPAGFSSTGQADDVHDLKAWKVIDD 249

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +G RG   G A++SE H NF+IN   AT  DLE LGE VRKKV+  SGI LEWEI R+GD
Sbjct: 250 AGMRGARRGAAQMSEKHSNFLINTGGATAADLEGLGEDVRKKVYENSGIRLEWEIMRIGD 309


>gi|254475193|ref|ZP_05088579.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Ruegeria sp. R11]
 gi|214029436|gb|EEB70271.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Ruegeria sp. R11]
          Length = 307

 Score =  216 bits (549), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 118/301 (39%), Positives = 165/301 (54%), Gaps = 15/301 (4%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRG+   N  L  +TW R GG A+ +FQP DI DL +F+      + +  +G+GSN++VR
Sbjct: 6   LRGRLTPNRALADLTWLRVGGPADYLFQPADIEDLSHFMRACEPSVQVFPMGVGSNLIVR 65

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+R VV+RL   GF++IE+     +  GA      +A  A   G+    F   IPGS+
Sbjct: 66  DGGLRAVVVRLGR-GFNSIEIDGDT-VTAGAAALDAHVARKAADAGVD-LTFLRTIPGSV 122

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAG      +        + R G    +  E L + YR S++ +  ++    LR
Sbjct: 123 GGAVRMNAGCYGSYVADVFQSATVVLRTGEVVELGPEALNFAYRQSDLAEGAVLVSAKLR 182

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLIE 244
           G       + A + +    R+  QP KE++ GSTF+NP G S            AW++I+
Sbjct: 183 GPLGEPAALHARMEDQLAKRDATQPTKERSAGSTFRNPAGFSSTGRADDVHDLKAWKVID 242

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            +G RG   GGA++SE H NFMINA  AT  DLE LGE+VRK+V+  SGI LEWEI R+G
Sbjct: 243 DAGMRGARRGGAQMSEKHSNFMINAGGATAADLEGLGEEVRKEVYANSGITLEWEIMRVG 302

Query: 305 D 305
           D
Sbjct: 303 D 303


>gi|84501758|ref|ZP_00999930.1| UDP-N-acetylenolpyruvoylglucosamine reductase/dehydrogenase
           [Oceanicola batsensis HTCC2597]
 gi|84390379|gb|EAQ02938.1| UDP-N-acetylenolpyruvoylglucosamine reductase/dehydrogenase
           [Oceanicola batsensis HTCC2597]
          Length = 312

 Score =  216 bits (549), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 116/302 (38%), Positives = 165/302 (54%), Gaps = 15/302 (4%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
           + RG+     PL ++TW R GG AE  FQP D  DL  FL+ L  ++P+  +G+GSN++V
Sbjct: 8   ETRGRLTAQRPLSELTWLRVGGPAEWFFQPADETDLAAFLSALDPEVPVFPMGVGSNLIV 67

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD G+ GVV+RL   GF+ I V     +  GA      +A  A+  G+    F   IPGS
Sbjct: 68  RDGGLPGVVIRLGR-GFNAITVEGR-RVTAGAAALDAHVARRAVEAGVD-LTFLRTIPGS 124

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           IGGA  MNAG     T+        + R G +  +    + + YR ++I +  ++T V  
Sbjct: 125 IGGALRMNAGCYGTYTADNFHSARAVTRDGRRVTLGSGDIDFAYRQTDIPEGWVVTEVTF 184

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLI 243
                    ++  +A     R+  QP KE++ GSTF+NP G S            AW+LI
Sbjct: 185 EAPVGDPADLADRMAAQLQKRDETQPTKERSAGSTFRNPAGFSSTGQADDVHDLKAWKLI 244

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           + +G RG   GGA++SE H NF++NA  AT  +LE LGE VRK+VF  SG+ LEWEI R+
Sbjct: 245 DDAGMRGARHGGAQMSEKHPNFLLNAAGATAAELEELGEDVRKRVFQSSGLTLEWEIMRI 304

Query: 304 GD 305
           G+
Sbjct: 305 GE 306


>gi|254441685|ref|ZP_05055178.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Octadecabacter
           antarcticus 307]
 gi|198251763|gb|EDY76078.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Octadecabacter
           antarcticus 307]
          Length = 311

 Score =  215 bits (548), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 118/301 (39%), Positives = 165/301 (54%), Gaps = 15/301 (4%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RG    N  L  +TW R GG A+V+FQP D  DL+ FL  LP  +P+ ++G+GSN++VR
Sbjct: 9   VRGVLTPNRDLSDLTWMRVGGPADVLFQPADEDDLRSFLAALPFAVPVFVMGVGSNLIVR 68

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ GVV+RL   GF+ IE  ++  +  GA      +A  A   G+    F   IPGSI
Sbjct: 69  DGGVHGVVIRLGR-GFNGIEFADNI-VRAGAAALDAHVARKAAALGL-NLTFLRTIPGSI 125

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAG      +  + +V  + R G+   +    L  QYRSS +    +I    L+
Sbjct: 126 GGAVRMNAGCYGDYVADVLQDVRVVMRDGSVQTLAVADLDLQYRSSALPDGAVIVSATLK 185

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLIE 244
              E   ++   +A     R+  QP K++T GSTF+NP G S            AW++I+
Sbjct: 186 AAREDAQVLEDRMAAQLAKRDETQPTKDRTAGSTFRNPVGFSSTGQADDTHDLKAWKVID 245

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            +G RG   GGA ++  H NF+ NA  AT  DL  LGE VRKKV+  SG+ LEWEI R+G
Sbjct: 246 DAGMRGAARGGAVMNTKHPNFLTNAGGATAADLIGLGEDVRKKVYETSGLTLEWEIMRVG 305

Query: 305 D 305
           +
Sbjct: 306 E 306


>gi|146276748|ref|YP_001166907.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodobacter
           sphaeroides ATCC 17025]
 gi|166222846|sp|A4WQD8|MURB_RHOS5 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|145554989|gb|ABP69602.1| UDP-N-acetylmuramate dehydrogenase [Rhodobacter sphaeroides ATCC
           17025]
          Length = 308

 Score =  215 bits (547), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 115/301 (38%), Positives = 164/301 (54%), Gaps = 15/301 (4%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RG   E  PL  +TW R GG A+ +FQP D  DL  FL      +P+  +G+GSN++VR
Sbjct: 5   VRGTLTEGRPLADLTWLRVGGPADWLFQPADEEDLAGFLAAHDPAVPVFPMGVGSNLIVR 64

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+R VV+RL   GF+ I V     +I GA      +A  A   G     F   IPG+I
Sbjct: 65  DGGLRAVVIRLGR-GFNGIRVEGE-RVIAGAAALDAHVARRAAEAGRD-LTFLRTIPGTI 121

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAG      + +++EV  I R+G    +P   L   YR S + +  ++     R
Sbjct: 122 GGAVRMNAGCYGSYVADHLIEVRAITREGRAVTLPAADLGLAYRQSRLPEGWVLVEAAFR 181

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLIE 244
                   ++  +      R++ QP ++++ GSTF+NP G S            AW+LI+
Sbjct: 182 ADAGDPAALARRMDEQIARRDSSQPTRDRSAGSTFRNPAGFSSTGRADDTHELKAWKLID 241

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           ++G RG   GGA++SE+H NF+IN   AT  DLE LGE+V K+VF  SGI L+WEI R+G
Sbjct: 242 EAGMRGARRGGAQMSEMHSNFLINTGGATAADLEGLGEEVIKRVFQSSGIELQWEIMRVG 301

Query: 305 D 305
           +
Sbjct: 302 E 302


>gi|85703763|ref|ZP_01034867.1| UDP-N-acetylenolpyruvoylglucosamine reductase/dehydrogenase
           [Roseovarius sp. 217]
 gi|85672691|gb|EAQ27548.1| UDP-N-acetylenolpyruvoylglucosamine reductase/dehydrogenase
           [Roseovarius sp. 217]
          Length = 298

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 161/291 (55%), Gaps = 15/291 (5%)

Query: 27  LKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDAGIRGVVLR 86
           +  +TW R GG A+ +FQP D+ DL  FL  L + +P+  +G+GSN++VRD G+  VV+R
Sbjct: 1   MADLTWLRVGGPADWLFQPADLEDLAAFLAGLDASVPVFPMGVGSNLIVRDGGLHAVVIR 60

Query: 87  LSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGA 146
           L   GF+ I V     ++ GA      +A  A   G+    F   IPGSIGGA  MNAG 
Sbjct: 61  LGR-GFNGIRVEG-PRVVAGAAALDAHVARRAAEAGVD-LTFLRTIPGSIGGAVRMNAGC 117

Query: 147 NNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPESQNIIS 206
                + +++E   + R G    +   +L++ YR S +    +I      G P     + 
Sbjct: 118 YGAYVADHLIEARAVTRSGEVVTLGPRELQFAYRHSALPDGWVIFEATFEGVPGDPATLE 177

Query: 207 AAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLIEKSGCRGLEFG 254
           A +A     R+  QP KE++ GSTF+NP G S            AW++I+++G RG   G
Sbjct: 178 AKMAEQIAKRDATQPTKERSAGSTFRNPAGFSSTGRADDVHDLKAWKVIDEAGLRGARRG 237

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            A++SE+H NF+IN   A+  DLE LG++VRKKVF   GI LEWEI R+G+
Sbjct: 238 AAQMSEMHPNFLINTGGASAADLEGLGDEVRKKVFQMRGIELEWEIMRVGE 288


>gi|58697335|ref|ZP_00372684.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Wolbachia
           endosymbiont of Drosophila simulans]
 gi|225630164|ref|YP_002726955.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Wolbachia sp. wRi]
 gi|254765618|sp|C0R2M2|MURB_WOLWR RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|58536287|gb|EAL59798.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Wolbachia
           endosymbiont of Drosophila simulans]
 gi|225592145|gb|ACN95164.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Wolbachia sp. wRi]
          Length = 295

 Score =  213 bits (541), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 105/292 (35%), Positives = 169/292 (57%), Gaps = 4/292 (1%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
           ++RG ++ +  + + TW   GG A+++F+P+DI DL   +    +++P++++G  SNI+V
Sbjct: 7   KVRGIYRYDILMSKATWLNVGGRADILFKPRDIEDLTCLIK--NTELPVSVIGATSNIIV 64

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD+GIRG+ ++L    F+ I+ + +  ++ G      +LA+ A    I G  F  GIPG+
Sbjct: 65  RDSGIRGITVKLGKE-FAYIKSKGNNSIVAGGAVLLSNLAHFAGNQQISGLEFLVGIPGT 123

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGID-RKGNQHVIPREQLKYQYRSSEITKDLIITHVV 194
           +GG   MNAGA   + +  V  +  ++   GN +    E++ Y YR   +  + I     
Sbjct: 124 VGGGIEMNAGAYGSDIASVVQSIKAVNLEDGNLYEFSSEEMGYFYRGHSLKGNWIFVEAE 183

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
            +G      +I   +  V   +   QPI+ KT G  FKNP  + AW+LI+KSGC GL  G
Sbjct: 184 FKGVNSEYELILQRLKEVIERKNKSQPIRGKTAGCIFKNPKNYRAWELIDKSGCLGLNIG 243

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           GA+IS+ HCNF++N DNAT  DLE LG +V+  V ++  + LEWEI+ LG +
Sbjct: 244 GARISKKHCNFLLNYDNATASDLENLGNKVKDAVKDKFNVELEWEIRVLGSY 295


>gi|42520402|ref|NP_966317.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Wolbachia
           endosymbiont of Drosophila melanogaster]
 gi|99034623|ref|ZP_01314578.1| hypothetical protein Wendoof_01000609 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
 gi|59798348|sp|Q73HL4|MURB_WOLPM RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|42410141|gb|AAS14251.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Wolbachia
           endosymbiont of Drosophila melanogaster]
          Length = 295

 Score =  212 bits (539), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 106/292 (36%), Positives = 168/292 (57%), Gaps = 4/292 (1%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
           ++RG ++ +  + + TW   GG A+V+F+P DI DL Y +    +++P++++G  SNI+V
Sbjct: 7   KVRGIYRYDVLMSKATWLNVGGRADVLFKPCDIEDLTYLIK--NTELPVSVIGATSNIIV 64

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD+GIRG+ ++L    F+ I+ + +  ++ G      +LA+ A    I G  F  GIPG+
Sbjct: 65  RDSGIRGITVKLGKE-FAYIKSKGNNSIVAGGAVLLSNLAHFAGNQQISGLEFLVGIPGT 123

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGID-RKGNQHVIPREQLKYQYRSSEITKDLIITHVV 194
           +GG   MNAGA   + +  V  +  ++   GN +    E++ Y YR   +  + I     
Sbjct: 124 VGGGIEMNAGAYGSDIASVVQSIKAVNLEDGNLYEFSSEEMGYFYRGHSLKGNWIFVEAE 183

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
            +G      +I   +  V   +   QPI+ KT G  FKNP  + AW+LI+KSGC  L  G
Sbjct: 184 FKGVNSEYELILQRLKEVIERKNKSQPIRGKTAGCIFKNPKNYRAWELIDKSGCLRLNIG 243

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           GA+IS+ HCNF++N DNAT  DLE LG +V+  V ++  + LEWEI+ LG +
Sbjct: 244 GARISKKHCNFLLNYDNATASDLENLGNKVKDAVKDKFNVELEWEIRVLGSY 295


>gi|126726625|ref|ZP_01742465.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodobacterales
           bacterium HTCC2150]
 gi|126703954|gb|EBA03047.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodobacterales
           bacterium HTCC2150]
          Length = 311

 Score =  210 bits (535), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 116/305 (38%), Positives = 164/305 (53%), Gaps = 15/305 (4%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RG    N PL  +TW R GG A+ +FQP D  DL  FL  LP++I +  +G+GSN++VR
Sbjct: 7   VRGVLTPNRPLADLTWLRVGGPADYLFQPADAQDLADFLRDLPAEIDVFPMGVGSNLIVR 66

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
             GIR VV+RL   GF++I       +  GA      +A  A   G+    F   IPG+I
Sbjct: 67  SGGIRAVVIRLGR-GFNSILTDGDL-VTAGAAALDAHVARRAAEAGLD-LTFLRTIPGAI 123

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAG      +  +  V  I R+G    +  ++L++ YR S++    +I     +
Sbjct: 124 GGAVRMNAGCYGAYVADVLQNVTVITRQGEIKTLAAQELEFGYRGSKLADGYVIVEATFK 183

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQLIE 244
                 + ++A +      R+  QP KE+T GSTF+NP G S            AW++I+
Sbjct: 184 APLGEPDQLAAKMVEQLATRDKTQPTKERTAGSTFRNPAGFSSTGRADDVHDLKAWKVID 243

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            +G RG   G A++S  H NF+IN   AT  DLE LGE VRKKVF  SG+ LEWE+ R+G
Sbjct: 244 DAGMRGATLGSAQMSPKHSNFLINTGGATSEDLEGLGELVRKKVFQTSGLTLEWEVLRVG 303

Query: 305 DFFDH 309
           +   H
Sbjct: 304 EPAPH 308


>gi|190570894|ref|YP_001975252.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|254765617|sp|B3CPS8|MURB_WOLPP RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|190357166|emb|CAQ54581.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
          Length = 294

 Score =  209 bits (531), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 106/287 (36%), Positives = 166/287 (57%), Gaps = 4/287 (1%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDA 78
           G ++ N  + ++TW   GG A+V+F+P+DI DL   +    +++PI+++G  SNI++RD+
Sbjct: 10  GIYRYNVSMSKMTWLNVGGQADVLFKPRDIEDLMCLIK--DAELPISVIGATSNIIIRDS 67

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIRG+ ++L    F+ I+ +++  ++ G      +LA  A    I G  F  GIPG++GG
Sbjct: 68  GIRGITVKLGKE-FAYIKCKDNSSIVAGGAALLSNLAYFAGEQQISGLEFLAGIPGTVGG 126

Query: 139 AAYMNAGANNCETSQYVVEVHGID-RKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRG 197
              MNAGA   + +  V  +  ++   GN +    E++ Y YR   +    I      +G
Sbjct: 127 GIEMNAGAYGSDIASVVKFIRAVNLEDGNLYEFSSEEMGYFYRGHSLKGRWIFIEAEFKG 186

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
                 +I   +  V   +   QP++ KT G  FKNP G  AW+LI++SGCRGL+ G AK
Sbjct: 187 VSSEYELILQRLKEVIDKKNKSQPVRGKTAGCIFKNPIGCKAWKLIDESGCRGLDNGVAK 246

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           IS+ HCNF++N +NAT  DLE LG +V+  V ++  I LEWEI+ LG
Sbjct: 247 ISKKHCNFLLNYNNATALDLENLGNRVKDAVKDKFNIELEWEIRVLG 293


>gi|89067823|ref|ZP_01155267.1| UDP-N-acetylenolpyruvoylglucosamine reductase/dehydrogenase
           [Oceanicola granulosus HTCC2516]
 gi|89046421|gb|EAR52477.1| UDP-N-acetylenolpyruvoylglucosamine reductase/dehydrogenase
           [Oceanicola granulosus HTCC2516]
          Length = 314

 Score =  208 bits (530), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 121/305 (39%), Positives = 170/305 (55%), Gaps = 14/305 (4%)

Query: 13  RGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSN 72
           R  + RG    + PL  +TW R GG A+ +FQP D  DL  FL  LP++I +  +G+GSN
Sbjct: 8   RLPEPRGTLTADRPLSDLTWLRVGGPADWLFQPADRDDLAAFLAALPAEIAVFPMGVGSN 67

Query: 73  ILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGI 132
           ++VRD GIRGVV+RL   GF+ IE+ +   +  GA      +A  A   G     F   I
Sbjct: 68  LIVRDGGIRGVVIRLGR-GFNGIEIGDDGLVRAGAAALDAHVARKAAAAGRD-LTFLRTI 125

Query: 133 PGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITH 192
           PG+IGGA  MNAG      + ++ E+  + R G    +P  +LK  YRSSE+    +I  
Sbjct: 126 PGAIGGAVRMNAGCYGSYVADHLREITLVHRDGTIATLPAAELKLAYRSSELPAGAVIVE 185

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AW 240
            V        + ++A +      R+  QP K++T GSTF+NP G+S            AW
Sbjct: 186 AVFEAEAGEPDALAARMETQLAKRDESQPTKDRTAGSTFRNPAGYSSTGAPDDSHDLKAW 245

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           ++I+++G RG   GGA ++E H NF+ NA  AT  DLE LGE VRKKV+   G+ LEWEI
Sbjct: 246 KVIDEAGLRGARLGGAVMNEKHPNFLTNAGEATAQDLESLGETVRKKVYEARGLTLEWEI 305

Query: 301 KRLGD 305
            R+G+
Sbjct: 306 MRVGE 310


>gi|84516386|ref|ZP_01003745.1| UDP-N-acetylenolpyruvoylglucosamine reductase/dehydrogenase
           [Loktanella vestfoldensis SKA53]
 gi|84509422|gb|EAQ05880.1| UDP-N-acetylenolpyruvoylglucosamine reductase/dehydrogenase
           [Loktanella vestfoldensis SKA53]
          Length = 312

 Score =  208 bits (529), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 116/302 (38%), Positives = 158/302 (52%), Gaps = 15/302 (4%)

Query: 15  KQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNIL 74
             +RG      PL  +TW R GG AE++FQP D  DL  FL  L   +P+  +G+GSN++
Sbjct: 9   PPVRGTLTAERPLADLTWMRVGGLAEMLFQPADAEDLAAFLAALDPSVPVFPMGVGSNLI 68

Query: 75  VRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPG 134
           VRD GI GVV+RL   GF++I + +   +  GA      +A  A   G+    F   IPG
Sbjct: 69  VRDGGIPGVVVRLGR-GFNSITI-DGGMVTAGAAALDGHVARRAADAGL-DLTFLRTIPG 125

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVV 194
           SIGGA  MNAG      +  +  V  + R G  H +P   L   YR S + +  II    
Sbjct: 126 SIGGAVRMNAGCYGSYVADVLTSVRVVLRDGTLHDLPAADLHLGYRHSSLPEGAIILAAT 185

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQL 242
                     ++A + +    R+  QP K++T GSTF+NP G S            AW +
Sbjct: 186 FAPPAGDPATLAARMDDQLAKRDATQPTKDRTAGSTFRNPAGFSSTGRADDTHELKAWAV 245

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           I+ +G RG   GGA ++  H NF+ NA  A+  DLE LGE VRKKV++  GI LEWEI R
Sbjct: 246 IDAAGLRGATLGGAVMNVKHPNFLTNAGGASAADLEDLGELVRKKVYDSQGITLEWEIMR 305

Query: 303 LG 304
           +G
Sbjct: 306 VG 307


>gi|58699700|ref|ZP_00374367.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|58533784|gb|EAL58116.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Wolbachia
           endosymbiont of Drosophila ananassae]
          Length = 278

 Score =  208 bits (529), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 103/281 (36%), Positives = 162/281 (57%), Gaps = 4/281 (1%)

Query: 27  LKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDAGIRGVVLR 86
           + + TW   GG A+++F+P+DI DL   +    +++P++++G  SNI+VRD+GIRG+ ++
Sbjct: 1   MSKATWLNVGGRADILFKPRDIEDLTCLIK--NTELPVSVIGATSNIIVRDSGIRGITVK 58

Query: 87  LSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGA 146
           L    F+ I+ + +  ++ G      +LA+ A    I G  F  GIPG++GG   MNAGA
Sbjct: 59  LGKE-FAYIKSKGNNSIVAGGAVLLSNLAHFAGNQQISGLEFLVGIPGTVGGGIEMNAGA 117

Query: 147 NNCETSQYVVEVHGID-RKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPESQNII 205
              + +  V  +  ++   GN +    E++ Y YR   +  + I      +G      +I
Sbjct: 118 YGSDIASVVQSIKAVNLEDGNLYEFSSEEMGYFYRGHSLKGNWIFVEAEFKGVNSEYELI 177

Query: 206 SAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCNF 265
              +  V   +   QPI+ KT G  FKNP  + AW+LI+KSGC GL  GGA+IS+ HCNF
Sbjct: 178 LQRLKEVIERKNKSQPIRGKTAGCIFKNPKNYRAWELIDKSGCLGLNIGGARISKKHCNF 237

Query: 266 MINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           ++N DNAT  DLE LG +V+  V ++  + LEWEI+ LG +
Sbjct: 238 LLNYDNATASDLENLGNKVKDAVKDKFNVELEWEIRVLGSY 278


>gi|91762847|ref|ZP_01264812.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Candidatus
           Pelagibacter ubique HTCC1002]
 gi|91718649|gb|EAS85299.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Candidatus
           Pelagibacter ubique HTCC1002]
          Length = 302

 Score =  206 bits (525), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 112/297 (37%), Positives = 165/297 (55%), Gaps = 4/297 (1%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           +R+   ++  K   ++ LK+  WF  GG  +V F+P ++ DL  FL        I I+G 
Sbjct: 6   IRKFSNEISSKINFDYDLKKSNWFNIGGQTKVYFRPDNLPDLILFLKKFGEKEKIHILGA 65

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
           GSN L+ D    GVV++L    FSNI +  +  +I G+ C  K L++ AL +GIGGF F 
Sbjct: 66  GSNTLISDEKFDGVVIKLG-KNFSNISILPNDVIIAGSACLDKKLSDFALNNGIGGFEFL 124

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLI 189
             IPG+IGG   MNAG  N E    +V +  ID+ G    IP  ++ ++YRS+++ +DLI
Sbjct: 125 ACIPGTIGGGLKMNAGCFNKEFKDVLVSIQAIDKNGQVFTIPASKVIFKYRSNDLKEDLI 184

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNP---TGHSAWQLIEKS 246
                 +G  +++  I   +  +   ++  QP K KT GSTFKNP   T    W+LI+ S
Sbjct: 185 FLSASFKGTKKNKEEIENEVLELKKKKDKAQPTKLKTSGSTFKNPIDQTDKKVWELIKDS 244

Query: 247 GCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
               + FG A IS  HCNF +N +NA+  D+  L E V+  V  ++GI+LE EIK L
Sbjct: 245 VPLDISFGDAHISNKHCNFFVNKNNASFEDMNKLIEFVKTSVEKKTGIVLEKEIKIL 301


>gi|71082731|ref|YP_265450.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Candidatus
           Pelagibacter ubique HTCC1062]
 gi|90109782|sp|Q4FPK7|MURB_PELUB RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|71061844|gb|AAZ20847.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Candidatus
           Pelagibacter ubique HTCC1062]
          Length = 302

 Score =  206 bits (523), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 112/297 (37%), Positives = 165/297 (55%), Gaps = 4/297 (1%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           +R+   ++  K   ++ LK+  WF  GG  +V F+P ++ DL  FL        I I+G 
Sbjct: 6   IRKFSNEISSKINFDYDLKKSNWFNIGGQTKVYFRPDNLPDLILFLKKFGEKEKIHILGA 65

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
           GSN L+ D    GVV++L    FSNI +  +  +I G+ C  K L++ AL +GIGGF F 
Sbjct: 66  GSNTLISDEKFDGVVIKLG-KNFSNISILPNDVIIAGSACLDKKLSDFALNNGIGGFEFL 124

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLI 189
             IPG+IGG   MNAG  N E    +V +  ID+ G    IP  ++ ++YRS+++ +DLI
Sbjct: 125 ACIPGTIGGGLKMNAGCFNKEFKDVLVSIQAIDKNGQVFTIPASKVIFKYRSNDLKEDLI 184

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNP---TGHSAWQLIEKS 246
                 +G  +++  I   +  +   ++  QP K KT GSTFKNP   T    W+LI+ S
Sbjct: 185 FLSASFKGTKKNKEEIENEVLELKKKKDKAQPTKLKTSGSTFKNPIDQTDKKVWKLIKDS 244

Query: 247 GCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
               + FG A IS  HCNF +N +NA+  D+  L E V+  V  ++GI+LE EIK L
Sbjct: 245 VPLDISFGDAHISNKHCNFFVNKNNASFEDMNKLIEFVKISVEKKTGIVLEKEIKIL 301


>gi|213019410|ref|ZP_03335216.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
 gi|212994832|gb|EEB55474.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
          Length = 274

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 104/276 (37%), Positives = 160/276 (57%), Gaps = 4/276 (1%)

Query: 30  ITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDAGIRGVVLRLSN 89
           +TW   GG A+V+F+P+DI DL   +    +++PI+++G  SNI++RD+GIRG+ ++L  
Sbjct: 1   MTWLNVGGQADVLFKPRDIEDLMCLIK--DAELPISVIGATSNIIIRDSGIRGITVKLGK 58

Query: 90  AGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNC 149
             F+ I+ +++  ++ G      +LA  A    I G  F  GIPG++GG   MNAGA   
Sbjct: 59  E-FAYIKCKDNSSIVAGGAALLSNLAYFAGEQQISGLEFLAGIPGTVGGGIEMNAGAYGS 117

Query: 150 ETSQYVVEVHGID-RKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPESQNIISAA 208
           + +  V  +  ++   GN +    E++ Y YR   +    I      +G      +I   
Sbjct: 118 DIASVVKFIRAVNLEDGNLYEFSSEEMGYFYRGHSLKGRWIFIEAEFKGVSSEYELILQR 177

Query: 209 IANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMIN 268
           +  V   +   QP++ KT G  FKNP G  AW+LI++SGCRGL+ G AKIS+ HCNF++N
Sbjct: 178 LKEVIDKKNKSQPVRGKTAGCIFKNPIGCKAWKLIDESGCRGLDNGVAKISKKHCNFLLN 237

Query: 269 ADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            +NAT  DLE LG +V+  V ++  I LEWEI+ LG
Sbjct: 238 YNNATALDLENLGNRVKDAVKDKFNIELEWEIRVLG 273


>gi|162148963|ref|YP_001603424.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161787540|emb|CAP57136.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 645

 Score =  204 bits (518), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 110/261 (42%), Positives = 150/261 (57%), Gaps = 6/261 (2%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRG+  +  PL   TWFR GG AE++ QP D  DL   L  LP D+P+T++G  SN+++R
Sbjct: 23  LRGRLTQGAPLGPRTWFRVGGPAEILLQPADTQDLADALHRLPPDVPVTVLGACSNVIIR 82

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GI GVV+RL   GF++I V     ++VGA C    +A  A   G+ G  F  GIPGSI
Sbjct: 83  DGGIDGVVIRLGG-GFADI-VAEPDGLVVGAACLDMVVAERAAEAGLKGLEFLAGIPGSI 140

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGA+  + +  +     I R GN   +    L + YR S +    ++    LR
Sbjct: 141 GGAVAMNAGAHGSDVATVLDWADIITRDGNSVRLSGPALGFGYRRSALPAGAVVVRARLR 200

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNP----TGHSAWQLIEKSGCRGLE 252
             P +   I  AIA +   RE  QP + +TGGSTF+NP    T   AW+LI+ +GCRGL 
Sbjct: 201 AAPAAPADIRQAIAAIRQSREESQPTRARTGGSTFRNPDPSVTDRKAWELIDSAGCRGLT 260

Query: 253 FGGAKISELHCNFMINADNAT 273
             GA++S  HCNF++N  +AT
Sbjct: 261 MDGAQVSTKHCNFILNTGDAT 281


>gi|254456334|ref|ZP_05069763.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Candidatus
           Pelagibacter sp. HTCC7211]
 gi|207083336|gb|EDZ60762.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Candidatus
           Pelagibacter sp. HTCC7211]
          Length = 301

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 109/297 (36%), Positives = 165/297 (55%), Gaps = 4/297 (1%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           L E  ++     + ++ LK+  WF  GG  ++ ++  ++ +L  FL  + ++  I I+G 
Sbjct: 5   LAELSQEFNDNLKLDYDLKKKNWFNIGGKTKIYYKADNLKELIRFLKKIENNEKIFILGG 64

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
           GSN L+ D    GVV++L+N  F+NI + +   +I G+  S KSL+N A+  G+GGF F 
Sbjct: 65  GSNTLITDEQFNGVVIKLTN-NFNNISLLSDEIIIAGSAVSDKSLSNFAMESGLGGFEFL 123

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLI 189
             IPG++GG   MNAG    E    ++ +  + + G    IP + + ++YR S ++ DLI
Sbjct: 124 SCIPGTVGGGIKMNAGCFKREFKDILISIQALTKSGEVLTIPAKDISFKYRDSGLSDDLI 183

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS---AWQLIEKS 246
                 RGF + + +I   I ++   +E  QP K KT GSTFKNP   S    WQLI++S
Sbjct: 184 FLSASFRGFKKDKELIRDEIISLKEKKEIAQPTKIKTSGSTFKNPLDQSDKKVWQLIKES 243

Query: 247 GCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
                 FG A ISE HCNF +N  NA   D++ L E V + V  ++GI LE EIK L
Sbjct: 244 VPLEKSFGDACISEKHCNFFVNKGNARFEDMKKLIEYVSESVLKKTGIKLETEIKIL 300


>gi|119387196|ref|YP_918251.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Paracoccus
           denitrificans PD1222]
 gi|187609734|sp|A1BAL1|MURB_PARDP RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|119377791|gb|ABL72555.1| UDP-N-acetylmuramate dehydrogenase [Paracoccus denitrificans
           PD1222]
          Length = 306

 Score =  199 bits (505), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 119/302 (39%), Positives = 164/302 (54%), Gaps = 21/302 (6%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRD 77
           RG    N  L  +TW R GG A+ +FQP D  DL  FL  L   IP+  +G+GSN++VRD
Sbjct: 9   RGSLTPNRTLADLTWLRVGGPADWLFQPADEADLAAFLAALDPAIPVFPMGVGSNLIVRD 68

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCE---MIVGARCSGKSLANSALRHGIGGFHFFYGIPG 134
            GIRGVV+RL   GF+ I     CE   +  GA      +A  A   G+    F   IPG
Sbjct: 69  GGIRGVVIRLGR-GFNAIA----CEGGTVTAGAAALDAHVARRAAEAGLD-LTFLRTIPG 122

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVV 194
           SIGGA  MNAG      + ++V V  + R G+ H I    L++ YR S++ +  ++    
Sbjct: 123 SIGGAVRMNAGCYGTYVADHLVSVRAVARDGSLHEIAAADLRFGYRHSDLPEGWVVIEAR 182

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS------------AWQL 242
            R  P     ++A +      R+  QP K+++ GSTF+NP G+S            AW L
Sbjct: 183 FRAEPGDPAELAARMEEQLARRDASQPTKDRSAGSTFRNPAGYSSTGRADDSHELKAWTL 242

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           I+ +G RG   GGA++SE H NF++NA  AT  +LE LGE VR+KV   SG  L+WE+ R
Sbjct: 243 IDAAGLRGHRLGGAQMSEKHPNFLLNAGGATAAELEALGELVRRKVRETSGHELKWEVIR 302

Query: 303 LG 304
           +G
Sbjct: 303 VG 304


>gi|126735386|ref|ZP_01751132.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Roseobacter sp.
           CCS2]
 gi|126715941|gb|EBA12806.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Roseobacter sp.
           CCS2]
          Length = 290

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 112/284 (39%), Positives = 153/284 (53%), Gaps = 15/284 (5%)

Query: 33  FRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGF 92
            R GG AEV+FQP D+ DL  FL  L    P+  +G+GSN++VRD GI GVV+RL   GF
Sbjct: 1   MRVGGPAEVLFQPADVQDLSDFLAALDPATPVFPMGVGSNLIVRDGGISGVVIRLGR-GF 59

Query: 93  SNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETS 152
           + IE+     +  GA      +A  A   G     F   IPG+IGGA  MNAG     T+
Sbjct: 60  NGIEIGEDT-VTAGAAALDAHVARKAADAGFD-LTFLRTIPGTIGGAVRMNAGCYGTYTA 117

Query: 153 QYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPESQNIISAAIANV 212
             +  V  + R G    +  + L+  YR S +    +I    L         +   +A+ 
Sbjct: 118 DVLQSVTVVLRDGTITEMAADALQLAYRQSALPDGAVIVSTRLSPPKGDPATLHQRMADQ 177

Query: 213 CHHRETVQPIKEKTGGSTFKNP-----TGHS-------AWQLIEKSGCRGLEFGGAKISE 260
              R+  QP K++T GSTF+NP     TGH+       AW++I+ +G RG   GGA ++ 
Sbjct: 178 LAKRDETQPTKDRTAGSTFRNPAGFSSTGHADDVHDLKAWKVIDDAGMRGARIGGAVMNA 237

Query: 261 LHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           +H NF+ NA +AT  DLE LGE VRKKV+   GI L+WEIKR+G
Sbjct: 238 MHSNFLTNAGDATAADLEDLGELVRKKVYASQGIELQWEIKRVG 281


>gi|58585035|ref|YP_198608.1| UDP-N-acetylmuramate dehydrogenase [Wolbachia endosymbiont strain
           TRS of Brugia malayi]
 gi|75497599|sp|Q5GRK8|MURB_WOLTR RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|58419351|gb|AAW71366.1| UDP-N-acetylmuramate dehydrogenase [Wolbachia endosymbiont strain
           TRS of Brugia malayi]
          Length = 295

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 107/291 (36%), Positives = 169/291 (58%), Gaps = 4/291 (1%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
           ++RG ++ +  + +ITW   GG A+++F+P+DI DL Y +    + +PI+++G  SN++V
Sbjct: 7   KVRGIYRYSVLMSKITWLNVGGQADILFKPRDIEDLIYLIK--NTKLPISVIGATSNMIV 64

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD+GIRG+ ++L    F+ I+ +++  +I G      +LA  A    + G  F  GIPG+
Sbjct: 65  RDSGIRGITVKLGKE-FAYIKYKSNNSIIAGGAALLSNLAYFAGEQQVSGLEFLVGIPGT 123

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGID-RKGNQHVIPREQLKYQYRSSEITKDLIITHVV 194
           IGG   MNAGA   + +  V  +  ++   GN +    +++ Y YR   +    I     
Sbjct: 124 IGGGIEMNAGAYGSDVASVVQSIKAVNLSDGNLYEFSSKEMGYVYRGHSLKGQWIFIEAE 183

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
            +G      +I   +  + + +   QP++ KT G  FKNP  + AW+LI+ SGCRGL  G
Sbjct: 184 FKGVSSGHEVILHRLKEIINKKNKSQPVRGKTAGCIFKNPRAYQAWKLIDGSGCRGLNNG 243

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           GAKIS+ HCNF++N +NAT  DLE LG +VR  V ++  I LEWEI+ LG 
Sbjct: 244 GAKISKKHCNFLLNYNNATASDLENLGNKVRNTVKDKFNIELEWEIRVLGS 294


>gi|254491332|ref|ZP_05104512.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylophaga
           thiooxidans DMS010]
 gi|224463461|gb|EEF79730.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylophaga
           thiooxydans DMS010]
          Length = 296

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 110/292 (37%), Positives = 157/292 (53%), Gaps = 4/292 (1%)

Query: 15  KQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNIL 74
           + L+G+ + N PL + T +R GGNA+  ++P DI DL  FL  LP   P+  +GLGSN+L
Sbjct: 6   QNLKGELKLNEPLAKYTSWRVGGNAQRFYKPTDIDDLATFLKQLPQSEPLLWLGLGSNVL 65

Query: 75  VRDAGIRGVVLRLSNAGFSNIEVR-NHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           +RD G +G V+  + A   +I V  N     VG  CS   LA  A + G+ G  F  GIP
Sbjct: 66  IRDGGFKGTVIVTAGA-LQDIHVDGNTVHAEVGVYCS--KLAKQAAKAGLKGGAFLAGIP 122

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHV 193
           G++GGA  MNAGA+  ET  +V +V  ID +GN H     + +  YR    +KD      
Sbjct: 123 GTLGGALAMNAGAHGAETWDFVSDVTTIDMQGNLHQRQASEFEVSYRHVAKSKDEYFVAA 182

Query: 194 VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEF 253
            ++         S  I ++   R   QP  +   GS F+NP G  A +LIE SG +GL  
Sbjct: 183 TMQFAQGDAEAESDLIRDLLRKRNASQPTNQPCAGSVFRNPEGDFAGRLIETSGLKGLRV 242

Query: 254 GGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           GGA +S  H NF++N D AT  D+E L   V++K+    G+ L  E+  +G+
Sbjct: 243 GGASVSTKHANFIVNDDAATAADIENLILLVQQKIEQMQGVKLTPEVHVIGE 294


>gi|306820908|ref|ZP_07454528.1| UDP-N-acetylmuramate dehydrogenase [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
 gi|304551022|gb|EFM38993.1| UDP-N-acetylmuramate dehydrogenase [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
          Length = 307

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 108/285 (37%), Positives = 162/285 (56%), Gaps = 3/285 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIRG 82
           N P+K +T F  GGNA+   +P  + D+   L +      P+ I+G GSN+LV D GIR 
Sbjct: 24  NHPMKDVTSFHIGGNADFFVRPTSVADIIEILNIAKDYSYPVFIMGNGSNLLVSDKGIRA 83

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           +V++L++  F+ +   +   + V A  S  SL+   L H + GF F  GIPG++GGA  M
Sbjct: 84  IVIQLTD-NFNKLTRIDDYTVEVDAGMSMTSLSKYFLEHSLSGFEFACGIPGTLGGAVTM 142

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFPES 201
           NAGA +   S  V EV  +D+  N   I  E +K+ YR+S I K+ +++  V +R    +
Sbjct: 143 NAGAYDSMMSNVVTEVIALDKDMNLRKINNENMKFAYRNSIIAKENMVVLTVRIRLEKGN 202

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
            + I A I +  H R T QP+   + GSTFK P GH A +LIE SG +GL    A +S L
Sbjct: 203 YDDIKAKITDYTHRRTTKQPLSAYSAGSTFKRPEGHFAGKLIEDSGLKGLVMKNAAVSSL 262

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           H  F+IN  +AT  ++  L   V++ V N+  ++LE E+K +G+F
Sbjct: 263 HSGFIINTGDATCEEVINLISFVKQVVSNKFNVMLEEEVKIIGEF 307


>gi|225377819|ref|ZP_03755040.1| hypothetical protein ROSEINA2194_03470 [Roseburia inulinivorans DSM
           16841]
 gi|225210330|gb|EEG92684.1| hypothetical protein ROSEINA2194_03470 [Roseburia inulinivorans DSM
           16841]
          Length = 302

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 114/290 (39%), Positives = 160/290 (55%), Gaps = 6/290 (2%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDA 78
           G F E  P+K+ T FR GG A+V+ QP +              +P + +G GSN+LV D 
Sbjct: 17  GIFMEE-PMKKHTTFRVGGPADVLVQPDETALAAVLGLCRQHHVPYSFIGNGSNLLVGDK 75

Query: 79  GIRGVVLRLSNAGFSNIEVR-NHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
           GIRGVV+ ++     +IEV+        GA  S   +AN+A  +G+GG  F  GIPGS+G
Sbjct: 76  GIRGVVIEMTEP-MGDIEVQGTRITAQAGAMLS--KIANTAASNGLGGMEFAAGIPGSVG 132

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLR 196
           GA  MNAGA   E    +  V+ +D  G Q  + R+ L   YR S I  K  I+T VVL 
Sbjct: 133 GAVVMNAGAYGGEMKDIIERVYVLDENGAQLELDRDALDLGYRHSCIPDKKYIVTKVVLE 192

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
             P  +  I + +  +   R   QP++  + GSTFK P G+ A +LI  +G RG + GGA
Sbjct: 193 LVPRDEAEIRSEMKELNEKRAEKQPLQYPSAGSTFKRPEGYFAGKLIMDAGLRGYQVGGA 252

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           ++SE HC F+IN  +AT  D+  L   V  KV  Q G++LE E+K +G+F
Sbjct: 253 QVSEKHCGFVINKGDATAADICQLMRDVSDKVQAQFGVVLEPEVKMIGEF 302


>gi|266621143|ref|ZP_06114078.1| UDP-N-acetylmuramate dehydrogenase [Clostridium hathewayi DSM
           13479]
 gi|288867213|gb|EFC99511.1| UDP-N-acetylmuramate dehydrogenase [Clostridium hathewayi DSM
           13479]
          Length = 312

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 109/279 (39%), Positives = 157/279 (56%), Gaps = 4/279 (1%)

Query: 31  TWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAGIRGVVLRLSN 89
           T FR GG A     P D  +L   + L    ++P  I+G GSN+LV D G  GVV+ ++ 
Sbjct: 27  TTFRAGGPAAYYVSPADARELGEVIRLCRREEVPYCILGNGSNLLVGDGGFDGVVISMT- 85

Query: 90  AGFSNIEV-RNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANN 148
           AGFS   V  + CE+  GA  S   +  +AL  G+ GF F  GIPG++GGA  MNAGA  
Sbjct: 86  AGFSGCTVDSDRCEIAAGAGASLSRVGKAALEAGLTGFEFAAGIPGTVGGAVVMNAGAYG 145

Query: 149 CETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFPESQNIISA 207
            ET   +     +  +G + V+   +L+  YR+S I  +  I+     R  P S+  I A
Sbjct: 146 SETKDIIESARVMTIEGEEKVLSLPELELGYRTSCIPANRYIVMEARYRLKPGSKTEIRA 205

Query: 208 AIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMI 267
            +  +   R++ QP++  + GSTFK P G+ A +LIE++G  G   GGA++S  HC F+I
Sbjct: 206 YMDELAARRKSKQPLEYPSAGSTFKRPAGNFAGKLIEEAGLAGYRVGGAEVSGKHCGFVI 265

Query: 268 NADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           N D+AT  D+  L + V++KVF  SG+ LE E+K LG F
Sbjct: 266 NRDHATASDIMTLCQDVKRKVFECSGVELEMEVKTLGTF 304


>gi|325662597|ref|ZP_08151197.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lachnospiraceae
           bacterium 4_1_37FAA]
 gi|325471094|gb|EGC74320.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lachnospiraceae
           bacterium 4_1_37FAA]
          Length = 303

 Score =  186 bits (472), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 109/284 (38%), Positives = 161/284 (56%), Gaps = 6/284 (2%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAGIRGVV 84
           PLK    FR GG A+    P+   +++  + L   + +P  I+G GSN+LV D G RGV+
Sbjct: 23  PLKNHVTFRVGGAADYFVSPESAEEVQKIILLCKEAGMPYYILGNGSNLLVSDQGYRGVI 82

Query: 85  LRLSNAGFSNIEVRNH-CEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMN 143
           +++  +  S I V+        GA  S  ++A  A    + GF F  GIPG+IGGAA MN
Sbjct: 83  IQIYKS-MSEISVKGEFVTAQAGALLS--AIAAKAAGESLAGFEFASGIPGTIGGAAVMN 139

Query: 144 AGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFPESQ 202
           AGA   E    + +V  + ++G    IPRE+L   YR+S++ K+  I+   V+      Q
Sbjct: 140 AGAYGGEMKDVLEQVTVLTKEGELLTIPREELDMGYRTSKVAKNQYIVLEAVIHLAHGEQ 199

Query: 203 NIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELH 262
             I   +  +   R T QP++  + GSTFK P G+ A +LIE++G RG + GGA++SE H
Sbjct: 200 EKIREKMNELKEKRTTKQPLEYPSAGSTFKRPEGYFAGKLIEEAGLRGFQVGGAQVSEKH 259

Query: 263 CNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           C F+IN DNAT  ++  L  QV ++V   SG+ LE E+K LG+F
Sbjct: 260 CGFVINKDNATAAEVRELIRQVSERVKANSGVTLEPEVKMLGEF 303


>gi|220933951|ref|YP_002512850.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219995261|gb|ACL71863.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 303

 Score =  185 bits (470), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 107/295 (36%), Positives = 158/295 (53%), Gaps = 3/295 (1%)

Query: 15  KQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNIL 74
           + LRG+ + + PL + T +R GG A+ +++P D+ DL +FL+ LP   P+  +GLGSN+L
Sbjct: 8   QMLRGELRHHEPLARYTSWRVGGTADQLYKPADLDDLAFFLSTLPPKEPLLWLGLGSNLL 67

Query: 75  VRDAGIRGVVLRLSNA-GFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           VRD G+RG V+ LS A     +   N      G  C+   LA  A    + G  F  GIP
Sbjct: 68  VRDGGVRGTVIALSGALNEMTLLPDNRIRAEAGVACA--KLARFAADANLTGCEFLAGIP 125

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHV 193
           G++GGA  MNAGA   ET   V  V  +DR+G +H+   ++ +  YRS     +   T  
Sbjct: 126 GTLGGALAMNAGAWGGETWTCVETVETLDRRGRRHLREADEYQVAYRSVITPVEEWFTAA 185

Query: 194 VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEF 253
             R  P       A I  +   R   QP    + GS F+NP G  A +L+E +G +G   
Sbjct: 186 TFRLTPGDGQAGKARIRELLAERAERQPTGVASCGSVFRNPPGDHAGRLVEAAGLKGHRI 245

Query: 254 GGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFD 308
           GGA++SE H NF++N  +AT  DLE L   V+  V  + G+ LE E++ +G+  +
Sbjct: 246 GGAQVSEKHANFILNTGDATAADLEALIHHVQATVEARFGVHLEPEVRMVGEPLE 300


>gi|302877581|ref|YP_003846145.1| D-alanine/D-alanine ligase [Gallionella capsiferriformans ES-2]
 gi|302580370|gb|ADL54381.1| D-alanine/D-alanine ligase [Gallionella capsiferriformans ES-2]
          Length = 631

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 109/295 (36%), Positives = 158/295 (53%), Gaps = 9/295 (3%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRGK   +  +++ T +R GG A+ ++QP D+ DL+ +L  LP D P+  VGLGSN+LVR
Sbjct: 14  LRGKLSLDQSMRRHTSWRVGGAADRVYQPADLDDLRVYLCSLPLDEPLVAVGLGSNLLVR 73

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+RG VL L +   + + ++    + V A   G  LA  A  H + G  F  GIPG++
Sbjct: 74  DGGVRGTVL-LMHGALTELAMQQDGLIYVQAGVPGAKLARFAANHDLAGAEFCAGIPGTL 132

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK------DLII 190
           GG   MNAG    E  Q+VV V  + R G   +I R   +YQ     +TK      D   
Sbjct: 133 GGMLAMNAGCYGSEIWQHVVRVQVVTRSG--ELIERASSEYQIAYRSVTKKQDGASDEFF 190

Query: 191 THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRG 250
               L        +    I  +   R + QP+     GS F+NP    A +LIE+ G +G
Sbjct: 191 VGAWLSFVQGDGQVARQNIKELLAKRISSQPLNLPNAGSVFRNPANDYAARLIEQCGLKG 250

Query: 251 LEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            + GGA++SE H NF++N DNAT  ++E L  QVR+ V  Q+G+ L  E+K +G+
Sbjct: 251 KKIGGAQVSEKHANFIVNVDNATADEIENLICQVRQTVMTQTGVDLHPEVKIIGE 305


>gi|169831591|ref|YP_001717573.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Candidatus
           Desulforudis audaxviator MP104C]
 gi|169638435|gb|ACA59941.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Candidatus
           Desulforudis audaxviator MP104C]
          Length = 300

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 112/293 (38%), Positives = 161/293 (54%), Gaps = 6/293 (2%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILV 75
           +RG  +    L   T +R GG A+   +P  I DL++ L       +P+T++G GSN+LV
Sbjct: 11  IRGSIRVGEMLGAHTTWRVGGPADYFVEPAVIEDLQFVLRFTAERGLPLTVMGNGSNLLV 70

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGA-RCSGKSLANSALRHGIGGFHFFYGIPG 134
            DAG+RGVV+R+  +G   + +  +  +  G  R S   L  +A   G+GG  F  GIP 
Sbjct: 71  SDAGLRGVVVRM-GSGMDRVVLDGNVILAQGGVRLS--RLLRTAWESGLGGLEFMAGIPA 127

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHV 193
           S+GGA  MNAGAN       V EV  +DR G        +L ++YR S I     I+T V
Sbjct: 128 SLGGAVVMNAGANGLCMGDRVEEVTMVDRSGTVQRRSAGELGFRYRWSNIQAGKEIVTAV 187

Query: 194 VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEF 253
            LR FP+ ++ I   I    + R   QP+++ + G  FKNP G SA +LIE +G +GL  
Sbjct: 188 ALRCFPKDRDEIGREIERFLNRRRETQPLEQPSAGCVFKNPPGDSAGRLIEAAGGKGLRV 247

Query: 254 GGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           GGA++S  H NF++N   AT  D+  L  QVR+ V ++ GI L  E+  +GDF
Sbjct: 248 GGAEVSYKHANFVLNTGGATARDIMELIRQVRQLVGDKFGIELGLEVNLMGDF 300


>gi|167760168|ref|ZP_02432295.1| hypothetical protein CLOSCI_02540 [Clostridium scindens ATCC 35704]
 gi|167662293|gb|EDS06423.1| hypothetical protein CLOSCI_02540 [Clostridium scindens ATCC 35704]
          Length = 310

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 110/284 (38%), Positives = 162/284 (57%), Gaps = 6/284 (2%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIRGVV 84
           P++  T FR GG AE   QP+   +++  + L    +IP  IVG GSN+LV D G RGV+
Sbjct: 30  PMRNHTTFRVGGPAEFFVQPKTAEEVQGLVGLCKEREIPYYIVGNGSNLLVSDQGFRGVI 89

Query: 85  LRLSNAGFSNIEVRNH-CEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMN 143
           +++     S I++     +   GA  S  ++A+ AL  G+ GF F  GIPG++GGA  MN
Sbjct: 90  IQIFKE-MSQIQIEGELVKAQAGALLS--AIASKALEAGLAGFEFAAGIPGALGGACVMN 146

Query: 144 AGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFPESQ 202
           AGA   E    + EV  +  +G    IP E+L+  YR+S I K   I+   V+R     +
Sbjct: 147 AGAYGKEMKDVLREVTVLTPEGEVLAIPDEKLELGYRTSIIAKKGYIVLEAVIRLQKGEK 206

Query: 203 NIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELH 262
             I A +  +   R T QP++  + GSTFK P G+ A +LI+ +G +G   GGA++S  H
Sbjct: 207 EEIKARMDELKEKRITKQPLEYPSAGSTFKRPEGYFAGKLIQDAGLQGFSVGGAQVSMKH 266

Query: 263 CNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           C F+IN DNAT  D+  L  +V ++V  + G+ LE E+KRLG+F
Sbjct: 267 CGFVINKDNATAADVAELMRKVSEQVEEKFGVRLEPEVKRLGEF 310


>gi|258514344|ref|YP_003190566.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Desulfotomaculum
           acetoxidans DSM 771]
 gi|257778049|gb|ACV61943.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Desulfotomaculum
           acetoxidans DSM 771]
          Length = 304

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 113/293 (38%), Positives = 171/293 (58%), Gaps = 4/293 (1%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILV 75
           L G+ + N P+ + T +R GG AEV+ +P  + D+K          IP+T++G GSN+LV
Sbjct: 13  LSGQLKYNEPMSRHTSWRVGGPAEVLVEPSGMVDIKTACEYARDKKIPLTVIGNGSNLLV 72

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
            D GI+G+VL++   G S+IE+ N   ++ GA      +A +A   G+GG  F  GIPG+
Sbjct: 73  SDYGIKGMVLKIGK-GLSDIEIDNET-IMAGAGAKLSRIAAAAGAAGVGGLEFMAGIPGT 130

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVV 194
           +GGA  MNAGA     SQ +  V  I++ G      +E + + YRSS + +  LI+T  V
Sbjct: 131 LGGAVVMNAGAYGKSISQVLKRVSLINQNGQVSCQEQENIIFDYRSSSLQESGLIVTEGV 190

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
           L G+   +  I   + ++   R + QP+     GS F+NP G+SA +LIE+SG +GL  G
Sbjct: 191 LEGYLRDEKQIKDDMKDMGEKRRSSQPLNYPNAGSVFRNPPGYSAGKLIEESGAKGLRVG 250

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFF 307
            A++SE H NF+IN  +AT  D+  L E+V++ V  + GI L+ EI+ LG F 
Sbjct: 251 DAQVSEKHANFIINLGSATAEDILQLIERVQRMVEKRFGIRLKKEIRVLGRFL 303


>gi|331086349|ref|ZP_08335429.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lachnospiraceae
           bacterium 9_1_43BFAA]
 gi|330406115|gb|EGG85638.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lachnospiraceae
           bacterium 9_1_43BFAA]
          Length = 303

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 108/284 (38%), Positives = 160/284 (56%), Gaps = 6/284 (2%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAGIRGVV 84
           PLK    FR GG A+    P+   +++  + L   + +P  I+G GSN+LV D G RGV+
Sbjct: 23  PLKNHVTFRVGGAADYFVSPESAEEVQKIILLCKEAGMPYYILGNGSNLLVSDQGYRGVI 82

Query: 85  LRLSNAGFSNIEVRNH-CEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMN 143
           +++  +  S I V+        GA  S  ++A  A    + GF F  GIPG+IGGAA MN
Sbjct: 83  IQIYKS-MSEISVKGEFVTAQAGALLS--AIAAKAAGESLAGFEFASGIPGTIGGAAVMN 139

Query: 144 AGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFPESQ 202
           AGA   E    + +V  + ++G    IPRE+L   YR+S++ K+  I+   V+      Q
Sbjct: 140 AGAYGGEMKDVLEQVTVLTKEGELLTIPREELDMGYRTSKVAKNQYIVLEAVIHLAHGEQ 199

Query: 203 NIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELH 262
             I   +  +   R T QP++  + GSTFK P G+ A +LI ++G RG + GGA++SE H
Sbjct: 200 EKIREKMNELKEKRTTKQPLEYPSAGSTFKRPEGYFAGKLIAEAGLRGFQVGGAQVSEKH 259

Query: 263 CNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           C F+IN DNAT  ++  L  QV ++V   SG+ LE E+K LG+F
Sbjct: 260 CGFVINKDNATAAEVRELIRQVSERVKANSGVTLEPEVKMLGEF 303


>gi|167037085|ref|YP_001664663.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|167039821|ref|YP_001662806.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           sp. X514]
 gi|300915395|ref|ZP_07132709.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           sp. X561]
 gi|307724855|ref|YP_003904606.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           sp. X513]
 gi|320115500|ref|YP_004185659.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
 gi|166854061|gb|ABY92470.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           sp. X514]
 gi|166855919|gb|ABY94327.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|300888671|gb|EFK83819.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           sp. X561]
 gi|307581916|gb|ADN55315.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           sp. X513]
 gi|319928591|gb|ADV79276.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
          Length = 301

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 117/306 (38%), Positives = 172/306 (56%), Gaps = 11/306 (3%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-S 60
           I  ++  +LRE      GK   N P+K+ T F+ GG A+V+  P +  +L   + LL   
Sbjct: 4   IVDKLKDILRE------GKLYLNEPMKRHTSFKIGGPADVLVVPNNRKELLEVIFLLKGE 57

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           +IP  I+G G+N+LV + GIRGVV++LS+    N+ V  +  +I  A      +AN AL 
Sbjct: 58  NIPFFILGNGTNLLVSEKGIRGVVIKLSS--LRNVMVEGNS-IIAEAGAPLSYIANVALV 114

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
           H + GF F  GIPG++GGA  MNAGA   E    V +V  +D KGN  ++  E++ + YR
Sbjct: 115 HELAGFEFASGIPGTLGGAIVMNAGAYGPEMKDVVEKVEVLDEKGNILILSNEEMNFSYR 174

Query: 181 SSEI-TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
            S I  KD I+    L         I + +  +   R+  QP++  + GSTFK P G+ A
Sbjct: 175 HSIIQEKDWIVLRAWLSLTKGKYEEIKSKMEELNAKRKEKQPLEYPSAGSTFKRPPGYYA 234

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LIE++G +G   GGAK+SE H  F+IN  NAT YD+  L E ++K V  + G+ L  E
Sbjct: 235 GKLIEEAGLKGYSIGGAKVSEKHSGFIINTGNATFYDVLNLIEHIQKVVKEKFGVELVPE 294

Query: 300 IKRLGD 305
           IK +G+
Sbjct: 295 IKIVGE 300


>gi|296133657|ref|YP_003640904.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermincola sp. JR]
 gi|296032235|gb|ADG83003.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermincola potens
           JR]
          Length = 302

 Score =  182 bits (463), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 107/302 (35%), Positives = 161/302 (53%), Gaps = 4/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           I R   E    + G+   N P+   T +R GG A++M  P+DI D    + L     IP 
Sbjct: 3   ICRFREELQNLISGEILVNEPMSLHTTWRIGGPADLMLIPEDIEDCWAAIKLAKKYGIPY 62

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G GSN+LV+D GIRG+V++++       E +N      G       +A  A  H + 
Sbjct: 63  LVMGNGSNLLVKDRGIRGLVIKMAAGEVKVDEEQNLIFAPAGTLLP--VVARVAADHALS 120

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIP S+GGA  MNAGA+     + V EV+ +D  G   V+P   L ++YR S I
Sbjct: 121 GLEFAVGIPASVGGAIVMNAGAHGKSIGEVVKEVNVLDSDGELLVLPGRDLDFRYRYSNI 180

Query: 185 T-KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
             K+ I+T  V          I   +      R  +QP+ +   GS FKNP G SA +LI
Sbjct: 181 LQKNFIVTKAVFLLARAPAVEIKKRMTEFLEKRRQLQPVGKPNAGSVFKNPAGTSAGRLI 240

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           + +GC+GL  G A++SE H NF++N D+AT +D+  L EQV+  V+ +  ++LE E++ +
Sbjct: 241 DAAGCKGLTVGDAQVSEKHANFILNLDSATAHDVLTLIEQVKNAVYKKFNVMLELEVQVV 300

Query: 304 GD 305
           G+
Sbjct: 301 GE 302


>gi|256752809|ref|ZP_05493652.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           ethanolicus CCSD1]
 gi|256748313|gb|EEU61374.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           ethanolicus CCSD1]
          Length = 301

 Score =  182 bits (462), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 117/306 (38%), Positives = 172/306 (56%), Gaps = 11/306 (3%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-S 60
           I  ++  +LRE      GK   N P+K+ T F+ GG A+V+  P +  +L   + LL   
Sbjct: 4   IVDKLKDILRE------GKLYLNEPMKRHTSFKIGGPADVLVVPNNRKELLEVIFLLKGE 57

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           +IP  I+G G+N+LV + GIRGVV++LS+    N+ V  +  +I  A      +AN AL 
Sbjct: 58  NIPFFILGNGTNLLVSEKGIRGVVIKLSS--LRNVIVEGN-RIIAEAGAPLSYIANVALV 114

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
           H + GF F  GIPG++GGA  MNAGA   E    V +V  +D KGN  ++  E++ + YR
Sbjct: 115 HELAGFEFASGIPGTLGGAIVMNAGAYGPEMKDVVEKVEVLDEKGNILILSNEEMNFSYR 174

Query: 181 SSEI-TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
            S I  KD I+    L         I + +  +   R+  QP++  + GSTFK P G+ A
Sbjct: 175 HSIIQEKDWIVLRAWLSLTKGKYEEIKSKMEELNAKRKEKQPLEYPSAGSTFKRPPGYYA 234

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LIE++G +G   GGAK+SE H  F+IN  NAT YD+  L E ++K V  + G+ L  E
Sbjct: 235 GKLIEEAGLKGYSIGGAKVSEKHSGFIINTGNATFYDVLNLIEHIQKVVKEKFGVELVPE 294

Query: 300 IKRLGD 305
           IK +G+
Sbjct: 295 IKIVGE 300


>gi|291615172|ref|YP_003525329.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sideroxydans
           lithotrophicus ES-1]
 gi|291585284|gb|ADE12942.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sideroxydans
           lithotrophicus ES-1]
          Length = 308

 Score =  182 bits (462), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 110/297 (37%), Positives = 160/297 (53%), Gaps = 7/297 (2%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRG+   + P+ + T +R GG A+ M++P D+ DL+ FL  +P D P+  VGLGSN+LVR
Sbjct: 14  LRGEMLHDEPMNRHTSWRAGGPAQRMYRPADLEDLQRFLQQMPDDEPLVAVGLGSNLLVR 73

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARC--SGKSLANSALRHGIGGFHFFYGIPG 134
           D G RG VL +  A     E+R   + I+ A+   +G  LA  A  + + G  FF GIPG
Sbjct: 74  DGGFRGTVLLMVGA---LAELRMDGDNIIYAQAGVAGAKLARFAASNHLYGAEFFVGIPG 130

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQ-HVIPRE-QLKYQYRSSEITKDLIITH 192
           ++GG   MNAG    ET Q V  V  + R+G      P+E ++ Y++       +     
Sbjct: 131 TLGGMLTMNAGCYGGETWQKVQRVQVLTRRGELLERTPQEYEIGYRHVLRRAAGEEFFVG 190

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
             LR            I  +   R   QP++    GS F+NP G  A +LIE  G +G  
Sbjct: 191 AWLRFEAGDVEAARQEIKALMEKRSASQPLQLPNAGSVFRNPPGRHAAKLIEDCGLKGRR 250

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDH 309
            GGA++SE H NF++NAD AT  D+E L ++VR  V  Q+GI L  E++ +G+  +H
Sbjct: 251 MGGAQVSEKHANFIVNADGATATDIENLIDEVRAVVLQQTGIDLHPEVRIIGEHANH 307


>gi|299822929|ref|ZP_07054815.1| UDP-N-acetylmuramate dehydrogenase [Listeria grayi DSM 20601]
 gi|299816458|gb|EFI83696.1| UDP-N-acetylmuramate dehydrogenase [Listeria grayi DSM 20601]
          Length = 307

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 103/303 (33%), Positives = 174/303 (57%), Gaps = 10/303 (3%)

Query: 10  LRERGKQLRGKF-----QENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIP 63
           +++  + L+ KF     +E   L + ++ +TGG A++   P+D+ + K  + L+   D+P
Sbjct: 3   MKKFAEMLQSKFPLMPLKEKESLAKYSYTKTGGQADLFAMPRDMEEAKALIALIDQHDVP 62

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           +T++G GSN+++RD GIRG+V+       S+I+ R   ++I G+     +++  A    +
Sbjct: 63  LTVIGNGSNLVIRDGGIRGIVVHFDL--LSSIK-REGTKVIAGSGAKIIAVSEFACNESL 119

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            G  F  GIPGS+GGA YMNAGA   E SQ +VE   +D+ GN   + +E L   YR+S 
Sbjct: 120 SGLEFACGIPGSVGGALYMNAGAYGGEISQVLVEATVLDQSGNLLHLEKEDLTASYRNST 179

Query: 184 IT-KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
           I  K+ I+   V +       +I A +  +   RE  QP++  + GS FK P G+ A +L
Sbjct: 180 IANKNYIVLEAVFQLELAEMAVIRAQMDELTALREAKQPLEYPSCGSVFKRPPGYFAGKL 239

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           I+ +G +GL+ GGA++SE H  F++N D+AT  D   +   V+K +  +  ++LE E+K 
Sbjct: 240 IQDAGLQGLQIGGAQVSEKHAGFIVNVDHATATDYMDVIHHVQKVIKEKFDVILETEVKI 299

Query: 303 LGD 305
           +G+
Sbjct: 300 IGE 302


>gi|297545054|ref|YP_003677356.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
 gi|296842829|gb|ADH61345.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
          Length = 301

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 116/306 (37%), Positives = 171/306 (55%), Gaps = 11/306 (3%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD 61
           I  ++  +LRE      GK   N P+K+ T F+ GG A+V+  P +  +L   + LL  +
Sbjct: 4   IIDKLKDILRE------GKLYLNEPMKRHTSFKIGGPADVLVVPNNRKELLEIIPLLKQE 57

Query: 62  -IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
            IP  I+G G+N+LV + GIRGVV++LS+    N+ V  +  +I  A      +AN AL 
Sbjct: 58  NIPFFILGNGTNLLVSEKGIRGVVIKLSS--LRNVIVEGN-RIIAEAGAPLSYIANVALV 114

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
           H + GF F  GIPG++GGA  MNAGA   E    V +V  +D +GN  ++  E++ + YR
Sbjct: 115 HELAGFEFASGIPGTLGGAIVMNAGAYGSEMKDVVEKVEVLDGEGNILILSNEEMNFSYR 174

Query: 181 SSEI-TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
            S I  KD I+    L         I + +  +   R   QP++  + GSTFK P G+ A
Sbjct: 175 YSIIHEKDWIVLRAWLSLAKGKYEEIKSKMEELNAKRREKQPLEYPSAGSTFKRPPGYYA 234

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LIE++G +G   GGAK+SE H  F+IN  NAT YD+  L E ++K V  + G+ L  E
Sbjct: 235 GKLIEEAGLKGYSIGGAKVSEKHSGFIINTGNATFYDVLNLIEHIQKVVKEKFGVELVPE 294

Query: 300 IKRLGD 305
           IK +G+
Sbjct: 295 IKIIGE 300


>gi|289578834|ref|YP_003477461.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           italicus Ab9]
 gi|289528547|gb|ADD02899.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           italicus Ab9]
          Length = 301

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 115/306 (37%), Positives = 172/306 (56%), Gaps = 11/306 (3%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-S 60
           I  ++  +LRE      GK   N P+K+ T F+ GG A+V+  P +  +L   ++LL   
Sbjct: 4   IIDKLKDILRE------GKLYLNEPMKRHTSFKIGGPADVLVVPNNRKELLEAISLLKRE 57

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           +IP  I+G G+N+LV + GIRGVV++LS+    N+ V  +  +I  A      +AN AL 
Sbjct: 58  NIPFFILGNGTNLLVSEKGIRGVVIKLSS--LRNVVVEGN-RIIAEAGAPLSYIANVALV 114

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
           H + GF F  GIPG++GGA  MNAGA   E    + +V  +D +GN  ++  E++ + YR
Sbjct: 115 HELAGFEFASGIPGTLGGAIVMNAGAYGSEMKDVIEKVEVLDGEGNILILSNEEMNFSYR 174

Query: 181 SSEI-TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
            S I  KD I+    L         I + +  +   R   QP++  + GSTFK P G+ A
Sbjct: 175 YSIIHEKDWIVLRAWLSLAKGKYEEIKSKMEELNAKRREKQPLEYPSAGSTFKRPPGYYA 234

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LIE++G +G   GGAK+SE H  F+IN  NAT YD+  L E ++K V  + G+ L  E
Sbjct: 235 GKLIEEAGLKGYSIGGAKVSEKHSGFIINTGNATFYDVLNLIEHIQKVVKEKFGVELVPE 294

Query: 300 IKRLGD 305
           IK +G+
Sbjct: 295 IKIIGE 300


>gi|307265907|ref|ZP_07547456.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           wiegelii Rt8.B1]
 gi|326390954|ref|ZP_08212504.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           ethanolicus JW 200]
 gi|306919076|gb|EFN49301.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           wiegelii Rt8.B1]
 gi|325992996|gb|EGD51438.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           ethanolicus JW 200]
          Length = 301

 Score =  179 bits (455), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 115/306 (37%), Positives = 173/306 (56%), Gaps = 11/306 (3%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-S 60
           I  ++  +LRE      GK   N P+K+ T F+ GG A+V+  P +  +L   ++LL   
Sbjct: 4   IVDKLKDILRE------GKLYLNEPMKRHTSFKIGGPADVLVVPNNRKELLEAISLLKRE 57

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           +IP  I+G G+N+LV + GIRGVV++LS+    N+ V  +  +I  A      +AN AL 
Sbjct: 58  NIPFFILGNGTNLLVSEKGIRGVVIKLSS--LRNVIVEGN-RIIAEAGAPLSYIANVALV 114

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
           H + GF F  GIPG++GGA  MNAGA   E    V +V  +D +GN  ++  E++ + YR
Sbjct: 115 HELAGFEFASGIPGTLGGAIVMNAGAYGPEMKDVVEKVEVLDGEGNILILSNEEMNFSYR 174

Query: 181 SSEI-TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
            S I  KD I+    L         I + +  +   R+  QP++  + GSTFK P G+ A
Sbjct: 175 HSIIQEKDWIVLRAWLSLTKGKYEEIKSKMEELNAKRKEKQPLEYPSAGSTFKRPPGYYA 234

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LIE++G +G   GGAK+SE H  F+IN  NAT YD+  L E ++K V  + G+ L  E
Sbjct: 235 GKLIEEAGLKGYSIGGAKVSEKHSGFIINTGNATFYDVLNLIEHIQKVVKEKFGVELVPE 294

Query: 300 IKRLGD 305
           I+ +G+
Sbjct: 295 IRIIGE 300


>gi|302385502|ref|YP_003821324.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           saccharolyticum WM1]
 gi|302196130|gb|ADL03701.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           saccharolyticum WM1]
          Length = 303

 Score =  179 bits (455), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 105/283 (37%), Positives = 155/283 (54%), Gaps = 5/283 (1%)

Query: 27  LKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRGVVL 85
           +++ T FR GG A     P D  +L   + L    ++P  I+G GSN+LV D G  GVV+
Sbjct: 23  MRKHTSFRVGGPAACFVIPADETELSGVMALCREEEVPFFILGNGSNLLVGDEGFDGVVI 82

Query: 86  RLSNAGFSNIEVRNHCEMIV-GARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
            + +  F + +V     ++  GA  S K +A  A +  + GF F  GIPG++GGA  MNA
Sbjct: 83  SMDS--FCSCQVNKETGIVTAGAGASLKRIAQEAYKASLTGFEFAAGIPGTLGGAVVMNA 140

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLRGFPESQN 203
           GA   E  + +  V  +   G    +P +QL   YR+S I  K  ++    +R     + 
Sbjct: 141 GAYGSEMKEVLKSVRVMTAGGEVRDLPADQLSLGYRTSCIIPKQYVVLEARIRLRDGDEV 200

Query: 204 IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHC 263
            I   +  +   R   QP++  + GSTFK P G+ A +LIE++G RG   GGA++SE HC
Sbjct: 201 SIKNRMDELAGRRREKQPLEYPSAGSTFKRPEGYFAGKLIEEAGLRGFSLGGAQVSEKHC 260

Query: 264 NFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
            F+IN D+AT  D+  L E+V+K+VF  SG+ LE E+K LG F
Sbjct: 261 GFVINKDHATAADIRDLCEEVKKRVFKNSGVALEMEVKTLGKF 303


>gi|323140619|ref|ZP_08075543.1| UDP-N-acetylmuramate dehydrogenase [Phascolarctobacterium sp. YIT
           12067]
 gi|322414883|gb|EFY05678.1| UDP-N-acetylmuramate dehydrogenase [Phascolarctobacterium sp. YIT
           12067]
          Length = 300

 Score =  179 bits (453), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 104/282 (36%), Positives = 158/282 (56%), Gaps = 4/282 (1%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRGVV 84
           P+ + T FR GG A++M  PQ   +L+  L     S +P+T++G GSN+LVRD GIRG+V
Sbjct: 20  PMAKHTSFRIGGPADLMAMPQSEQELQQLLQRAGESKVPVTLIGNGSNLLVRDKGIRGLV 79

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           ++L N    N  V + C +  G+  S  + +  A   G+ G  F  GIPGSIGGA YMNA
Sbjct: 80  IKLGN--MLNDVVADGCTLTFGSGVSLAAASRKAAELGLSGMEFAVGIPGSIGGAVYMNA 137

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLRGFPESQN 203
           GA + E ++ V  V  ++  G    +    L + YR + +     I+T V +R     + 
Sbjct: 138 GAYDGEMAKVVTGVRVMELDGTISELAAAALDFGYRHTALQGSGKIVTAVTVRLTAGDKQ 197

Query: 204 IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHC 263
            I+  +A+  + R T QP++  + GS FK P+G+ A  LI+++G +G   GGA++SE H 
Sbjct: 198 AIADKMADFSNRRITKQPLELPSAGSMFKRPSGYFAGTLIDQTGLKGYTVGGAQVSEKHA 257

Query: 264 NFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            F++N   AT  D+  L   V+ KVF   G+ LE E+  LG+
Sbjct: 258 GFVVNIGGATAADVLQLICDVQDKVFAAHGVHLEPEVLVLGE 299


>gi|311068044|ref|YP_003972967.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus atrophaeus
           1942]
 gi|310868561|gb|ADP32036.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus atrophaeus
           1942]
          Length = 303

 Score =  179 bits (453), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 106/303 (34%), Positives = 173/303 (57%), Gaps = 5/303 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           + ++++E   +  GK  EN PL   T  + GG A+++  P  +  +K  + ++   DI  
Sbjct: 1   MEKVIQELKDREVGKVLENEPLANHTTMKIGGPADILVIPNRVEAVKDIMDIIKKHDIKW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T++G GSN+LV D GIRGVV++L  AG  ++E+ N  ++ VG   S   LA S  + G+ 
Sbjct: 61  TVIGRGSNLLVLDEGIRGVVIKLG-AGLDHLEL-NEDQVAVGGGYSVVRLATSMSKKGLS 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGSIGGA YMNAGA+  + S+ +V+ H +   G    + +E++++ YR+S +
Sbjct: 119 GLEFAAGIPGSIGGAVYMNAGAHGSDMSEILVKAHILFEDGTIKWLTKEEMEFSYRTSVL 178

Query: 185 TKDL--IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
            K    +    VL+   + +  I   + N   +R+  QP      GS F+NP  + A  L
Sbjct: 179 QKKRPGVCLEAVLQLEQKDREGIVQQMQNNKDYRKNTQPYSSPCAGSIFRNPLPNHAGNL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           +EK+G +G + GGAKISE+H NF++NA  A+  D+  L + V+K +  Q  I +  E++ 
Sbjct: 239 VEKAGLKGYQIGGAKISEMHGNFIVNAGGASAKDVLDLIDYVKKTIREQYEIDMHTEVEI 298

Query: 303 LGD 305
           +G+
Sbjct: 299 VGE 301


>gi|288939896|ref|YP_003442136.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Allochromatium
           vinosum DSM 180]
 gi|288895268|gb|ADC61104.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Allochromatium
           vinosum DSM 180]
          Length = 294

 Score =  179 bits (453), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 104/287 (36%), Positives = 148/287 (51%), Gaps = 1/287 (0%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRG++Q + PL + T +R GG A  ++QP D  DL  F+  L  D P+  +GLGSN+LV 
Sbjct: 4   LRGRWQFDEPLSRHTSWRVGGPARRLYQPADADDLVGFMRQLDPDEPLLWLGLGSNLLVD 63

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           DAG  G V+ L+      +E+R    +      S   LA  A RH + G  F  GIPG++
Sbjct: 64  DAGFPGTVI-LTQGTLDTLELRGERRLYAEVGVSSAKLARFAARHDLTGIEFLAGIPGTL 122

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGA   ET  +V  V  +DR+G  H     + +  YR              L 
Sbjct: 123 GGALAMNAGAWGGETWSFVRRVWTLDRQGQIHEREASEYEPAYREIRGPAGEWFLAAELE 182

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
             P       A I  +   R   QP+ + + GS F+NP G  A +LI+  G +G   GGA
Sbjct: 183 LTPGDGAASLARIRELLDQRAATQPVGQPSCGSVFRNPPGDHAARLIDSLGLKGTRIGGA 242

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           ++S +H NF+IN   AT  D+  L EQ+++ V   +GI L  E++R+
Sbjct: 243 EVSSIHANFIINRGGATATDIARLIEQIQETVERHTGIRLMPEVRRI 289


>gi|187776685|ref|ZP_02993158.1| hypothetical protein CLOSPO_00200 [Clostridium sporogenes ATCC
           15579]
 gi|187775344|gb|EDU39146.1| hypothetical protein CLOSPO_00200 [Clostridium sporogenes ATCC
           15579]
          Length = 298

 Score =  179 bits (453), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 111/283 (39%), Positives = 158/283 (55%), Gaps = 7/283 (2%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAGIRGVV 84
           P+K  T F+ GG A+++  P  +  +K  + L   S IP  I+G GSN+LVRD G+RGVV
Sbjct: 17  PMKNHTSFKVGGPADLLITPTTLEQVKDSIVLCKNSSIPYYIIGNGSNLLVRDGGLRGVV 76

Query: 85  LRLSNAGFSNIEVRNHCEMI-VGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMN 143
           ++ S  G  NI+V     M   GA  +  ++ N AL+  +GG  F  GIPGS+GGA  MN
Sbjct: 77  IKFSKLG--NIKVEGDRVMAQSGAPLT--NICNEALKSNLGGLEFACGIPGSVGGAVTMN 132

Query: 144 AGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGFPESQ 202
           AGA N E SQ +     ID+ GN  ++ +EQL   YR S I K   I+  V  R      
Sbjct: 133 AGAYNGEISQVIESAKVIDKDGNVFLLNKEQLDLGYRMSAIQKYHYIVLEVTFRLHNSEY 192

Query: 203 NIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELH 262
           + I   I ++   R   QP++  + GSTFK P GH A +LIE +G +G   GGA++S+ H
Sbjct: 193 DTIKNRIMDLNRRRTEKQPLEYPSAGSTFKRPEGHFAAKLIEDTGLKGKSIGGAQVSQKH 252

Query: 263 CNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
             F+IN   AT  D+  L E V+ KV  +  + L  E++ +G+
Sbjct: 253 SGFIINKGGATAGDILNLIEFVQNKVKEKFEVDLHTEVRIIGE 295


>gi|291536777|emb|CBL09889.1| UDP-N-acetylmuramate dehydrogenase [Roseburia intestinalis M50/1]
          Length = 302

 Score =  179 bits (453), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 106/282 (37%), Positives = 156/282 (55%), Gaps = 3/282 (1%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDAGIRGVVL 85
           P+K+ T FR GG A+++ QP+              D+P  ++G GSN+LV D GIRG+V+
Sbjct: 23  PMKKHTTFRVGGPADILVQPKGTELAAVIRLCRKYDVPYQVIGNGSNLLVGDRGIRGLVI 82

Query: 86  RLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAG 145
            + +     I V + C + VGA       AN A  HG+ G  F  GIPGSIGGA  MNAG
Sbjct: 83  EMLSKE-DEICVEDDC-ITVGAGMLLSKTANRAAEHGLIGMEFAAGIPGSIGGAVVMNAG 140

Query: 146 ANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFPESQNI 204
           A   E    +  V  +D++GN+ ++  E+L+  YR+S I K   I+T   ++     +  
Sbjct: 141 AYGGEMKDILTAVTVLDQEGNEKILSAEELELGYRTSCILKKGYIVTGAKIKLKHGEETA 200

Query: 205 ISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCN 264
           ISA +  +   R   QP++  + GSTFK P G+ A +LI  +G RG + G A++SE HC 
Sbjct: 201 ISARMEELKKQRVEKQPLEYPSAGSTFKRPEGYFAGKLIMDAGLRGYQVGDAQVSEKHCG 260

Query: 265 FMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           F+IN  NAT  D+  L + V   V  +  + LE E+K +G+F
Sbjct: 261 FVINRGNATAADVRTLMQNVSDIVEEKFDVRLEPEVKMIGEF 302


>gi|303231928|ref|ZP_07318636.1| UDP-N-acetylmuramate dehydrogenase [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302513357|gb|EFL55391.1| UDP-N-acetylmuramate dehydrogenase [Veillonella atypica
           ACS-049-V-Sch6]
          Length = 310

 Score =  178 bits (452), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 166/288 (57%), Gaps = 4/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFL-TLLPSDIPITIVGLGSNILVRDA 78
           + +E   L+  T F+ GG A++  +P  + +L + L T+   D+P+TI+G GSNILV+D 
Sbjct: 24  RVREEEYLRHHTTFKIGGPADLFVEPTTMAELSFALRTIHEFDVPVTIIGCGSNILVKDG 83

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIRG V+ + +   + I   N   + +G+    K  +  A  +G+ G  F  GIPG++GG
Sbjct: 84  GIRGAVVSVRH--MTQIMDCNDNVLCIGSGYMLKDASEFAWENGLTGLEFAIGIPGTLGG 141

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRG 197
           A +MNAGA + E S  V  V  +D +GN        L + YR S    +  +I  V++  
Sbjct: 142 AVFMNAGAYDGEMSHVVTAVRAVDFQGNIKEYDASHLDFGYRHSVFHDNHEVIGEVIMTL 201

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P  +N+I A +  +   RE+ QP++  + GSTFK P G+ A  LIE++G +GL  G A+
Sbjct: 202 KPGDKNVIKARMDELTEKRESKQPLEFASAGSTFKRPPGYFAGTLIEQTGLKGLSVGDAQ 261

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S  H  F+IN  +A+  D+  L  +V+++V++Q G+ LE E++ +G+
Sbjct: 262 VSHKHAGFVINTGSASAKDVLDLIAEVQRRVYDQHGVHLEPEVRMIGE 309


>gi|303230280|ref|ZP_07317047.1| UDP-N-acetylmuramate dehydrogenase [Veillonella atypica
           ACS-134-V-Col7a]
 gi|302515063|gb|EFL57038.1| UDP-N-acetylmuramate dehydrogenase [Veillonella atypica
           ACS-134-V-Col7a]
          Length = 310

 Score =  178 bits (452), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 166/288 (57%), Gaps = 4/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFL-TLLPSDIPITIVGLGSNILVRDA 78
           + +E   L+  T F+ GG A++  +P  + +L + L T+   D+P+TI+G GSNILV+D 
Sbjct: 24  RVREEEYLRHHTTFKIGGPADLFVEPTTMAELSFALRTVHEFDVPVTIIGCGSNILVKDG 83

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIRG V+ + +   + I   N   + +G+    K  +  A  +G+ G  F  GIPG++GG
Sbjct: 84  GIRGAVVSVRH--MTQIMDCNDNVLCIGSGYMLKDASEFAWENGLTGLEFAIGIPGTLGG 141

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRG 197
           A +MNAGA + E S  V  V  +D +GN        L + YR S    +  +I  V++  
Sbjct: 142 AVFMNAGAYDGEMSHVVTAVRAVDFQGNIKEYDASHLDFGYRHSVFHDNHEVIGEVIMTL 201

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P  +N+I A +  +   RE+ QP++  + GSTFK P G+ A  LIE++G +GL  G A+
Sbjct: 202 KPGDKNVIKARMDELTEKRESKQPLEFASAGSTFKRPPGYFAGTLIEQTGLKGLSVGDAQ 261

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S  H  F+IN  +A+  D+  L  +V+++V++Q G+ LE E++ +G+
Sbjct: 262 VSHKHAGFVINTGSASAKDVLDLIAEVQRRVYDQHGVHLEPEVRMIGE 309


>gi|114321340|ref|YP_743023.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|122311124|sp|Q0A6K4|MURB_ALHEH RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|114227734|gb|ABI57533.1| UDP-N-acetylmuramate dehydrogenase [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 298

 Score =  178 bits (452), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 109/290 (37%), Positives = 150/290 (51%), Gaps = 8/290 (2%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDA 78
           G+ +   P+ + T +R GG AE +++P  + DL  FL  LP D P+   GLGSN+LVR+ 
Sbjct: 11  GELRHWEPMARYTSWRAGGPAERLYRPAGLADLVAFLRRLPEDEPLFWCGLGSNLLVREG 70

Query: 79  GIRGVVLRLSNAGFSNIEVRN---HCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           G+RG V+ L+  G   + V     H E   G  C    L+   +R G+ G  FF GIPG+
Sbjct: 71  GLRGTVI-LTQGGLDALRVEGEQVHAE--AGVACG--RLSRYCIRQGLAGAEFFAGIPGT 125

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           +GGA  MNAGA   ET   V  V  +DR G       E  +  YR             VL
Sbjct: 126 LGGALAMNAGAFGGETWSRVRRVETVDRHGVLRRRGPEDFRVGYRHVSGPAGEWFVAAVL 185

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
              P     + A +  +   R   QPI E + GS F+NP G  A +LIE +G +GL  G 
Sbjct: 186 DLEPGDAQAMQARVKALLSQRNRTQPIGEPSCGSVFRNPPGDHAARLIEAAGLKGLRRGA 245

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           A++SE H NF+IN   AT  D+E L EQVR +V  + G+ L  E+  +G+
Sbjct: 246 AQVSERHANFIINTGGATPADIEALIEQVRDEVARRHGVTLVPEVHIVGE 295


>gi|168181971|ref|ZP_02616635.1| UDP-N-acetylmuramate dehydrogenase [Clostridium botulinum Bf]
 gi|237796837|ref|YP_002864389.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           botulinum Ba4 str. 657]
 gi|259509757|sp|C3KV11|MURB_CLOB6 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|182674781|gb|EDT86742.1| UDP-N-acetylmuramate dehydrogenase [Clostridium botulinum Bf]
 gi|229260592|gb|ACQ51625.1| UDP-N-acetylmuramate dehydrogenase [Clostridium botulinum Ba4 str.
           657]
          Length = 306

 Score =  178 bits (452), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 107/282 (37%), Positives = 157/282 (55%), Gaps = 5/282 (1%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIRGVV 84
           P+K+ T F+ GG A+++  P  +  +K  + L  ++ IP  I+G GSN+LVRD GIRGVV
Sbjct: 25  PMKKHTSFKVGGPADLLITPTTLEQVKDSIILCRNNSIPYYIIGNGSNLLVRDGGIRGVV 84

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           ++    G   +EV     +I  +     ++ N AL+  +GG  F  GIPGS+GGA  MNA
Sbjct: 85  IKFLKLGDIKVEVD---RVIAQSGAPLTNICNEALKSNLGGLEFACGIPGSVGGAVTMNA 141

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGFPESQN 203
           GA N E SQ +     ID+ GN  ++ +EQL   YR S I K   I+  V  +      +
Sbjct: 142 GAYNGEISQVIESAKVIDKDGNVFLLNKEQLDLGYRMSAIQKYHYIVLEVTFKLHNSEYD 201

Query: 204 IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHC 263
            I   I ++   R   QP++  + GSTFK P GH A +LIE +G +G   GGA++SE H 
Sbjct: 202 TIKNRIMDLNRRRTEKQPLEYPSAGSTFKRPEGHFAAKLIEDTGLKGKSIGGAQVSEKHS 261

Query: 264 NFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            F+IN   AT  D+  L E V+ KV  +  + L  E++ +G+
Sbjct: 262 GFIINKGGATAGDILNLIEFVQNKVKEKFQVDLHTEVRIIGE 303


>gi|197116891|ref|YP_002137318.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacter
           bemidjiensis Bem]
 gi|197086251|gb|ACH37522.1| UDP-N-acetylenolpyruvylglucosamine reductase [Geobacter
           bemidjiensis Bem]
          Length = 300

 Score =  178 bits (451), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 106/290 (36%), Positives = 154/290 (53%), Gaps = 4/290 (1%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDL-KYFLTLLPSDIPITIVGLGSNILV 75
           +RG  + + P+ Q T  + GG A++ F+P D+ DL +    LL + IP  ++G G N+LV
Sbjct: 13  VRGTVKWDEPMWQHTSLKVGGPADLYFEPADLPDLHETVEKLLAAKIPYLVLGGGYNLLV 72

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD GIRG V+ L       +E++    + VGA  +  +L   A  H +GG  F  GIPGS
Sbjct: 73  RDGGIRGCVISLKK--LDTLEMQPGARLEVGAGVTNSTLCRFAAEHCLGGMEFLSGIPGS 130

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
            GGA  MNAGA   ET Q V E     R+G   V    +L++ YR   +    I+    L
Sbjct: 131 FGGALTMNAGAQGGETLQRV-ETLITLREGKLLVRKAAELEFGYRYLRLLPGEIVLGAKL 189

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           R  P  + II   +      R   Q +     GS FKNP+G  AW+LI+++G RG+  GG
Sbjct: 190 RLEPAERRIIEERMQANIARRSGTQRVTYPNAGSFFKNPSGRHAWELIDRAGMRGVTVGG 249

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           A++SE H NF++N   A   D   L   V+ +V   SG+ LE E++ +G+
Sbjct: 250 AQVSEAHTNFLVNRGGACAADFTSLAALVKLRVKETSGVDLEEEVRLVGE 299


>gi|167768137|ref|ZP_02440190.1| hypothetical protein CLOSS21_02692 [Clostridium sp. SS2/1]
 gi|167709661|gb|EDS20240.1| hypothetical protein CLOSS21_02692 [Clostridium sp. SS2/1]
 gi|291560166|emb|CBL38966.1| UDP-N-acetylmuramate dehydrogenase [butyrate-producing bacterium
           SSC/2]
          Length = 302

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 107/286 (37%), Positives = 164/286 (57%), Gaps = 10/286 (3%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIRGVV 84
           P+K  T FR GG A++   P+++ ++K        + IP+ ++G GSN+LV D G+ G+V
Sbjct: 22  PMKNHTTFRIGGPADIFVAPENMEEIKAVSRFAKEEGIPLFVLGNGSNLLVADDGMDGIV 81

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           L++    +S IEVR + E+IV A     S + +AL   + GF F  GIPG+ GGA  MNA
Sbjct: 82  LQIYK-NYSGIEVRGN-ELIVKAGTLLSSTSRAALNEELTGFEFAGGIPGTFGGAVVMNA 139

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGF----PE 200
           GA   E  Q + EV  + ++G    +  E+L+  YR+S + K+    +VVL G       
Sbjct: 140 GAYGGEMVQVLKEVTVLTKEGEIKTLKAEELELGYRTSNVLKN---EYVVLEGVIALKKG 196

Query: 201 SQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISE 260
           ++  I A +      R+T QP++  + GSTFK P G+ A +LI+ +G +G + G A++SE
Sbjct: 197 NKEEIKAKMDEYALARKTKQPLEYPSAGSTFKRPEGYFAGKLIQDAGLKGYQVGDAQVSE 256

Query: 261 LHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
            H  F+IN  NAT  D+  L   V+ KV  Q G+ +E E+KR+G F
Sbjct: 257 KHSGFVINRGNATASDVMQLISDVKDKVKEQFGVTMEPEVKRVGRF 302


>gi|153852656|ref|ZP_01994093.1| hypothetical protein DORLON_00066 [Dorea longicatena DSM 13814]
 gi|149754298|gb|EDM64229.1| hypothetical protein DORLON_00066 [Dorea longicatena DSM 13814]
          Length = 310

 Score =  177 bits (450), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 113/309 (36%), Positives = 166/309 (53%), Gaps = 15/309 (4%)

Query: 8   RLLRERGKQLRGKFQE-----NFPLKQITWFRTGGNAEVMFQPQDIHDL-KYFLTLLPSD 61
           R+ +E GK+L    +E     + P+K  T FR GG A+    PQ   ++ K         
Sbjct: 7   RMNQELGKKLLSILKEEQVKKDEPMKSHTTFRVGGPADYFVTPQTAEEVAKVIEACTQEK 66

Query: 62  IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRN---HCEMIVGARCSGKSLANSA 118
           +P  IVG GSN+LV D G  GV++++     + ++V     H +   GA  S   +A  A
Sbjct: 67  VPYYIVGNGSNLLVSDKGYEGVIIQIYKQ-MNQVKVEGAQIHAQ--AGALLS--MIAKRA 121

Query: 119 LRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQ 178
           L   + GF F  GIPG++GGA  MNAGA   E    +  V  +  KG    + +E+L+  
Sbjct: 122 LDAELTGFEFAAGIPGTLGGACVMNAGAYGGEMKDVLKSVTVLTGKGEVKTLAKEELELG 181

Query: 179 YRSSEITKD-LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGH 237
           YR+S I K   I+   VL      +  I A + ++   R T QP++  + GSTFK P G+
Sbjct: 182 YRTSVIAKKGYIVLEAVLELQKGEKEKIQAVMDDLKERRVTKQPLEYPSAGSTFKRPEGY 241

Query: 238 SAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLE 297
            A +LI+ +G RG + GGA++SE HC F+IN D AT  D+  L  QV  KV+ + G+ L+
Sbjct: 242 FAGKLIQDAGLRGFQVGGAQVSEKHCGFVINKDQATASDVMNLMNQVSDKVYEEFGVRLQ 301

Query: 298 WEIKRLGDF 306
            E+KRLG+F
Sbjct: 302 PEVKRLGEF 310


>gi|317495440|ref|ZP_07953809.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Gemella moribillum
           M424]
 gi|316914499|gb|EFV35976.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Gemella moribillum
           M424]
          Length = 300

 Score =  177 bits (450), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 105/284 (36%), Positives = 164/284 (57%), Gaps = 4/284 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTL-LPSDIPITIVGLGSNILVRDAGIRG 82
           N PLK+ ++ +TGGNAEV+ + +   D +  +       I +TI+G GSN+L+ D GI G
Sbjct: 19  NEPLKKYSFTKTGGNAEVLVRVKTEEDFQNIIKYSYDHKIELTILGNGSNVLISDTGISG 78

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           +V+  S+   +NIE+     +   A  + K L +  + + +    F  GIPGS+GGA +M
Sbjct: 79  IVVITSD--MNNIELSEENILSCYAGTTLKELTDFCIENSLTNLEFSCGIPGSVGGAIFM 136

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFPES 201
           NAGA   E  + V +V   DRKGN+ V   E + + YR S I +   II+ V  +    +
Sbjct: 137 NAGAYGGEMKEVVEKVEIFDRKGNKKVYSNEDMNFSYRHSVIQETGEIISKVYFKMIDGN 196

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
           +  I A +  +   RE  QP++  + GS FK P G+ A +LI+ +G +GL  GGA++S  
Sbjct: 197 KEEIIARVNELNKMREEKQPLEYPSCGSVFKRPVGYFAGKLIQDAGLQGLTVGGAQVSTK 256

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           H  FM+N +NAT  D + L ++V+++VF  SG+ LE E+K LG+
Sbjct: 257 HAGFMVNINNATCEDYKNLIKKVQEEVFKHSGVKLECEVKVLGE 300


>gi|317499773|ref|ZP_07958028.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lachnospiraceae
           bacterium 5_1_63FAA]
 gi|316892939|gb|EFV15166.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lachnospiraceae
           bacterium 5_1_63FAA]
          Length = 302

 Score =  177 bits (450), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 107/286 (37%), Positives = 164/286 (57%), Gaps = 10/286 (3%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIRGVV 84
           P+K  T FR GG A++   P+++ ++K        + IP+ ++G GSN+LV D G+ G+V
Sbjct: 22  PMKNHTTFRIGGPADIFVAPENMEEIKAVSCFAKEEGIPLFVLGNGSNLLVADDGMDGIV 81

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           L++    +S IEVR + E+IV A     S + +AL   + GF F  GIPG+ GGA  MNA
Sbjct: 82  LQIYK-NYSGIEVRGN-ELIVKAGTLLSSTSRAALNEELTGFEFAGGIPGTFGGAVVMNA 139

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGF----PE 200
           GA   E  Q + EV  + ++G    +  E+L+  YR+S + K+    +VVL G       
Sbjct: 140 GAYGGEMVQVLKEVTVLTKEGEIKTLKAEELELGYRTSNVLKN---EYVVLEGVIALKKG 196

Query: 201 SQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISE 260
           ++  I A +      R+T QP++  + GSTFK P G+ A +LI+ +G +G + G A++SE
Sbjct: 197 NKEEIKAKMDEYALARKTKQPLEYPSAGSTFKRPEGYFAGKLIQDAGLKGYQVGDAQVSE 256

Query: 261 LHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
            H  F+IN  NAT  D+  L   V+ KV  Q G+ +E E+KR+G F
Sbjct: 257 KHSGFVINRGNATASDVMQLISDVKDKVKEQFGVTMEPEVKRVGRF 302


>gi|88811836|ref|ZP_01127089.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrococcus mobilis
           Nb-231]
 gi|88790720|gb|EAR21834.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrococcus mobilis
           Nb-231]
          Length = 299

 Score =  177 bits (450), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 102/293 (34%), Positives = 159/293 (54%), Gaps = 2/293 (0%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRD 77
           RG  +EN P+++ T +R GG A+  F+P D+ DL  F+  LP+  P+  +GLGSN+LVRD
Sbjct: 5   RGTLRENEPMRRHTSWRAGGYAKRFFEPADVEDLVAFVRQLPATEPVVWLGLGSNLLVRD 64

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G+RG V++   A  +  ++   C + +GA  +   +A + +R G+ G  F  GIPG++G
Sbjct: 65  GGVRGTVIQTRTALTALEQLPGGC-VRIGAGVACAKVARACVRWGLAGAEFLIGIPGTVG 123

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRG 197
           GA  MNAGA   ET   VV +  +DR G +H     + +  YR+       +     LR 
Sbjct: 124 GALAMNAGAWGAETWSRVVALETLDRDGVRHRRSPGEYRVGYRTVSAPGPEVFLGATLRF 183

Query: 198 FPESQ-NIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
            P      + A +  +   R   QP+   + GS F+NP G  A +LIE++G +G  FG A
Sbjct: 184 EPGGDPQALHARVRALLARRGATQPLGRPSCGSVFRNPPGDFAARLIEQAGLKGRGFGEA 243

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDH 309
            +S  H NF++N   AT  D+E L   VR ++ +  G+ L+ E+  +G+   H
Sbjct: 244 CVSTKHANFILNHGAATAADIERLIGYVRGRIRDLYGVELQTEVCIVGEAPSH 296


>gi|260684907|ref|YP_003216192.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           difficile CD196]
 gi|260688565|ref|YP_003219699.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           difficile R20291]
 gi|260211070|emb|CBA66437.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           difficile CD196]
 gi|260214582|emb|CBE07144.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           difficile R20291]
          Length = 317

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 111/289 (38%), Positives = 168/289 (58%), Gaps = 18/289 (6%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIRGVV 84
           P+K+   FR GG A+++ +P+    LK  L L+  + IP  I+G GSNIL++D GIRGVV
Sbjct: 37  PMKKHISFRVGGPADILVRPRTEEQLKNVLKLVKEESIPYLIIGNGSNILIKDGGIRGVV 96

Query: 85  LRLSNAGFSNIEVRNHCEMIV--GARCS--GKSLANSALRHGIGGFHFFYGIPGSIGGAA 140
           + L++  F++ E+ N   M    GA  S  GK+L    L+    GF F  GIPG++GGA 
Sbjct: 97  IELAD-NFNSYEI-NDTRMTAQSGALLSVLGKALQKQELK----GFEFASGIPGTLGGAL 150

Query: 141 YMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPE 200
            MNAGA   E    V  V  +D +GN   +  EQ+++ YR S I+K+    ++ L    E
Sbjct: 151 AMNAGAYGGEMKDIVKSVRLMDMEGNIFELSNEQMEFGYRKSIISKN---GYIALSAELE 207

Query: 201 SQ----NIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
            Q    + I + + ++   R T QP+   + GSTFK PTG+ A +LIE++G RGL   GA
Sbjct: 208 LQEGNYDEIKSLMDDLATRRITKQPLNFASAGSTFKRPTGYFAGKLIEETGLRGLTLRGA 267

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           ++SE HC F++N   A+  D+  L   ++  V+ + G++LE E+K LG+
Sbjct: 268 QVSEKHCGFVVNQGEASAKDILDLIYVIKSAVYAKFGVMLEEEVKILGE 316


>gi|255102605|ref|ZP_05331582.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           difficile QCD-63q42]
 gi|255308431|ref|ZP_05352602.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           difficile ATCC 43255]
          Length = 304

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 111/289 (38%), Positives = 168/289 (58%), Gaps = 18/289 (6%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIRGVV 84
           P+K+   FR GG A+++ +P+    LK  L L+  + IP  I+G GSNIL++D GIRGVV
Sbjct: 24  PMKKHISFRVGGPADILVRPRTEEQLKNVLKLVKKESIPYLIIGNGSNILIKDGGIRGVV 83

Query: 85  LRLSNAGFSNIEVRNHCEMIV--GARCS--GKSLANSALRHGIGGFHFFYGIPGSIGGAA 140
           + L++  F++ E+ N   M    GA  S  GK+L    L+    GF F  GIPG++GGA 
Sbjct: 84  IELAD-NFNSYEI-NDTRMTAQSGALLSVLGKALQKQELK----GFEFASGIPGTLGGAL 137

Query: 141 YMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPE 200
            MNAGA   E    V  V  +D +GN   +  EQ+++ YR S I+K+    ++ L    E
Sbjct: 138 AMNAGAYGGEMKDIVKSVRLMDMEGNIFELSNEQMEFGYRKSIISKN---GYIALSAELE 194

Query: 201 SQ----NIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
            Q    + I + + ++   R T QP+   + GSTFK PTG+ A +LIE++G RGL   GA
Sbjct: 195 LQEGNYDEIKSLMDDLATRRITKQPLNFASAGSTFKRPTGYFAGKLIEETGLRGLTLRGA 254

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           ++SE HC F++N   A+  D+  L   ++  V+ + G++LE E+K LG+
Sbjct: 255 QVSEKHCGFVVNQGEASAKDILDLIYVIKSAVYAKFGVMLEEEVKILGE 303


>gi|126701025|ref|YP_001089922.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           difficile 630]
 gi|254977024|ref|ZP_05273496.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           difficile QCD-66c26]
 gi|255094351|ref|ZP_05323829.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           difficile CIP 107932]
 gi|255316104|ref|ZP_05357687.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           difficile QCD-76w55]
 gi|255518765|ref|ZP_05386441.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           difficile QCD-97b34]
 gi|255651943|ref|ZP_05398845.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           difficile QCD-37x79]
 gi|123173714|sp|Q180P9|MURB_CLOD6 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|115252462|emb|CAJ70305.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           difficile]
          Length = 304

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 111/289 (38%), Positives = 168/289 (58%), Gaps = 18/289 (6%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIRGVV 84
           P+K+   FR GG A+++ +P+    LK  L L+  + IP  I+G GSNIL++D GIRGVV
Sbjct: 24  PMKKHISFRVGGPADILVRPRTEEQLKNVLKLVKEESIPYLIIGNGSNILIKDGGIRGVV 83

Query: 85  LRLSNAGFSNIEVRNHCEMIV--GARCS--GKSLANSALRHGIGGFHFFYGIPGSIGGAA 140
           + L++  F++ E+ N   M    GA  S  GK+L    L+    GF F  GIPG++GGA 
Sbjct: 84  IELAD-NFNSYEI-NDTRMTAQSGALLSVLGKALQKQELK----GFEFASGIPGTLGGAL 137

Query: 141 YMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPE 200
            MNAGA   E    V  V  +D +GN   +  EQ+++ YR S I+K+    ++ L    E
Sbjct: 138 AMNAGAYGGEMKDIVKSVRLMDMEGNIFELSNEQMEFGYRKSIISKN---GYIALSAELE 194

Query: 201 SQ----NIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
            Q    + I + + ++   R T QP+   + GSTFK PTG+ A +LIE++G RGL   GA
Sbjct: 195 LQEGNYDEIKSLMDDLATRRITKQPLNFASAGSTFKRPTGYFAGKLIEETGLRGLTLRGA 254

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           ++SE HC F++N   A+  D+  L   ++  V+ + G++LE E+K LG+
Sbjct: 255 QVSEKHCGFVVNQGEASAKDILDLIYVIKSAVYAKFGVMLEEEVKILGE 303


>gi|153939546|ref|YP_001392734.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           botulinum F str. Langeland]
 gi|168178940|ref|ZP_02613604.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           botulinum NCTC 2916]
 gi|170759800|ref|YP_001788707.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           botulinum A3 str. Loch Maree]
 gi|226950828|ref|YP_002805919.1| UDP-N-acetylmuramate dehydrogenase [Clostridium botulinum A2 str.
           Kyoto]
 gi|166222836|sp|A7GIX4|MURB_CLOBL RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|254764149|sp|C1FMJ6|MURB_CLOBJ RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|254764167|sp|B1L271|MURB_CLOBM RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|152935442|gb|ABS40940.1| UDP-N-acetylmuramate dehydrogenase [Clostridium botulinum F str.
           Langeland]
 gi|169406789|gb|ACA55200.1| UDP-N-acetylmuramate dehydrogenase [Clostridium botulinum A3 str.
           Loch Maree]
 gi|182670013|gb|EDT81989.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           botulinum NCTC 2916]
 gi|226840987|gb|ACO83653.1| UDP-N-acetylmuramate dehydrogenase [Clostridium botulinum A2 str.
           Kyoto]
 gi|295320715|gb|ADG01093.1| UDP-N-acetylmuramate dehydrogenase [Clostridium botulinum F str.
           230613]
 gi|322807701|emb|CBZ05276.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           botulinum H04402 065]
          Length = 306

 Score =  176 bits (447), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 107/282 (37%), Positives = 158/282 (56%), Gaps = 5/282 (1%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIRGVV 84
           P+K+ T F+ GG A+++  P  +  +K  + L  ++ IP  I+G GSN+LVRD GIRGVV
Sbjct: 25  PMKKHTSFKVGGPADLLITPTTLEQVKDSIILCRNNSIPYYIIGNGSNLLVRDGGIRGVV 84

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           ++    G  +I+V     +I  +     ++ N AL+  +GG  F  GIPGS+GGA  MNA
Sbjct: 85  IKFLKLG--DIKVEGD-RVIAQSGAPLTNICNEALKSNLGGLEFACGIPGSVGGAVTMNA 141

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGFPESQN 203
           GA N E SQ +     ID+ GN  ++ +EQL   YR S I K   I+  V  +      +
Sbjct: 142 GAYNGEISQVIESAKVIDKDGNVFLLNKEQLDLGYRMSAIQKYHYIVLEVTFKLHNSEYD 201

Query: 204 IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHC 263
            I   I ++   R   QP++  + GSTFK P GH A +LIE +G +G   GGA++SE H 
Sbjct: 202 TIKNRIMDLNRRRTEKQPLEYPSAGSTFKRPEGHFAAKLIEDTGLKGESIGGAQVSEKHS 261

Query: 264 NFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            F+IN   AT  D+  L E V+ KV  +  + L  E++ +G+
Sbjct: 262 GFIINKGGATAGDILNLIEFVQNKVMEKFQVDLHTEVRIIGE 303


>gi|148381319|ref|YP_001255860.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           botulinum A str. ATCC 3502]
 gi|153933962|ref|YP_001385695.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           botulinum A str. ATCC 19397]
 gi|153934775|ref|YP_001389101.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           botulinum A str. Hall]
 gi|166222834|sp|A7FYX2|MURB_CLOB1 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|166222835|sp|A5I7A3|MURB_CLOBH RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|148290803|emb|CAL84937.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           botulinum A str. ATCC 3502]
 gi|152930006|gb|ABS35506.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           botulinum A str. ATCC 19397]
 gi|152930689|gb|ABS36188.1| UDP-N-acetylmuramate dehydrogenase [Clostridium botulinum A str.
           Hall]
          Length = 306

 Score =  176 bits (447), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 107/282 (37%), Positives = 158/282 (56%), Gaps = 5/282 (1%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIRGVV 84
           P+K+ T F+ GG A+++  P  +  +K  + L  ++ IP  I+G GSN+LVRD GIRGVV
Sbjct: 25  PMKKHTSFKVGGPADLLITPTTLEQVKDSIILCRNNSIPYYIIGNGSNLLVRDGGIRGVV 84

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           ++    G  +I+V     +I  +     ++ N AL+  +GG  F  GIPGS+GGA  MNA
Sbjct: 85  IKFLKLG--DIKVEGD-RVIAQSGAPLTNICNEALKSNLGGLEFACGIPGSVGGAVTMNA 141

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGFPESQN 203
           GA N E SQ +     ID+ GN  ++ +EQL   YR S I K   I+  V  +      +
Sbjct: 142 GAYNGEISQVIESAKVIDKDGNVFLLNKEQLDLGYRMSAIQKYHYIVLEVTFKLHNSEYD 201

Query: 204 IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHC 263
            I   I ++   R   QP++  + GSTFK P GH A +LIE +G +G   GGA++SE H 
Sbjct: 202 TIKNRIMDLNRRRTEKQPLEYPSAGSTFKRPEGHFAAKLIEDTGLKGESIGGAQVSEKHS 261

Query: 264 NFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            F+IN   AT  D+  L E V+ KV  +  + L  E++ +G+
Sbjct: 262 GFIINKGGATAGDILNLIEFVQNKVMEKFEVDLHTEVRIIGE 303


>gi|226325343|ref|ZP_03800861.1| hypothetical protein COPCOM_03136 [Coprococcus comes ATCC 27758]
 gi|225206086|gb|EEG88440.1| hypothetical protein COPCOM_03136 [Coprococcus comes ATCC 27758]
          Length = 303

 Score =  176 bits (447), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 106/289 (36%), Positives = 160/289 (55%), Gaps = 4/289 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDA 78
           K Q++ P+K+ T FR GG A+    P +  +L   + +     IPI IVG GSN+LV D 
Sbjct: 17  KIQKDEPMKKHTTFRIGGPADYFIMPSNEKELAETIRVCREFSIPIYIVGNGSNLLVGDK 76

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           G RG +++L  +     +V  + ++   A CS   +AN+AL   + GF F  GIPG++GG
Sbjct: 77  GFRGAIIQLYKS-MGTFQVEGN-QITAQAGCSLAQIANAALDAALTGFEFAAGIPGTLGG 134

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLRG 197
           A  MNAGA   E    +  V  +  +G    +P E+L   YR+S I  K  I+   V+  
Sbjct: 135 AVVMNAGAYGGEMKDVLTSVRVMTEEGEIMELPAEKLGLGYRTSIIPEKRYIVLGAVISL 194

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
               +  I A + ++   R + QP++  + GSTFK P G+ A +LI+ SG +G   GGA+
Sbjct: 195 TEGKKEEIKAQMDDLRQKRVSKQPLEYPSAGSTFKRPEGYFAGKLIQDSGLKGFTVGGAQ 254

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           +SE H  F+IN  NAT  D+  L  QV  KV   +G+ +E E+K++G+F
Sbjct: 255 VSEKHSGFVINKGNATAADVMELIRQVTAKVKEDTGVTMEPEVKQIGEF 303


>gi|205373272|ref|ZP_03226076.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           coahuilensis m4-4]
          Length = 302

 Score =  176 bits (446), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 103/289 (35%), Positives = 165/289 (57%), Gaps = 5/289 (1%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFL-TLLPSDIPITIVGLGSNILVRD 77
           G  + N PLK  T  + GG A+++ +P  I  ++  +  ++  +IP T++G GSN+LV D
Sbjct: 14  GNVKYNEPLKYHTTIKIGGPADILIEPYSIEAIEKIMKVIIKGEIPWTVIGRGSNLLVSD 73

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            GI GVVL+L N G  +I++ N  ++ VGA  S   LA    + G+ GF F  GIPGS+G
Sbjct: 74  KGIEGVVLKL-NKGLDHIDI-NENQVTVGAGYSLIVLATQLSKKGLKGFEFAGGIPGSVG 131

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL--IITHVVL 195
           GA YMNAGA+  + S  +V+   +   G    + +E++KY YR+S + K    I+   + 
Sbjct: 132 GAVYMNAGAHGMDLSTILVKAKVLFDDGTISWVTKEEMKYSYRTSVLQKKRPGIVLEAIF 191

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           +     ++ I   +     +R+  QP      GS F+NP    A +LIE +G +G   GG
Sbjct: 192 QLEAGDKHSIQNEMQVNKDYRKETQPWSNPCAGSIFRNPLPEYAGRLIETAGLKGYTIGG 251

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           AKIS+LH NF++N  NA+  D+  L + +++ +++  GI +E EI+ +G
Sbjct: 252 AKISDLHGNFIVNNGNASAEDVRKLIQYIQQTIYDLYGIRMETEIEIIG 300


>gi|291549785|emb|CBL26047.1| UDP-N-acetylmuramate dehydrogenase [Ruminococcus torques L2-14]
          Length = 301

 Score =  176 bits (446), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 108/294 (36%), Positives = 163/294 (55%), Gaps = 14/294 (4%)

Query: 22  QENF----PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVR 76
           QEN     P+K+ T FR GG A+    P+   +++  + L    +IP +++G GSN+LV 
Sbjct: 13  QENVMKDEPMKKHTTFRIGGPADYFVTPESKEEIQAIVELCKKEEIPYSVIGNGSNLLVG 72

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G RGV+L++     + I V  + ++  GA      +A +AL   + GF F  GIPG++
Sbjct: 73  DKGYRGVILQIFKK-MNQIRVEEN-KIYAGAGALLSKIAATALSESLTGFEFAAGIPGTL 130

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVL 195
           GGA  MNAGA   E  Q +  V  +   G    IP E++   YR+S +  K+ I+   V+
Sbjct: 131 GGAVRMNAGAYGGEMKQVLESVEVMTVDGEFLTIPVEEMGLAYRTSVVEQKNYIVLEAVI 190

Query: 196 ---RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
              +G PE    I   + ++   R T QP++  + GSTFK P G+ A +LIE +G RG  
Sbjct: 191 SLEKGNPEK---IKEVMDDLKEKRVTKQPLEYASAGSTFKRPEGYFAGKLIEDAGLRGFR 247

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
            G A++SE HC F+IN  NA+  ++  L  QV  KV   SG+ LE E++R+G+F
Sbjct: 248 VGDAQVSEKHCGFVINRGNASAAEVMELMRQVEDKVEENSGVRLEAEVRRIGEF 301


>gi|292490626|ref|YP_003526065.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrosococcus
           halophilus Nc4]
 gi|291579221|gb|ADE13678.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrosococcus
           halophilus Nc4]
          Length = 298

 Score =  176 bits (446), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 103/293 (35%), Positives = 152/293 (51%), Gaps = 1/293 (0%)

Query: 14  GKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNI 73
           G   RG+ Q+   +   T +R GG A  +++P D+ DL  FL  LP D P++ +GLGSN+
Sbjct: 6   GASFRGQLQQQVSMGGYTSWRVGGPARCLYRPADVDDLMAFLGSLPEDEPLSWLGLGSNL 65

Query: 74  LVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           LVRD GI G V+ ++ A  + IE R+   + V A      LA    R G+ G  F  GIP
Sbjct: 66  LVRDGGIEGTVIAIAGA-LNRIERRSATTVWVEAGVPCAKLAKFCAREGLRGAEFMAGIP 124

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHV 193
           G++GGA  MNAGA   ET + V  V  +   G +H    ++ +  YR     K       
Sbjct: 125 GTVGGALAMNAGAFGRETWELVTAVETVGVGGRRHRRRPQEYQVGYREVHRPKGEWFIAA 184

Query: 194 VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEF 253
            LR            I ++  HR + QP ++   GS F+NP    A +LIE  G +G+  
Sbjct: 185 ELRLAQGDSQAAQQQIRHLLRHRNSCQPTQQPCAGSVFRNPPNDKAGRLIESCGLKGVSI 244

Query: 254 GGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           GGA++SE H NF++N  +A   D+E+L + V + V  + G+ L  E+  +GD 
Sbjct: 245 GGAQVSEKHANFIVNTGDAAAADIEHLIQLVAETVARRRGVTLVPEVHVVGDL 297


>gi|313893157|ref|ZP_07826734.1| UDP-N-acetylmuramate dehydrogenase [Veillonella sp. oral taxon 158
           str. F0412]
 gi|313442510|gb|EFR60925.1| UDP-N-acetylmuramate dehydrogenase [Veillonella sp. oral taxon 158
           str. F0412]
          Length = 310

 Score =  176 bits (446), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 103/302 (34%), Positives = 167/302 (55%), Gaps = 13/302 (4%)

Query: 15  KQLRGKFQENFPLKQI---------TWFRTGGNAEVMFQPQDIHDLKYFL-TLLPSDIPI 64
           K L+    E  P  ++         T F+ GG A++  +P  + +L + L T+    +P+
Sbjct: 10  KALKEALLEKLPSTRVREQELLCHHTTFKIGGPADLFIEPTTMDELSFTLRTIHELQVPV 69

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           TI+G GSNILV+D GIRG V+ + +   + I   N   + +G+    K  +  A  +G+ 
Sbjct: 70  TIIGCGSNILVKDGGIRGAVVSVRH--MTQIMDCNDNVLCIGSGYMLKDASEFAWENGLS 127

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPG++GGA +MNAGA + E S  V  V  +D +GN        L + YR S  
Sbjct: 128 GLEFAIGIPGTLGGAVFMNAGAYDGEMSNVVTTVRAVDFQGNIKEYDASHLDFGYRHSVF 187

Query: 185 TKD-LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
             +  +I  V++   P  ++ I A +  +   RE+ QP++  + GSTFK P G+ A  LI
Sbjct: 188 HDNHEVIGEVIMTLQPGDKDAIKARMDELTEKRESKQPLEYASAGSTFKRPPGYFAGTLI 247

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           E++G +GL  G A++S+ H  F+IN  NA   D+  L ++V+K+V++Q G+ LE E++ +
Sbjct: 248 EQTGLKGLSVGDAQVSQKHAGFVINTGNAKAKDVLDLIKEVQKRVYHQHGVHLEPEVRMI 307

Query: 304 GD 305
           G+
Sbjct: 308 GE 309


>gi|296451831|ref|ZP_06893550.1| UDP-N-acetylmuramate dehydrogenase [Clostridium difficile NAP08]
 gi|296879773|ref|ZP_06903747.1| UDP-N-acetylmuramate dehydrogenase [Clostridium difficile NAP07]
 gi|296259310|gb|EFH06186.1| UDP-N-acetylmuramate dehydrogenase [Clostridium difficile NAP08]
 gi|296429244|gb|EFH15117.1| UDP-N-acetylmuramate dehydrogenase [Clostridium difficile NAP07]
          Length = 317

 Score =  176 bits (446), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 110/289 (38%), Positives = 168/289 (58%), Gaps = 18/289 (6%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIRGVV 84
           P+K+   FR GG A+++ +P+    LK  L L+  + IP  I+G GSNIL++D GIRGVV
Sbjct: 37  PMKKHISFRVGGPADILVRPRTEEQLKNVLKLVKKESIPYLIIGNGSNILIKDGGIRGVV 96

Query: 85  LRLSNAGFSNIEVRNHCEMIV--GARCS--GKSLANSALRHGIGGFHFFYGIPGSIGGAA 140
           + L++  F++ E+ N   M    GA  S  GK+L    L+    GF F  GIPG++GGA 
Sbjct: 97  IELAD-NFNSYEI-NDTRMTAQSGALLSVLGKALQKQELK----GFEFASGIPGTLGGAL 150

Query: 141 YMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPE 200
            MNAGA   E    V  V  +D +GN   +  +Q+++ YR S I+K+    ++ L    E
Sbjct: 151 AMNAGAYGGEMKDIVKSVRVMDMEGNIFELSNKQMEFGYRKSIISKN---GYIALSAELE 207

Query: 201 SQ----NIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
            Q    + I + + ++   R T QP+   + GSTFK PTG+ A +LIE++G RGL   GA
Sbjct: 208 LQEGNYDEIKSLMDDLATRRITKQPLNFASAGSTFKRPTGYFAGKLIEETGLRGLTLRGA 267

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           ++SE HC F++N   A+  D+  L   ++  V+ + G++LE E+K LG+
Sbjct: 268 QVSEKHCGFVVNQGEASAKDILDLIYVIKSAVYAKFGVMLEEEVKILGE 316


>gi|255657354|ref|ZP_05402763.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           difficile QCD-23m63]
          Length = 304

 Score =  176 bits (446), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 110/289 (38%), Positives = 168/289 (58%), Gaps = 18/289 (6%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIRGVV 84
           P+K+   FR GG A+++ +P+    LK  L L+  + IP  I+G GSNIL++D GIRGVV
Sbjct: 24  PMKKHISFRVGGPADILVRPRTEEQLKNVLKLVKKESIPYLIIGNGSNILIKDGGIRGVV 83

Query: 85  LRLSNAGFSNIEVRNHCEMIV--GARCS--GKSLANSALRHGIGGFHFFYGIPGSIGGAA 140
           + L++  F++ E+ N   M    GA  S  GK+L    L+    GF F  GIPG++GGA 
Sbjct: 84  IELAD-NFNSYEI-NDTRMTAQSGALLSVLGKALQKQELK----GFEFASGIPGTLGGAL 137

Query: 141 YMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPE 200
            MNAGA   E    V  V  +D +GN   +  +Q+++ YR S I+K+    ++ L    E
Sbjct: 138 AMNAGAYGGEMKDIVKSVRVMDMEGNIFELSNKQMEFGYRKSIISKN---GYIALSAELE 194

Query: 201 SQ----NIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
            Q    + I + + ++   R T QP+   + GSTFK PTG+ A +LIE++G RGL   GA
Sbjct: 195 LQEGNYDEIKSLMDDLATRRITKQPLNFASAGSTFKRPTGYFAGKLIEETGLRGLTLRGA 254

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           ++SE HC F++N   A+  D+  L   ++  V+ + G++LE E+K LG+
Sbjct: 255 QVSEKHCGFVVNQGEASAKDILDLIYVIKSAVYAKFGVMLEEEVKILGE 303


>gi|255658212|ref|ZP_05403621.1| UDP-N-acetylmuramate dehydrogenase [Mitsuokella multacida DSM
           20544]
 gi|260849521|gb|EEX69528.1| UDP-N-acetylmuramate dehydrogenase [Mitsuokella multacida DSM
           20544]
          Length = 305

 Score =  176 bits (445), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 101/290 (34%), Positives = 167/290 (57%), Gaps = 7/290 (2%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDA 78
           +F+ + P+K  T F+ GG A+ +  P  + + +  L L+ +  +P+TI+G GSN+LV+D 
Sbjct: 18  RFRLDEPMKLHTTFKIGGPADCLIFPASMEETEKVLALVSAYKLPLTILGNGSNVLVQDK 77

Query: 79  GIRGVVLRLSNAGFSNIEVRNH-CEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
           GIRGVV++ +       ++R+    +I GA    K ++ +A +  + G  F  GIPGSIG
Sbjct: 78  GIRGVVVKFAR---PMAKIRHEGTRIIAGAGALLKDVSEAAAQSSLTGLEFACGIPGSIG 134

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLR 196
           GA +MNAGA + E       V  +DR+G  H   R++L   YR S    +   I  V L 
Sbjct: 135 GAIFMNAGAYDGEMKNVADTVRTVDREGKIHTYSRDELDLGYRHSRFQDNGEAIVEVELC 194

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
             P     I A + +    RE+ QP++  + GSTFK P G+ A  LI+++G +GL+ GGA
Sbjct: 195 LEPGDSEAIRAKMEDFTERRESKQPLEMPSAGSTFKRPKGYFAGTLIQETGLKGLQVGGA 254

Query: 257 KISELHCNFMINAD-NATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           ++S  H  F++NA  +AT  D+  L  +V+++V+ + G++L  E++ +G+
Sbjct: 255 QVSTKHAGFVVNATGDATAADVRGLIHEVQQRVYKKHGVMLHPEVRIIGE 304


>gi|197302640|ref|ZP_03167694.1| hypothetical protein RUMLAC_01370 [Ruminococcus lactaris ATCC
           29176]
 gi|197298222|gb|EDY32768.1| hypothetical protein RUMLAC_01370 [Ruminococcus lactaris ATCC
           29176]
          Length = 301

 Score =  176 bits (445), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 107/285 (37%), Positives = 157/285 (55%), Gaps = 8/285 (2%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRGVV 84
           P+ + T FR GG A+    PQ + +++  L +    ++P  IVG GSN+LV D G RGVV
Sbjct: 21  PMCRHTTFRVGGPADYFVTPQSVEEIRGILAVCRKENVPYYIVGNGSNLLVGDGGFRGVV 80

Query: 85  LRLSNAGFSNI-EVRNHCEMIVG-ARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           L++    F  + +VR   E +   A      +A++A    + G  F  GIPG++GGA  M
Sbjct: 81  LQI----FKKMNDVRVEGERVTAQAGVLLSKVASAAYNASLTGLEFAAGIPGTLGGAVRM 136

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLRGFPES 201
           NAGA   E  Q +     + ++G    IP E+L   YR+S +  KD ++    LR     
Sbjct: 137 NAGAYGGEMKQVLESAVVLTQEGELLTIPVEELGLAYRTSVVEKKDYVVVEATLRLKKGD 196

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
           Q  I   + ++   R T QP++  + GSTFK P G+ A +LIE +G RG   G A++SE 
Sbjct: 197 QAAIREVMDDLKQRRVTKQPLEFGSAGSTFKRPKGYFAGKLIEDAGLRGFRIGDAQVSEK 256

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           HC F+IN  NAT   +  L ++V KKV   SG+ LE E+KR+G+F
Sbjct: 257 HCGFVINRGNATAAQVCELMQEVVKKVKETSGVTLEPEVKRIGEF 301


>gi|170756034|ref|YP_001783015.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           botulinum B1 str. Okra]
 gi|254764160|sp|B1IFW4|MURB_CLOBK RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|169121246|gb|ACA45082.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           botulinum B1 str. Okra]
          Length = 306

 Score =  176 bits (445), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 107/282 (37%), Positives = 158/282 (56%), Gaps = 5/282 (1%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIRGVV 84
           P+K+ T F+ GG A+++  P  +  +K  + L  ++ IP  I+G GSN+LVRD GIRGVV
Sbjct: 25  PMKKHTSFKVGGPADLLITPTTLEQVKDSIILCRNNSIPYYIIGNGSNLLVRDGGIRGVV 84

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           ++    G  +I+V     +I  +     ++ N AL+  +GG  F  GIPGS+GGA  MNA
Sbjct: 85  IKFLKLG--DIKVEGD-RVIAQSGAPLTNICNEALKSNLGGLEFACGIPGSVGGAVTMNA 141

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGFPESQN 203
           GA N E SQ +     ID+ GN  ++ +EQL   YR S I K   I+  V  +      +
Sbjct: 142 GAYNGEISQVIESAKVIDKDGNVFLLNKEQLDLGYRMSAIQKYHYIVLEVTFKLHNSEYD 201

Query: 204 IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHC 263
            I   I ++   R   QP++  + GSTFK P GH A +LIE +G +G   GGA++SE H 
Sbjct: 202 TIKNRIMDLNRRRIEKQPLEYPSAGSTFKRPEGHFAAKLIEDTGLKGESIGGAQVSEKHS 261

Query: 264 NFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            F+IN   AT  D+  L E V+ KV  +  + L  E++ +G+
Sbjct: 262 GFIINKGGATAGDILNLIEFVQNKVMEKFQVDLHTEVRIIGE 303


>gi|240143362|ref|ZP_04741963.1| UDP-N-acetylmuramate dehydrogenase [Roseburia intestinalis L1-82]
 gi|257204735|gb|EEV03020.1| UDP-N-acetylmuramate dehydrogenase [Roseburia intestinalis L1-82]
 gi|291539850|emb|CBL12961.1| UDP-N-acetylmuramate dehydrogenase [Roseburia intestinalis XB6B4]
          Length = 302

 Score =  176 bits (445), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 105/282 (37%), Positives = 154/282 (54%), Gaps = 3/282 (1%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDAGIRGVVL 85
           P+K+ T FR GG A+++ QP+              D+P  ++G GSN+LV D GIRG+V+
Sbjct: 23  PMKKHTTFRVGGPADILVQPKGTELAAVIRLCRKYDVPYQVIGNGSNLLVGDRGIRGLVI 82

Query: 86  RLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAG 145
            + +     I V + C + VGA       AN A  HG+ G  F  GIPG IGGA  MNAG
Sbjct: 83  EMLSKE-DEICVEDDC-ITVGAGMLLSKTANRAAEHGLTGMEFAAGIPGRIGGAVVMNAG 140

Query: 146 ANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFPESQNI 204
           A   E    +  V  +D++GN+ ++  E+L+  YR+S I K   I+T   ++     +  
Sbjct: 141 AYGGEMKDILTAVTVLDQEGNEKILSAEELELGYRTSCILKKGYIVTGAKIKLKHGEETA 200

Query: 205 ISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCN 264
           I A +  +   R   QP++  + GSTFK P G+ A +LI  +G RG   G A++SE HC 
Sbjct: 201 IRARMEELKKQRVEKQPLEYPSAGSTFKRPEGYFAGKLIMDAGLRGYLVGEAQVSEKHCG 260

Query: 265 FMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           F+IN  NAT  D+  L + V   V  + G+ LE E+K +G+F
Sbjct: 261 FVINRGNATAADVRTLMQNVADIVEEKFGVRLEPEVKMIGEF 302


>gi|210621614|ref|ZP_03292727.1| hypothetical protein CLOHIR_00672 [Clostridium hiranonis DSM 13275]
 gi|210154679|gb|EEA85685.1| hypothetical protein CLOHIR_00672 [Clostridium hiranonis DSM 13275]
          Length = 311

 Score =  176 bits (445), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 107/283 (37%), Positives = 162/283 (57%), Gaps = 6/283 (2%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIRGVV 84
           P+K+   FR GG A+V+ +P++   LK  L  +  + IP  ++G GSN+LV+D GIRG+V
Sbjct: 24  PMKKHASFRVGGPADVLVRPRNEEHLKDILLYIKKENIPYLVIGNGSNLLVKDGGIRGIV 83

Query: 85  LRLSNAGFSNIEV-RNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMN 143
           + +S+  +S+ ++  N  E+  GA  S   + N+AL+  + GF F  GIPGS GGA  MN
Sbjct: 84  VEISD-NYSDFKIDENRIEIQAGALLS--RIGNAALKAELKGFEFASGIPGSFGGALAMN 140

Query: 144 AGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLRGFPESQ 202
           AGA   E    V  V  +D  GN   +  E++ + YR S I  K+ I    V+     S 
Sbjct: 141 AGAYGGEIKDIVKTVKVMDIDGNIFELSNEEMNFGYRKSAIVEKNYIALSAVVELEKGSY 200

Query: 203 NIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELH 262
           + I A + ++   R + QP+   + GSTFK P G+ A +LI+ SG +GL  G A++SE H
Sbjct: 201 DDIKATMDDLKERRTSKQPLNFASAGSTFKRPEGYFAGKLIQDSGLKGLSIGDAQVSEKH 260

Query: 263 CNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
             F+IN  NAT  +L  L   V+  V  + G++LE E+K +G+
Sbjct: 261 SGFVINRGNATAKELLDLMFAVKATVNAKFGVMLEEEVKIVGE 303


>gi|282850621|ref|ZP_06260000.1| UDP-N-acetylmuramate dehydrogenase [Veillonella parvula ATCC 17745]
 gi|282580114|gb|EFB85518.1| UDP-N-acetylmuramate dehydrogenase [Veillonella parvula ATCC 17745]
          Length = 309

 Score =  175 bits (444), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 98/288 (34%), Positives = 163/288 (56%), Gaps = 4/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDA 78
           + +E   L   T F+ GG A++  +P  + +L + L ++   D+P+TI+G GSNILV+D 
Sbjct: 23  RVREQELLSHHTTFKIGGPADLFIEPTTMAELSFTLRIIHELDVPVTIIGCGSNILVKDG 82

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIRG V+ + +   + I   N   + +G+    K  +  A  + + G  F  GIPG++GG
Sbjct: 83  GIRGAVVSVRH--MTQIMDCNENTLCIGSGYMLKDASEFAWENSLSGLEFAIGIPGTLGG 140

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRG 197
           A +MNAGA + E S  V  V  +D +GN        L + YR S    +  +I  V++  
Sbjct: 141 AVFMNAGAYDGEMSHVVTAVRAVDFQGNIKEYDASHLDFAYRHSVFHDNHEVIGEVIMTL 200

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P  ++ I A +  +   RE+ QP++  + GSTFK P G+ A  LIE++G +GL  G A+
Sbjct: 201 KPGDKDAIKARMDELTEKRESKQPLEYASAGSTFKRPPGYFAGTLIEQTGLKGLSVGDAQ 260

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S  H  F+IN  +A+  D+  L  +V+++V++Q G+ LE E++ +G+
Sbjct: 261 VSHKHAGFVINTGSASAKDVLDLISEVQRRVYDQHGVHLEPEVRMIGE 308


>gi|302389415|ref|YP_003825236.1| UDP-N-acetylmuramate dehydrogenase [Thermosediminibacter oceani DSM
           16646]
 gi|302200043|gb|ADL07613.1| UDP-N-acetylmuramate dehydrogenase [Thermosediminibacter oceani DSM
           16646]
          Length = 304

 Score =  175 bits (444), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 110/289 (38%), Positives = 163/289 (56%), Gaps = 6/289 (2%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDA 78
           + + N  +K  T FR GG A++M  PQ   ++K  L L    DIP+ I+G G+N+LVRD 
Sbjct: 18  RVKMNELMKHHTSFRIGGPADIMVLPQSSEEIKKALMLCRQKDIPVFIMGNGTNLLVRDK 77

Query: 79  GIRGVVLRLSNAGFSNIEVR-NHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
           GIRGVV++++   F+++EV+ N      G   S   +A  AL + + G  F  GIPG++G
Sbjct: 78  GIRGVVIKIAQ-NFNDVEVKGNTIRSKAGVFLS--VVARIALENHLSGLEFAAGIPGTVG 134

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLR 196
           GA  MNAGA   E +  + EV  +D  G    + +E+L++ YR   + K   I+    L 
Sbjct: 135 GAIIMNAGAYGGEMADVIKEVVVMDFNGEIFSMKKEELEFGYRWCNLQKGGKIVLEAELE 194

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
             P +   I   +  +   R   QP+   + GS FK PTG+ A  LIEK+G +G + GGA
Sbjct: 195 LKPGNYEDIKLKMEELSAKRRMKQPLNMPSAGSAFKRPTGNYAGALIEKAGLKGFKVGGA 254

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            IS+LH  F++N  NAT  D+  L   +++KV  + GILLE EIK +G+
Sbjct: 255 MISDLHAGFIVNTGNATAEDVLKLIGIIQRKVKEEFGILLEPEIKVVGE 303


>gi|164686683|ref|ZP_02210711.1| hypothetical protein CLOBAR_00278 [Clostridium bartlettii DSM
           16795]
 gi|164604073|gb|EDQ97538.1| hypothetical protein CLOBAR_00278 [Clostridium bartlettii DSM
           16795]
          Length = 304

 Score =  175 bits (443), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 106/283 (37%), Positives = 159/283 (56%), Gaps = 6/283 (2%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIRGVV 84
           P+K+   FR GG A+++ +P+    L   L  +  + +P  I+G GSN+LV+D GIRG+V
Sbjct: 24  PMKKHISFRVGGPADILVRPRTEEQLSQILKYIDENALPYLIIGNGSNLLVKDGGIRGIV 83

Query: 85  LRLSNAGFSNIEVR-NHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMN 143
           +   +  F+N E+  N  +   GA  +   L  +ALR  + GF    GIPGS+GG   MN
Sbjct: 84  IEFGD-NFNNFEIDGNIIKAQAGALLA--VLGKAALREELTGFECISGIPGSLGGGLAMN 140

Query: 144 AGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLRGFPESQ 202
           AGA   E    V  V  ++ KG       E++K++YR S +T  D I+   VL     + 
Sbjct: 141 AGAYGGEIKSVVKSVRVMNPKGEIFEFSNEEMKFEYRRSILTNSDYIVLSAVLELQKGNY 200

Query: 203 NIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELH 262
           + I A +A++ + R T QP+   + GSTFK P G+ A +LI+  G RGL   GA++SE H
Sbjct: 201 DEIKAFMADLTNRRTTKQPLNLPSAGSTFKRPEGYFAGKLIDDCGLRGLTLRGAQVSEKH 260

Query: 263 CNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           C F++N  +AT  D+  L   V+  V N+ G+ LE E+K LG+
Sbjct: 261 CGFVVNIGDATAKDILDLMYIVKSTVLNKFGVTLEEEVKILGE 303


>gi|238018787|ref|ZP_04599213.1| hypothetical protein VEIDISOL_00645 [Veillonella dispar ATCC 17748]
 gi|237864553|gb|EEP65843.1| hypothetical protein VEIDISOL_00645 [Veillonella dispar ATCC 17748]
          Length = 309

 Score =  175 bits (443), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 99/277 (35%), Positives = 159/277 (57%), Gaps = 4/277 (1%)

Query: 31  TWFRTGGNAEVMFQPQDIHDLKYFL-TLLPSDIPITIVGLGSNILVRDAGIRGVVLRLSN 89
           T F+ GG A++  +P  + +L + L T+    +P+T++G GSNILV+D GIRG V+ + +
Sbjct: 34  TTFKIGGPADLFIEPTTMAELSFTLRTIHELKVPVTVIGCGSNILVKDGGIRGAVVSVRH 93

Query: 90  AGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNC 149
              + I   N   + +G+    K  +  A  +G+ G  F  GIPG++GGA +MNAGA + 
Sbjct: 94  --MTQIMDCNDNVLCIGSGYMLKDASEFAWENGLSGLEFAIGIPGTLGGAVFMNAGAYDG 151

Query: 150 ETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFPESQNIISAA 208
           E S  V  V  +D +GN        L + YR S    +  +I  VV+   P  ++ I A 
Sbjct: 152 EMSHVVTSVLAVDFEGNIKEYDASHLDFAYRHSVFHDNHEVIGEVVMTLKPGDKDAIKAR 211

Query: 209 IANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMIN 268
           +  +   RE+ QP++  + GSTFK P G+ A  LIE++G +GL  G A++S  H  F+IN
Sbjct: 212 MDELTEKRESKQPLEYASAGSTFKRPPGYFAGTLIEQTGLKGLSVGDAQVSHKHAGFVIN 271

Query: 269 ADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
             NA   D+  L ++V+K+V++Q G+ LE E++ +G+
Sbjct: 272 TGNAKAKDVLDLIKEVQKRVYDQHGVHLEPEVRMIGE 308


>gi|260583958|ref|ZP_05851706.1| UDP-N-acetylmuramate dehydrogenase [Granulicatella elegans ATCC
           700633]
 gi|260158584|gb|EEW93652.1| UDP-N-acetylmuramate dehydrogenase [Granulicatella elegans ATCC
           700633]
          Length = 300

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 106/298 (35%), Positives = 169/298 (56%), Gaps = 9/298 (3%)

Query: 11  RERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDL-KYFLTLLPSDIPITIVGL 69
           +E+  +++  F E  PLK+ T+ +TGG AE +  P+D H+  K    L    IPIT++G 
Sbjct: 6   KEQFPEVKVCFHE--PLKKYTYTKTGGEAECLIFPKDKHETAKIIKALQEKQIPITVLGN 63

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
            SN++VRD GI+G V+ L+    + ++V  + +++  A  S   +   AL   + G  F 
Sbjct: 64  ASNVIVRDGGIKGAVILLNE--MTAMKVMGN-KILAEAGVSLIEVTKCALEQSLTGLEFA 120

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK--D 187
            GIPGS+GGA YMNAGA   E  + V  V  + R G    +  E+L++ YR S + +  D
Sbjct: 121 CGIPGSVGGAMYMNAGAYGGEVCEVVEFVDVVTRTGEIKRLTNEELEFSYRHSALQESGD 180

Query: 188 LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSG 247
           L+I  V     P  +  I A +  + H RE+ QP++  + GS FK P GH   +LI+ +G
Sbjct: 181 LVI-DVCFNLSPGKRESIKAKMEELTHLRESKQPLEYPSCGSVFKRPEGHFTGKLIQDAG 239

Query: 248 CRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            +G + GGA++S+ H  F++N D+AT  D   + + V++ VF Q  + LE E+K +G+
Sbjct: 240 LQGFQIGGAQVSKKHAGFIVNIDHATATDYLAVIQHVQEIVFEQFQVRLEPEVKIIGE 297


>gi|253580613|ref|ZP_04857877.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251847984|gb|EES75950.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 306

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 110/290 (37%), Positives = 161/290 (55%), Gaps = 6/290 (2%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDA 78
           K + + P+K+ T FR GG A+    P    +L   L +  ++ +P  I+G GSN+LV D 
Sbjct: 20  KVKVDEPMKRHTTFRIGGPADYFLLPSSEEELSGILKICKNEELPYFILGNGSNLLVSDE 79

Query: 79  GIRGVVLRLSNAGFSNIEVR-NHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
           G RGV+++L    + +I V+ N      GA  S   +A +A    + GF F  GIPG++G
Sbjct: 80  GYRGVIIQLYR-NYGDITVKGNEIHATAGALLS--QIAAAAKNASLTGFEFAGGIPGTLG 136

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLR 196
           GA  MNAGA   E    + EV  +   G   V+P E+L+  YR+S + TK  ++   V+ 
Sbjct: 137 GAVVMNAGAYGGEMKDVLKEVTVMTAAGEILVLPAEKLEMGYRTSLVKTKGYLVLSAVIV 196

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
               +Q  I A +  +   R + QP++  + GSTFK P G+ A +LI  +G RG + GGA
Sbjct: 197 LEQGNQEAIKARMKELTEQRISKQPLEFPSAGSTFKRPEGYFAGKLIMDAGLRGYQTGGA 256

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           ++SE HC F+IN DNAT  D+  L   V+ KV  Q G+ LE E+K LG F
Sbjct: 257 QVSEKHCGFVINKDNATAADVCRLLRDVQDKVKEQFGVTLEPEVKFLGKF 306


>gi|284048188|ref|YP_003398527.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acidaminococcus
           fermentans DSM 20731]
 gi|283952409|gb|ADB47212.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acidaminococcus
           fermentans DSM 20731]
          Length = 303

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 106/302 (35%), Positives = 168/302 (55%), Gaps = 4/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPI 64
           +S LL    ++L GKFQ N P+++ T FR GG A+++ +P+   ++   L  +    +P+
Sbjct: 3   MSGLLSFLEERLPGKFQINAPMERYTTFRVGGPADLLVEPETREEVCSLLREIHTQQVPL 62

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T++G GSN+LV D GIRG V++L +     + ++  C + V A      LA++A   G+ 
Sbjct: 63  TVIGNGSNLLVLDKGIRGCVVKLGSC-LKQLTIQG-CTIRVEAGVLLSRLASAAAEGGLA 120

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA  MNAGA   E    V  V   D  G    + RE+++++YR S +
Sbjct: 121 GLEFASGIPGSLGGAILMNAGAYGGEIGNLVRSVTVADGGGELRTLNREEMEFRYRHSAV 180

Query: 185 TKD-LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
                II    L    +  + I   I+ +   R + QP+   + GSTFK P G+ A  LI
Sbjct: 181 MDSGDIILGATLELTRDDPDAIRERISELTRKRVSKQPLNFPSAGSTFKRPPGYFAAALI 240

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           +++G RG   G A++SE H  F++N  +AT  ++  L + VR+KV   SG+ LE E++ +
Sbjct: 241 DQAGLRGYRVGDAQVSEKHTGFVVNRGHATASEILQLMDDVREKVHAMSGVWLEPEVRII 300

Query: 304 GD 305
           G+
Sbjct: 301 GE 302


>gi|154685942|ref|YP_001421103.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           amyloliquefaciens FZB42]
 gi|166222822|sp|A7Z4E6|MURB_BACA2 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|154351793|gb|ABS73872.1| MurB [Bacillus amyloliquefaciens FZB42]
          Length = 303

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 102/289 (35%), Positives = 162/289 (56%), Gaps = 5/289 (1%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRD 77
           GK  E  PL   T  + GG A+++  P  +  +K  + ++   D+P T++G GSN+LV D
Sbjct: 14  GKVLEQEPLANHTTMKIGGPADILIIPNRVEAVKDIMDIVKKHDLPWTVIGRGSNLLVLD 73

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            GIRGVV++L  AG  ++E+ +  ++ VG   S   LA S  + G+ G  F  GIPGSIG
Sbjct: 74  EGIRGVVIKLG-AGLDHLEI-DGDQVTVGGGYSVVRLATSMSKKGMSGLEFAAGIPGSIG 131

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL--IITHVVL 195
           GA YMNAGA+  + S+ +V+   +   G    +  E++ + YR+S + K    +    VL
Sbjct: 132 GAVYMNAGAHGSDMSEILVKARILFEDGTIEWLTNEEMDFSYRTSVLQKKRPGVCLEAVL 191

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           +   + +  I+A +     +R+  QP      GS F+NP    A  L+EK+G +G + GG
Sbjct: 192 QLEQKEREAITAQMQQNKDYRKNTQPYSSPCAGSIFRNPLPDHAGNLVEKAGLKGHQIGG 251

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           AK+SE+H NF++NA  AT  D+  L E V+K +  Q  + +  E++ +G
Sbjct: 252 AKVSEMHGNFIVNAGGATAKDVLDLIEYVKKTIREQYDVDMHTEVEIIG 300


>gi|308173488|ref|YP_003920193.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           amyloliquefaciens DSM 7]
 gi|307606352|emb|CBI42723.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           amyloliquefaciens DSM 7]
 gi|328553582|gb|AEB24074.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           amyloliquefaciens TA208]
 gi|328911624|gb|AEB63220.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           amyloliquefaciens LL3]
          Length = 303

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 101/289 (34%), Positives = 163/289 (56%), Gaps = 5/289 (1%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRD 77
           GK  E  PL   T  + GG A+++  P  +  +K  + ++   D+P T++G GSN+LV D
Sbjct: 14  GKVLEQEPLANHTTMKIGGPADILIIPNRVEAVKDIMNIVKKYDLPWTVIGRGSNLLVLD 73

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            GIRGVV++L  AG  ++E+ +  ++ VG   S   LA S  + G+ G  F  GIPGSIG
Sbjct: 74  EGIRGVVIKLG-AGLDHLEI-DGDQVTVGGGYSVVRLATSMSKKGMSGLEFAAGIPGSIG 131

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL--IITHVVL 195
           GA YMNAGA+  + S+ +V+   +   G    +  +++ + YR+S + K    +    VL
Sbjct: 132 GAVYMNAGAHGSDMSEILVKARILFEDGTIEWLTNDEMDFSYRTSVLQKKRPGVCLEAVL 191

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           +   + +  I+A +     +R+  QP      GS F+NP  + A  L+EK+G +G + GG
Sbjct: 192 KLEQKEREAITAQMQQNKDYRKNTQPYSSPCAGSIFRNPLPNHAGNLVEKAGLKGHQIGG 251

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           AK+SE+H NF++NA  AT  D+  L E V+K +  Q  + +  E++ +G
Sbjct: 252 AKVSEMHGNFIVNAGGATAKDVLDLIEYVKKTIREQYDVEMHTEVEIIG 300


>gi|239626640|ref|ZP_04669671.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239516786|gb|EEQ56652.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 302

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 109/289 (37%), Positives = 157/289 (54%), Gaps = 7/289 (2%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDA 78
           +F E  P+ + T FR GG AEV   P    +L   L +L +  +P  I+G GSN+LV D+
Sbjct: 19  RFME--PMSRHTSFRIGGPAEVFISPSGEEELAAVLRVLRTYHVPWRILGNGSNLLVSDS 76

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           G  G V+ +   G  ++E       + G +   ++ A+ AL+H + G  F  GIPGS GG
Sbjct: 77  GCEGAVIAME--GICHMEACGRFLRVAGGQLLSRA-AHLALKHSLTGMEFAAGIPGSAGG 133

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLRG 197
           A  MNAGA   E    + E   +  +G   V+  ++L   YR+S I +K  I+   V   
Sbjct: 134 ALVMNAGAYGFEMKDILREARVMTPEGEVLVLDADRLDLGYRTSCIPSKGYIVLEAVFGL 193

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P  +  I A +  +   R   QP++  + GSTFK P G+ A +LIE +G RG + GGA+
Sbjct: 194 EPGDRAAIEARMKELSDRRREKQPLEYPSAGSTFKRPQGYFAGKLIEDAGLRGYQVGGAQ 253

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           +SE HC F+IN+ +AT  D+  L   VRKKV   SG+ LE E+KR G F
Sbjct: 254 VSEKHCGFVINSGSATASDVMALCGHVRKKVMETSGVELEMEVKRWGRF 302


>gi|258511262|ref|YP_003184696.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
 gi|257477988|gb|ACV58307.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
          Length = 316

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 112/303 (36%), Positives = 169/303 (55%), Gaps = 12/303 (3%)

Query: 8   RLLRERG-KQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPIT 65
           ++L E+G K +RG+     P+K+ T +R GG A+   +P  +  L+  +       +PIT
Sbjct: 8   KILMEQGVKVIRGE-----PMKRHTTWRIGGPADYFVEPDSVDALRASVCAARDHGLPIT 62

Query: 66  IVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVR-NHCEMIVGARCSGKSLANSALRHGIG 124
           ++G GSN LV D GIRG+V++L +A F++ EVR + C +   A  S  +LAN A+RHG+ 
Sbjct: 63  VIGRGSNTLVLDGGIRGLVIKLHDA-FASCEVREDECAVYAMAGRSYVALANLAIRHGLS 121

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA  MNAGA   ET + +     +D  G    +  E L++ YR S +
Sbjct: 122 GLEFATGIPGSVGGAVMMNAGAYGRETCEVLAWAEVMDETGAIARLSNEDLRFGYRYS-V 180

Query: 185 TKDL--IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
            KD   I+T    +  P  ++ +   +      R   QP+     GS F+NP G  A +L
Sbjct: 181 LKDRFGIVTWAKFQLKPGDRDEMRRVVREWSQRRIATQPLSFPNCGSVFRNPEGTHAARL 240

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IE++G +GL  G A IS+ H NF+IN  NA+  D+ +L    +  V  + GI LE E++ 
Sbjct: 241 IEEAGLKGLRRGQAMISDKHANFIINLGNASASDVLWLIRHAQSVVRERFGIALETEVRV 300

Query: 303 LGD 305
           LG+
Sbjct: 301 LGE 303


>gi|226313423|ref|YP_002773317.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brevibacillus brevis
           NBRC 100599]
 gi|226096371|dbj|BAH44813.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brevibacillus brevis
           NBRC 100599]
          Length = 301

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 104/288 (36%), Positives = 161/288 (55%), Gaps = 4/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDA 78
           K   + PL   T +R GG A+++ QP+D   L+  L ++   +IP +++G GSN+LVRD 
Sbjct: 15  KVWTDEPLANHTTWRIGGPADLLIQPKDKASLQKALQIIHRHEIPWSVIGRGSNLLVRDR 74

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIRG VL+++  G S+ E R   E+ VGA  S   LA    + G+ G  F  GIPG++GG
Sbjct: 75  GIRGAVLKVAE-GLSHCEFRGE-EVCVGAGYSMIRLAVETGKMGLTGMEFAGGIPGTVGG 132

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL-IITHVVLRG 197
           A YMNAGA+  + S+ ++E   +   G   V+  E+L + YR+S + K   I+     + 
Sbjct: 133 AVYMNAGAHGSDLSRILIEAEILFENGESKVLSNEELSFSYRTSLLQKQKGIVLEARFQL 192

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
               +  I+A +A     R   QP++    GS F+NP    A +LIE +G +G + GGA+
Sbjct: 193 RTGDRKEIAATLAVNKERRRNTQPLQMPCAGSVFRNPPNDHAGRLIEAAGLKGYQIGGAQ 252

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +SE H NF++N   AT  D+  L   VR  +  ++GI L  E+  +G+
Sbjct: 253 VSEKHSNFIVNCGGATATDVLTLINHVRSTILEKNGIDLHPEVLVVGE 300


>gi|260887247|ref|ZP_05898510.1| UDP-N-acetylmuramate dehydrogenase [Selenomonas sputigena ATCC
           35185]
 gi|330838995|ref|YP_004413575.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Selenomonas
           sputigena ATCC 35185]
 gi|260863309|gb|EEX77809.1| UDP-N-acetylmuramate dehydrogenase [Selenomonas sputigena ATCC
           35185]
 gi|329746759|gb|AEC00116.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Selenomonas
           sputigena ATCC 35185]
          Length = 307

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 107/284 (37%), Positives = 155/284 (54%), Gaps = 4/284 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKY-FLTLLPSDIPITIVGLGSNILVRDAGIRG 82
           N P+K+ T FR GG A+ +  P  + D+ + F  L   DIP  I+G GSN+LV D GIRG
Sbjct: 25  NEPMKEHTTFRIGGPADCLILPASMEDVAFVFQCLKRHDIPFVILGNGSNVLVLDKGIRG 84

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           VV++  N+  S I  +N+  +  GA    + ++  A  + + G  F  GIPGSIGGA +M
Sbjct: 85  VVIKF-NSPISAIRKKNNT-LTAGAGALLRDVSEFAAENSLSGMEFACGIPGSIGGAVFM 142

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFPES 201
           NAGA + E    V  V  I  KG        +L + YR S   ++   I  V L     +
Sbjct: 143 NAGAYDGEMKNIVSAVRAISPKGEIVQFAANELDFGYRHSIFQENGCAICEVDLTLASGN 202

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
              I   IA     RE+ QP++  + GSTFK P GH A  LIE++G +G   GGA++S+ 
Sbjct: 203 AEEIKEKIAGFTERRESKQPLEMPSAGSTFKRPEGHYAGTLIEQTGLKGFTVGGAQVSDK 262

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           H  F++NA +AT  D+  L  QV+ +VF +  + L  E++ LG+
Sbjct: 263 HAGFVVNAGDATAKDVLELIRQVQDRVFEKHHVKLFPEVRILGE 306


>gi|331091816|ref|ZP_08340648.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lachnospiraceae
           bacterium 2_1_46FAA]
 gi|330402715|gb|EGG82282.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lachnospiraceae
           bacterium 2_1_46FAA]
          Length = 303

 Score =  173 bits (439), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 105/283 (37%), Positives = 158/283 (55%), Gaps = 4/283 (1%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRGVV 84
           P+ + T FR GG A+    P+ + +++  + L    D+P  ++G GSN+LV D G RGV+
Sbjct: 23  PMSRHTTFRIGGPADCFVCPETVDEVQKVVRLCNEMDMPFYLLGNGSNLLVGDKGFRGVI 82

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           +RL       IEV +  ++   A      +A+ A R+G+ G  F  GIPG++GGA  MNA
Sbjct: 83  VRLYKQ-MDKIEV-SGTKIRAQAGALLVKVASEACRNGLTGLEFAGGIPGTLGGAVVMNA 140

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLRGFPESQN 203
           GA   E    + EV  + R+G    + +E+L+  YR+S +  +  I    VL+   +   
Sbjct: 141 GAYGGEMKNVLEEVTVLTREGELLTLSKEELELGYRTSIVGRRGYIALEAVLQLEKKDAK 200

Query: 204 IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHC 263
            I   +  +   R T QP++  + GSTFK P GH A QLIE++G RG   G A++SE HC
Sbjct: 201 EIREYMNELREKRTTKQPLEYASAGSTFKRPEGHFAGQLIEQAGLRGFRVGDAQVSEKHC 260

Query: 264 NFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
            F+IN  NAT  D+  L  +V  KV  + G+ LE E+K+LG+F
Sbjct: 261 GFLINRGNATAEDVVELMREVTVKVEEKFGVTLEPEVKKLGEF 303


>gi|225574687|ref|ZP_03783297.1| hypothetical protein RUMHYD_02764 [Blautia hydrogenotrophica DSM
           10507]
 gi|225038114|gb|EEG48360.1| hypothetical protein RUMHYD_02764 [Blautia hydrogenotrophica DSM
           10507]
          Length = 316

 Score =  173 bits (439), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 108/284 (38%), Positives = 158/284 (55%), Gaps = 6/284 (2%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIRGVV 84
           P+   T FR GG AE    P  + +L+  L +     +P  I+G GSN+LV D G RGV+
Sbjct: 32  PMSAHTTFRIGGPAEYYVCPHSVDELQRTLDVCRRYQLPYFILGNGSNLLVSDQGYRGVI 91

Query: 85  LRLSNAGFSNIEVRNH-CEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMN 143
           ++L     S I+V++       GA  S   +A  AL H + GF F  GIPG++GGA  MN
Sbjct: 92  IQLFR-NMSQIDVQDERIRAQAGALLS--LVAKQALAHSLTGFEFAGGIPGTLGGAVVMN 148

Query: 144 AGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGFPESQ 202
           AGA   E    + EV  ++++G    IP E+L+  YR+S + K + I+   VL+     +
Sbjct: 149 AGAYGGELKDVLEEVTVLNQEGEILKIPFEKLEMGYRTSIVKKKNYIVLEAVLKLRYGDE 208

Query: 203 NIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELH 262
           + I   +  +   R + QP++  + GSTFK P G+ A +LI  SG RG   GGA++SE H
Sbjct: 209 DKIRQTMRELTEKRTSKQPLELPSAGSTFKRPEGYFAGKLIMDSGLRGYRVGGAQVSEKH 268

Query: 263 CNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           C F++N DNAT  D+  L   V  KV+ +  + LE E+K LG+F
Sbjct: 269 CGFVVNIDNATAEDVRRLMRDVTDKVYEKFQVTLEPEVKFLGNF 312


>gi|253699159|ref|YP_003020348.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacter sp. M21]
 gi|251774009|gb|ACT16590.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacter sp. M21]
          Length = 300

 Score =  173 bits (438), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 103/290 (35%), Positives = 152/290 (52%), Gaps = 4/290 (1%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFL-TLLPSDIPITIVGLGSNILV 75
           +RG  + + P+ Q T  + GG A++ F+P D+ DL+  +  L+ + IP  ++G G N+LV
Sbjct: 13  VRGTVKWHEPMWQHTSLKVGGPADLYFEPADLPDLQETVEKLIAAKIPYLVLGGGYNLLV 72

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD GIRG V+ L       +E++    +  GA  +  +L   A  H +GG  F  GIPGS
Sbjct: 73  RDGGIRGCVISLKK--LDTLEMQPGARLEAGAGVTNSTLCRFAAEHCLGGMEFLCGIPGS 130

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
            GGA  MNAGA   ET Q V E     R+G   V    +L++ YR   +    I     L
Sbjct: 131 FGGALTMNAGAQGGETLQRV-ETLTTLREGKLVVRKAAELEFGYRYLRLLPGEIALGAKL 189

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           R  P  + +I   +      R   Q +     GS FKNP G  AW+LI+++G RG+  GG
Sbjct: 190 RLEPAERRVIEERMQANIARRSGTQRVTYPNAGSFFKNPAGRHAWELIDQAGMRGVTVGG 249

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           A++SE H NF++N   A   D   L   V+ +V   SG+ LE E++ +G+
Sbjct: 250 AQVSEAHTNFLVNRGGARAADFTSLAALVKLRVKETSGVDLEEEVRLVGE 299


>gi|124024733|ref|YP_001013849.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Prochlorococcus
           marinus str. NATL1A]
 gi|123959801|gb|ABM74584.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Prochlorococcus
           marinus str. NATL1A]
          Length = 291

 Score =  173 bits (438), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 106/288 (36%), Positives = 157/288 (54%), Gaps = 5/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDA 78
           K Q+N  L   T +  GG AE + QP++I +LKY +       IP +++G GSN+L+ D 
Sbjct: 5   KLQKNISLSNFTTWGIGGPAEWIAQPKNIEELKYVINWTNKKKIPCSVIGAGSNLLINDK 64

Query: 79  GIRGVVLRLSNAGFSNIEVRNHC-EMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
           GI+G+ L + N     I+  N   E++ G      +LA  A   G+ GF +  GIPG+IG
Sbjct: 65  GIKGLSLCMRNLKGIEIDKNNGIIEVLSGEMLP--TLARKAAASGLHGFEWAVGIPGTIG 122

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLR 196
           GA  MNAGA     S Y+  +  +   G    I  + L + YR S +  + LI+    L+
Sbjct: 123 GAVVMNAGAQEHCISSYLESITTLSLTGEYQRIKGKDLNFGYRHSLLQNEKLIVVSARLK 182

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
                   I        +HR   QP + +T GS F+NP    A +LIE+ G +G  FGGA
Sbjct: 183 LASGHAKEIRQVTNENLNHRLKTQPYQAQTCGSVFRNPEPLKAAKLIEELGLKGFRFGGA 242

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           +IS++H NF+IN + A+ YD+  L + V+K+VF+  GILLE E+K+ G
Sbjct: 243 EISKIHSNFIINVNKASSYDVRELIKYVKKRVFDSYGILLETEVKQCG 290


>gi|269798384|ref|YP_003312284.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Veillonella parvula
           DSM 2008]
 gi|269095013|gb|ACZ25004.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Veillonella parvula
           DSM 2008]
          Length = 309

 Score =  173 bits (438), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 100/302 (33%), Positives = 166/302 (54%), Gaps = 13/302 (4%)

Query: 15  KQLRGKFQENFPLKQI---------TWFRTGGNAEVMFQPQDIHDLKYFL-TLLPSDIPI 64
           K L+    E  P  ++         T F+ GG A++  +P  + +L + L T+   D+P+
Sbjct: 9   KVLQTALLEKLPCTRVREQELLCHHTTFKIGGPADLFIEPTTMAELSFTLRTIHELDVPV 68

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           TI+G GSNILV+D GIRG V+ + +   + I   N   + +G+    K  +  A  + + 
Sbjct: 69  TIIGCGSNILVKDGGIRGAVVSVRH--MTQIMDCNENTLCIGSGYMLKDASEFAWENSLS 126

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPG++GGA +MNAGA + E S  V  V  +D +G+        L + YR S  
Sbjct: 127 GLEFAIGIPGTLGGAVFMNAGAYDGEMSHVVTAVRAVDFQGSIKEYDASHLDFAYRHSVF 186

Query: 185 TKD-LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
             +  +I  V++   P  ++ I A +  +   RE+ QP++  + GSTFK P G+ A  LI
Sbjct: 187 HDNHEVIGEVIMTLKPGDKDAIKARMDELTEKRESKQPLEYASAGSTFKRPPGYFAGTLI 246

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           E++G +GL  G A++S  H  F+IN  +A+  D+  L  +V+++V++Q G+ LE E++ +
Sbjct: 247 EQTGLKGLSVGDAQVSHKHAGFVINTGSASAKDVLDLISEVQRRVYDQHGVHLEPEVRMI 306

Query: 304 GD 305
           G+
Sbjct: 307 GE 308


>gi|16078587|ref|NP_389406.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|221309397|ref|ZP_03591244.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|221313722|ref|ZP_03595527.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus subtilis
           subsp. subtilis str. NCIB 3610]
 gi|221318646|ref|ZP_03599940.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus subtilis
           subsp. subtilis str. JH642]
 gi|221322919|ref|ZP_03604213.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus subtilis
           subsp. subtilis str. SMY]
 gi|321315288|ref|YP_004207575.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus subtilis
           BSn5]
 gi|140583|sp|P18579|MURB_BACSU RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|142833|gb|AAA83969.1| ORF2 [Bacillus subtilis]
 gi|1195557|gb|AAB35538.1| orf2 3' of murG=putative UDP-N-acetylenolpyruvoylglucosamine
           reductase [Bacillus subtilis, Peptide, 303 aa]
 gi|2633894|emb|CAB13396.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|291484074|dbj|BAI85149.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus subtilis
           subsp. natto BEST195]
 gi|320021562|gb|ADV96548.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus subtilis
           BSn5]
          Length = 303

 Score =  173 bits (438), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 102/302 (33%), Positives = 169/302 (55%), Gaps = 5/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           + ++++E  ++  GK   N PL   T  + GG A+V+  P  +  +K  + ++   D+  
Sbjct: 1   MEKVIQELKEREVGKVLANEPLANHTTMKIGGPADVLVIPSSVDAVKDIMDVIKKYDVKW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T++G GSN+LV D GIRGVV++L  AG  ++E+    ++ VG   S   LA S  + G+ 
Sbjct: 61  TVIGRGSNLLVLDEGIRGVVIKLG-AGLDHLELEGE-QVTVGGGYSVVRLATSLSKKGLS 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA+  + S+ +V+ H +   G    +  EQ+ + YR+S +
Sbjct: 119 GLEFAAGIPGSVGGAVYMNAGAHGSDMSEILVKAHILFEDGTIEWLTNEQMDFSYRTSVL 178

Query: 185 TKDL--IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
            K    +    VL+   + +  I   + +   +R+  QP      GS F+NP  + A  L
Sbjct: 179 QKKRPGVCLEAVLQLEQKDKESIVQQMQSNKDYRKNTQPYSSPCAGSIFRNPLPNHAGNL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           +EK+G +G + GGAKISE+H NF++NA  A+  D+  L + V+K +  +  I +  E++ 
Sbjct: 239 VEKAGLKGYQIGGAKISEMHGNFIVNAGGASAKDVLDLIDHVKKTIREKYEIDMHTEVEI 298

Query: 303 LG 304
           +G
Sbjct: 299 IG 300


>gi|153875389|ref|ZP_02003214.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Beggiatoa sp. PS]
 gi|152068147|gb|EDN66786.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Beggiatoa sp. PS]
          Length = 322

 Score =  173 bits (438), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 108/292 (36%), Positives = 156/292 (53%), Gaps = 3/292 (1%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRGK ++N P+   T +R GG A+  ++P DI DL  FL  LP++IP+  +GLGSN+LVR
Sbjct: 32  LRGKLRQNEPMSAHTSWRVGGPAQWFYEPADIADLAQFLQQLPANIPVFWLGLGSNLLVR 91

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GI G+V+ L+    + I +  +  + V    S   +A  A R G+ G  F  GIPG+ 
Sbjct: 92  DGGIPGIVI-LTAGLLNKIHLLENKILYVEVGVSSAKVARFATRSGLTGTEFLAGIPGTF 150

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD--LIITHVV 194
           GGA  MNAGA   ET   V  V  +D++G +H       +  YRS +  K+   I   + 
Sbjct: 151 GGALAMNAGAWGQETWPLVQSVETLDQQGQRHQRQVADYEIGYRSVKGKKNEWFIAAKLQ 210

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
           L    +        I  +   R   QPI   + GS F+NP G  A +LIE++G +G   G
Sbjct: 211 LAKSEDDDKNSKEKIQALLKQRNEKQPIGLPSCGSVFRNPPGDYAARLIEQAGWKGRCIG 270

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           GA +SE H NF+IN+  AT  D+E L EQ++  +  +  I L  E+  +G  
Sbjct: 271 GACVSEKHANFIINSHAATAADIENLIEQIKHSIKQKYQISLIPEVHIVGKL 322


>gi|51892349|ref|YP_075040.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Symbiobacterium
           thermophilum IAM 14863]
 gi|81389143|sp|Q67Q47|MURB2_SYMTH RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase 2;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase 2
 gi|51856038|dbj|BAD40196.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Symbiobacterium
           thermophilum IAM 14863]
          Length = 308

 Score =  172 bits (437), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 102/285 (35%), Positives = 156/285 (54%), Gaps = 4/285 (1%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRD 77
           G+ +   PLK+ T  R GG A+ + +  D H+L   L L   + +P+ I+G GSN++V D
Sbjct: 16  GRIRRAEPLKRHTSVRIGGPADYLVEVADRHELSRLLRLAGEEALPVYILGSGSNLVVSD 75

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G+RG+VLRL+   F+ I V +   + VG  CS   LA+ A R G+GG  F   IPG++G
Sbjct: 76  EGVRGLVLRLTGE-FARIAV-DGSTVRVGGGCSLPKLAHQASRRGLGGLEFACAIPGTVG 133

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLR 196
               MNAGA+  + +Q V E   I   G    +   ++ + YRS+ +     I+  VV+ 
Sbjct: 134 AGLVMNAGAHGGDMAQVVAEATVIWGDGRMERLCPGEIGFAYRSTRLQGTSAIVAEVVMA 193

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
             P  +  +  A+    + R   QP++    GS FKNP G  A +LIE++G +G   G A
Sbjct: 194 LRPADRAALEGAMRQHLNRRRATQPLQYPNAGSVFKNPPGDYAGRLIEQAGLKGERVGDA 253

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           ++SE H NF++N   AT  D+  L ++VR  V  + G+ LE E+K
Sbjct: 254 QVSEKHANFIVNLGQATARDVLTLMDRVRSTVERRFGVRLEAEVK 298


>gi|153812857|ref|ZP_01965525.1| hypothetical protein RUMOBE_03264 [Ruminococcus obeum ATCC 29174]
 gi|149831069|gb|EDM86158.1| hypothetical protein RUMOBE_03264 [Ruminococcus obeum ATCC 29174]
          Length = 280

 Score =  172 bits (437), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 107/282 (37%), Positives = 159/282 (56%), Gaps = 4/282 (1%)

Query: 27  LKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIRGVVL 85
           +K+ T FR GG AEV   P ++ +++  L +  + D+P  I+G GSN+LV D G RGVV+
Sbjct: 1   MKRHTTFRIGGPAEVFVMPGNLEEVQRILEICRTEDLPYFILGNGSNLLVSDRGYRGVVI 60

Query: 86  RLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAG 145
           +L +  F  ++V    E+   A     ++A +A R  + GF F  GIPG++GGA  MNAG
Sbjct: 61  QL-DRNFGEVKVEG-TEIHASAGALLSTIAVAARRASLTGFEFAGGIPGTLGGAVVMNAG 118

Query: 146 ANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLRGFPESQNI 204
           A   E    + +V  +D+ G    IP E+L+  YR+S I T   I+   VL     +   
Sbjct: 119 AYGGEMKDVLRKVMVMDQSGKVFEIPAEELQMGYRTSIIKTAGYIVLGAVLSLKEGNLEE 178

Query: 205 ISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCN 264
           I      +   R + QP++  + GSTFK P G+ A +LI  SG RG   GGA++SE HC 
Sbjct: 179 IKMLTRKLSEQRTSKQPLEYPSAGSTFKRPEGYFAGKLIMDSGLRGYRVGGAQVSEKHCG 238

Query: 265 FMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           F+IN  +AT  D+  L + V + V+ + G+ LE E+K LG+F
Sbjct: 239 FVINTGDATAEDVRSLMKHVTEIVYAKFGVTLEPEVKFLGEF 280


>gi|294792252|ref|ZP_06757400.1| UDP-N-acetylmuramate dehydrogenase [Veillonella sp. 6_1_27]
 gi|294457482|gb|EFG25844.1| UDP-N-acetylmuramate dehydrogenase [Veillonella sp. 6_1_27]
          Length = 309

 Score =  172 bits (437), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 100/302 (33%), Positives = 166/302 (54%), Gaps = 13/302 (4%)

Query: 15  KQLRGKFQENFPLKQI---------TWFRTGGNAEVMFQPQDIHDLKYFL-TLLPSDIPI 64
           K L+    E  P  ++         T F+ GG A++  +P  + +L + L T+   D+P+
Sbjct: 9   KVLQTALLEKLPSTRVREQELLCHHTTFKIGGPADLFIEPTTMAELSFTLRTIHELDVPV 68

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           TI+G GSNILV+D GIRG V+ + +   + I   N   + +G+    K  +  A  + + 
Sbjct: 69  TIIGCGSNILVKDGGIRGAVVSVRH--MTQIMDCNENTLCIGSGYMLKDASEFAWENSLS 126

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPG++GGA +MNAGA + E S  V  V  +D +GN        L + YR S  
Sbjct: 127 GLEFAIGIPGTLGGAVFMNAGAYDGEMSHVVTAVRAVDFQGNIKEYDASHLDFAYRHSVF 186

Query: 185 TKD-LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
             +  +I  V++   P  ++ I A +  +   RE+ QP++  + GSTFK P G+ A  LI
Sbjct: 187 HDNHEVIGEVIMTLKPGDKDTIKARMDELTEKRESKQPLEYASAGSTFKRPPGYFAGTLI 246

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           E++G +GL  G A++S  H  F+IN  +A+  D+  L  +V+++V+++ G+ LE E++ +
Sbjct: 247 EQTGLKGLSVGDAQVSHKHAGFVINTGSASAKDVLDLIAEVQRRVYDRHGVHLEPEVRMI 306

Query: 304 GD 305
           G+
Sbjct: 307 GE 308


>gi|310658963|ref|YP_003936684.1| UDP-n-acetylenolpyruvoylglucosamine reductase 2 [Clostridium
           sticklandii DSM 519]
 gi|308825741|emb|CBH21779.1| UDP-N-acetylenolpyruvoylglucosamine reductase 2
           (UDP-N-acetylmuramate dehydrogenase 2) [Clostridium
           sticklandii]
          Length = 302

 Score =  172 bits (437), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 102/283 (36%), Positives = 162/283 (57%), Gaps = 8/283 (2%)

Query: 27  LKQITWFRTGGNAEVMFQPQDIHDLKYFL-TLLPSDIPITIVGLGSNILVRDAGIRGVVL 85
           +K  T F+ GG+A+ +  P+ +  ++  + TL   +IP+ I+G GSN+LV D GIRGVV+
Sbjct: 23  MKNHTSFKIGGSADFLVTPRTVDQIQNLIKTLKKENIPVFIMGNGSNLLVSDKGIRGVVI 82

Query: 86  RLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAG 145
           +LS   FS+  +    E+   +     +L+ S +   + GF F  GIPG+IGGA  MNAG
Sbjct: 83  KLSK-NFSSFSISGD-EVTAQSGILLSTLSKSIVNESLSGFEFASGIPGTIGGAVTMNAG 140

Query: 146 ANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFPESQNI 204
           A + E    V EV  +D  GN      +++ ++YR S +T + L++    L+   E  NI
Sbjct: 141 AYDSEMKNIVEEVVAMDMDGNIKTFTNQEMNFRYRKSRVTDETLVVLEAKLK--LEKGNI 198

Query: 205 --ISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELH 262
             I A I +    R T QP+   + GSTFK P G+ A +LIE +G +G+    A +S LH
Sbjct: 199 EDIKAKIDDFTVRRTTKQPLTAYSAGSTFKRPEGYFAGKLIEDAGLKGIIMRNAAVSSLH 258

Query: 263 CNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
             F+IN  +AT  ++  L E ++  VF++ G++LE E++ +G+
Sbjct: 259 SGFVINTGDATCENILELIEFIKLTVFSKFGVMLEEEVRVVGE 301


>gi|47605861|sp|Q82VS1|MURB_NITEU RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
          Length = 322

 Score =  172 bits (437), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 105/303 (34%), Positives = 155/303 (51%), Gaps = 12/303 (3%)

Query: 15  KQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNIL 74
           + LRG+ +++ P+K+   +R GG+A   +QP D+ DL  FL   P D P+ ++GLGSN+L
Sbjct: 16  RLLRGELRQHEPMKRHVSWRAGGHAACFYQPADLEDLALFLRHWPKDEPVVMIGLGSNLL 75

Query: 75  VRDAGIRGVVLRLSNAGFSNIEVRNHCE----MIVGARCSGKSLANSALRHGIGGFHFFY 130
           VRD G+ GVV+ L +A  +++ +    E    +  GA      LA  A  H + G  F  
Sbjct: 76  VRDGGLPGVVITL-HAKLNDLSLVEQNESGGLIYAGAGVPCAKLARFAASHNLTGAEFLA 134

Query: 131 GIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI------ 184
           GIPG++GGA  MNAG    ET   V  V  IDR G       E  +  YR  E+      
Sbjct: 135 GIPGTVGGALAMNAGCYGAETWDRVERVTTIDRSGIVRERTPEDYQVGYRHVELQRTPSS 194

Query: 185 -TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            T D+  T    R  P        A+  +   R   QP+   + GS F+NP G  A +LI
Sbjct: 195 DTPDVWFTGGWFRLRPGKMESSRQAVRTLLTARIKTQPLGFPSAGSVFRNPPGDHAARLI 254

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           E+ G +G   G A +S LH NF++N  +AT  ++E + + V+  V   +GI L  E++ +
Sbjct: 255 EQCGLKGFRIGDAMVSTLHANFIVNCGHATASEIEAIIDTVQNAVHQATGIRLITEVRII 314

Query: 304 GDF 306
           G  
Sbjct: 315 GQL 317


>gi|30248996|ref|NP_841066.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrosomonas
           europaea ATCC 19718]
 gi|30138613|emb|CAD84904.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrosomonas
           europaea ATCC 19718]
          Length = 331

 Score =  172 bits (436), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 105/303 (34%), Positives = 155/303 (51%), Gaps = 12/303 (3%)

Query: 15  KQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNIL 74
           + LRG+ +++ P+K+   +R GG+A   +QP D+ DL  FL   P D P+ ++GLGSN+L
Sbjct: 25  RLLRGELRQHEPMKRHVSWRAGGHAACFYQPADLEDLALFLRHWPKDEPVVMIGLGSNLL 84

Query: 75  VRDAGIRGVVLRLSNAGFSNIEVRNHCE----MIVGARCSGKSLANSALRHGIGGFHFFY 130
           VRD G+ GVV+ L +A  +++ +    E    +  GA      LA  A  H + G  F  
Sbjct: 85  VRDGGLPGVVITL-HAKLNDLSLVEQNESGGLIYAGAGVPCAKLARFAASHNLTGAEFLA 143

Query: 131 GIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI------ 184
           GIPG++GGA  MNAG    ET   V  V  IDR G       E  +  YR  E+      
Sbjct: 144 GIPGTVGGALAMNAGCYGAETWDRVERVTTIDRSGIVRERTPEDYQVGYRHVELQRTPSS 203

Query: 185 -TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            T D+  T    R  P        A+  +   R   QP+   + GS F+NP G  A +LI
Sbjct: 204 DTPDVWFTGGWFRLRPGKMESSRQAVRTLLTARIKTQPLGFPSAGSVFRNPPGDHAARLI 263

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           E+ G +G   G A +S LH NF++N  +AT  ++E + + V+  V   +GI L  E++ +
Sbjct: 264 EQCGLKGFRIGDAMVSTLHANFIVNCGHATASEIEAIIDTVQNAVHQATGIRLITEVRII 323

Query: 304 GDF 306
           G  
Sbjct: 324 GQL 326


>gi|294794114|ref|ZP_06759251.1| UDP-N-acetylmuramate dehydrogenase [Veillonella sp. 3_1_44]
 gi|294455684|gb|EFG24056.1| UDP-N-acetylmuramate dehydrogenase [Veillonella sp. 3_1_44]
          Length = 309

 Score =  172 bits (436), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 100/302 (33%), Positives = 166/302 (54%), Gaps = 13/302 (4%)

Query: 15  KQLRGKFQENFPLKQI---------TWFRTGGNAEVMFQPQDIHDLKYFL-TLLPSDIPI 64
           K L+    E  P  ++         T F+ GG A++  +P  + +L + L T+   D+P+
Sbjct: 9   KVLQTALLEKLPCTRVREQELLCHHTTFKIGGPADLFIEPTTMAELSFTLRTIHELDVPV 68

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           TI+G GSNILV+D GIRG V+ + +   + I   N   + +G+    K  +  A  + + 
Sbjct: 69  TIIGCGSNILVKDGGIRGAVVSVRH--MTQIMDCNENTLCIGSGYMLKDASEFAWENSLS 126

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPG++GGA +MNAGA + E S  V  V  +D +GN        L + YR S  
Sbjct: 127 GLEFAIGIPGTLGGAVFMNAGAYDGEMSHVVTAVRAVDFQGNIKEYDGSHLDFAYRHSVF 186

Query: 185 TKD-LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
             +  +I  V++   P  ++ I A +  +   RE+ QP++  + GSTFK P G+ A  LI
Sbjct: 187 HDNHEVIGEVIMTLKPGDKDAIKARMDELTEKRESKQPLEYASAGSTFKRPPGYFAGTLI 246

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           E++G +GL  G A++S  H  F+IN  +A+  D+  L  +V+++V+++ G+ LE E++ +
Sbjct: 247 EQTGLKGLSVGDAQVSHKHAGFVINTGSASAKDVLDLIAEVQRRVYDRHGVHLEPEVRMI 306

Query: 304 GD 305
           G+
Sbjct: 307 GE 308


>gi|238926815|ref|ZP_04658575.1| UDP-N-acetylmuramate dehydrogenase [Selenomonas flueggei ATCC
           43531]
 gi|238885347|gb|EEQ48985.1| UDP-N-acetylmuramate dehydrogenase [Selenomonas flueggei ATCC
           43531]
          Length = 303

 Score =  172 bits (436), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 105/295 (35%), Positives = 168/295 (56%), Gaps = 14/295 (4%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVR 76
           R +  EN P++  T FR GG A+++F P +  +++  +      DIP+TI+G GSN+L+R
Sbjct: 15  RTRLFENAPMRFHTTFRIGGPADLLFYPHNTEEVRAIIQKAKHYDIPVTILGNGSNLLIR 74

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSG---KSLANSALRHGIGGFHFFYGIP 133
           D GIRG+V+R S    S I  +    +IV   CSG   K +A+ A + G+ G  F  GIP
Sbjct: 75  DGGIRGLVIRFSRQ-MSGI-TQEGTTLIV---CSGALLKDIASFAQKKGLSGLEFACGIP 129

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI---TKDLII 190
           GSIGGA +MNAGA + E    V+ V  I   G   +   ++L + YR S      + +  
Sbjct: 130 GSIGGAVFMNAGAYDGEVKSVVMAVKTISPDGEVRLYSADELDFGYRHSVFHTNNEAICE 189

Query: 191 THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRG 250
            H+ LR   +  + I   ++++   RE+ QP+   + GSTFK P G+ A  LI+++G +G
Sbjct: 190 AHLCLR--TDDPSSILERMSDLNQRRESKQPLSYPSAGSTFKRPPGYFAGTLIDQTGLKG 247

Query: 251 LEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           L +GGA++S+ H  F+IN   AT  D++ L   V+ +V+ +  + L  E++ +G+
Sbjct: 248 LTYGGAQVSQKHAGFIINIGGATARDVQQLIHSVQNRVYAKHHVRLFPELRIIGE 302


>gi|160893087|ref|ZP_02073875.1| hypothetical protein CLOL250_00632 [Clostridium sp. L2-50]
 gi|156865170|gb|EDO58601.1| hypothetical protein CLOL250_00632 [Clostridium sp. L2-50]
          Length = 302

 Score =  172 bits (435), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 112/308 (36%), Positives = 164/308 (53%), Gaps = 24/308 (7%)

Query: 12  ERGKQLRG--KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVG 68
           ER   + G  + +   PL + T FR GG A+ M +P+    +   + L   + +P  I+G
Sbjct: 6   ERAAAITGENRIKTKEPLNRYTTFRIGGEADFMAEPEKPEQIAELVDLCKEENVPFFIMG 65

Query: 69  LGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCS---GKSLANSAL---RHG 122
            GSN+LV D G RG+++ +++ G S I       M+ G R +   G SL  +A+   +H 
Sbjct: 66  NGSNLLVSDNGYRGMIIHIAD-GMSKI-------MVDGTRITAQAGASLIKAAVTAKQHE 117

Query: 123 IGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS 182
           + G  F  GIPGS+GGA YMNAGA   E    +  V  +D+ G  + I    +++ YR S
Sbjct: 118 LTGMEFASGIPGSVGGAVYMNAGAYGGEMKHIISSVKVLDQNGQIYDISGSDMEFGYRHS 177

Query: 183 EITKDLIITHVVLRGFPESQN----IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           +  KD +   VVL    E Q      I A +  +   R + QP++  + GSTFK P G+ 
Sbjct: 178 KAEKDGL---VVLEAEFELQTGDAAQIDAEMKRLAESRISKQPLEYPSAGSTFKRPEGYF 234

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI  +G RG   GGA++SE HC F++N   AT  D+  L   V+K V + SG+ LE 
Sbjct: 235 AGKLIMDAGLRGYTVGGAQVSEKHCGFVVNKGGATAADVMQLVNDVKKMVKDSSGVDLEL 294

Query: 299 EIKRLGDF 306
           EIK LG F
Sbjct: 295 EIKTLGAF 302


>gi|296331099|ref|ZP_06873573.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus subtilis
           subsp. spizizenii ATCC 6633]
 gi|305674254|ref|YP_003865926.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus subtilis
           subsp. spizizenii str. W23]
 gi|296151743|gb|EFG92618.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus subtilis
           subsp. spizizenii ATCC 6633]
 gi|305412498|gb|ADM37617.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus subtilis
           subsp. spizizenii str. W23]
          Length = 303

 Score =  172 bits (435), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 101/303 (33%), Positives = 169/303 (55%), Gaps = 5/303 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           + ++++E  ++  GK   N PL   T  + GG A+V+  P  +  +K  + ++   D+  
Sbjct: 1   MEKVIQELKEREVGKVLANEPLANHTTMKIGGPADVLVIPSSVDAVKDIMDVIKKYDVKW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T++G GSN+LV D GIRGVV++L   G  ++E+    ++ VG   S   LA S  + G+ 
Sbjct: 61  TVIGRGSNLLVLDEGIRGVVIKLG-VGLDHLELEGE-QVTVGGGYSVVRLATSLSKKGLS 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA+  + S+ +V+ H +   G    +  EQ+ + YR+S +
Sbjct: 119 GLEFAAGIPGSVGGAVYMNAGAHGSDMSEILVKAHILFEDGTIEWLTNEQMDFSYRTSVL 178

Query: 185 TKDL--IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
            K    +    VL+   + +  I   + +   +R+  QP      GS F+NP  + A  L
Sbjct: 179 QKKRPGVCLEAVLQLEQKDKESIVQQMQSNKDYRKNTQPYSSPCAGSIFRNPLPNHAGNL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           +EK+G +G + GGAKISE+H NF++NA  A+  D+  L + V+K +  +  I +  E++ 
Sbjct: 239 VEKAGLKGYQIGGAKISEMHGNFIVNAGGASAKDVLDLIDHVKKTIREKYEIDMHTEVEI 298

Query: 303 LGD 305
           +G+
Sbjct: 299 IGE 301


>gi|72383185|ref|YP_292540.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Prochlorococcus
           marinus str. NATL2A]
 gi|90109783|sp|Q46I41|MURB_PROMT RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|72003035|gb|AAZ58837.1| UDP-N-acetylmuramate dehydrogenase [Prochlorococcus marinus str.
           NATL2A]
          Length = 291

 Score =  172 bits (435), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 106/290 (36%), Positives = 159/290 (54%), Gaps = 9/290 (3%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDA 78
           K ++N  L   T +  GG AE + QP++I +LKY +       IP +++G GSN+L+ D 
Sbjct: 5   KLEKNISLSNFTTWGIGGPAEWIAQPKNIEELKYVINWTNKKKIPCSVIGAGSNLLINDK 64

Query: 79  GIRGVVLRLSNAGFSNIEVRNH---CEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           GI+G+ L + N  F  IE+  +    E++ G      +LA  A   G+ GF +  GIPG+
Sbjct: 65  GIKGLSLCMRN--FKGIEIDKNNGIIEVLSGEMLP--TLARKAAASGLHGFEWAVGIPGT 120

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVV 194
           IGGA  MNAGA     S Y+  +  +   G    I  + L + YR S +  + LI+    
Sbjct: 121 IGGAVVMNAGAQEHCISSYLESITTLSLTGEYQRIKGKDLNFGYRQSLLQNEKLIVVSAR 180

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
           L+        I        +HR   QP + +T GS F+NP    A +LIE+ G +G  FG
Sbjct: 181 LKLASGHAKEIRQVTNENLNHRLKTQPYQAQTCGSVFRNPEPLKAAKLIEELGLKGFRFG 240

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           GA+IS++H NF+INA+ A+  D+  L + V+K+VF+  GILLE E+K+ G
Sbjct: 241 GAEISKIHSNFIINANQASSNDVRELIKYVKKRVFDSYGILLETEVKQCG 290


>gi|225569537|ref|ZP_03778562.1| hypothetical protein CLOHYLEM_05631 [Clostridium hylemonae DSM
           15053]
 gi|225161745|gb|EEG74364.1| hypothetical protein CLOHYLEM_05631 [Clostridium hylemonae DSM
           15053]
          Length = 307

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 109/290 (37%), Positives = 158/290 (54%), Gaps = 6/290 (2%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDA 78
           K   + P+K  T FR GG A+    P+   +++  + L    D+P  I+G GSN+LV D 
Sbjct: 21  KVLADEPMKNHTTFRVGGAADYYTVPESKEEVRDIIRLCRQWDVPFYIIGNGSNLLVSDK 80

Query: 79  GIRGVVLRLSNAGFSNIEVRNHC-EMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
           G RGV++++     S I V  H      GA  S  S+A  AL  G+ GF F  GIPG++G
Sbjct: 81  GYRGVMIQIYR-DMSEITVEGHTVRAQAGALLS--SIAARALSAGLTGFEFAAGIPGTLG 137

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLR 196
           GA  MNAGA   E    +  V  +   G    + R++L+  YR+S I  K  I     + 
Sbjct: 138 GACVMNAGAYGGEMKDVLRYVTVLTEDGAFLTLHRDELELGYRTSVIARKGYIALEAEIE 197

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
               S++ I A +  +   R T QP++  + GSTFK P G+ A +LIE +G RG   GGA
Sbjct: 198 LKEGSKDEIKARMDELKEKRVTKQPLEYPSAGSTFKRPEGYFAGKLIEDAGLRGFRVGGA 257

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           ++SE HC F+IN  +AT  D+  L  +V  +V  Q+G+ +E E+KRLG+F
Sbjct: 258 QVSEKHCGFVINRGSATAADIMALITEVADRVERQTGVRMEPEVKRLGEF 307


>gi|225018885|ref|ZP_03708077.1| hypothetical protein CLOSTMETH_02835 [Clostridium methylpentosum
           DSM 5476]
 gi|224948355|gb|EEG29564.1| hypothetical protein CLOSTMETH_02835 [Clostridium methylpentosum
           DSM 5476]
          Length = 304

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 109/307 (35%), Positives = 158/307 (51%), Gaps = 13/307 (4%)

Query: 3   YGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSD 61
           Y  +   L E G     +++   PLK+ T F+ GGN  ++  P  I  ++  +      +
Sbjct: 5   YNALEHCLEENGI----RYEWGVPLKEYTSFKIGGNCTILLSPDSIEQVQNAIRCCRKHN 60

Query: 62  IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRH 121
           I   I+G GSN+LV D G  G V+  SN+    I +     +   A      L   A   
Sbjct: 61  INYFILGKGSNLLVSDDGFEGAVICTSNS-LHEITMVGETTIACQAGVHLSKLCTFAFEQ 119

Query: 122 GIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS 181
           G+ G  F YGIPG++GGAAYMNAGA   E    +     ID +GN     R+QL + YR 
Sbjct: 120 GLTGLEFAYGIPGTVGGAAYMNAGAYGGEMKDVITRCDHIDGEGNPGTFLRKQLDFSYRH 179

Query: 182 SEIT-KDLIITHVVLR---GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGH 237
           S  + ++  IT +  R   G PE+   I A +  + H R T QP++  + GSTFK P G 
Sbjct: 180 SAYSDQNYCITTIYFRLQKGDPEA---IKARMEELMHRRVTKQPLEYPSAGSTFKRPEGA 236

Query: 238 SAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLE 297
            A  LIE+ G +G   G A++SE H  F+IN   AT   +  L EQV+++V+ ++G  LE
Sbjct: 237 YASALIEQCGLKGRSVGDAQVSEKHSGFLINRGEATCKQVLELIEQVQQEVYERTGFSLE 296

Query: 298 WEIKRLG 304
            E+KR+G
Sbjct: 297 CEVKRIG 303


>gi|257066175|ref|YP_003152431.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Anaerococcus
           prevotii DSM 20548]
 gi|256798055|gb|ACV28710.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Anaerococcus
           prevotii DSM 20548]
          Length = 300

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 105/283 (37%), Positives = 152/283 (53%), Gaps = 4/283 (1%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTL-LPSDIPITIVGLGSNILVRDAGIRGVV 84
            L+  T F  GG A+VM +P     L+  L +    +I  T++G GSN+L+ D GIRG +
Sbjct: 20  SLRDYTTFGIGGKADVMIKPNTEEQLQNILKINHRENIKTTVIGRGSNLLISDKGIRGCI 79

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           + L++  F  IE R+   +   A  S   LA  A+  G+ G     GIPGS+GGA  MNA
Sbjct: 80  IVLAD-NFDKIE-RDGDILTALAGTSLNELALFAIERGLAGMEEISGIPGSVGGAVAMNA 137

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFPESQN 203
           GA   E     V V   D  G ++     Q+ + YR S+I +D LI++    +    ++ 
Sbjct: 138 GAYGGEIKDICVNVKAFDFAGKEYNFTNSQMNFSYRHSKIFEDELIVSSASFKLEAGNKE 197

Query: 204 IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHC 263
            I     +    R T QP+  K+ GSTFK PTG  A +LI++ G RG   G  ++SE HC
Sbjct: 198 EIEERYQDFTDRRTTKQPLDRKSAGSTFKRPTGSYASKLIDECGLRGYRKGECQVSEKHC 257

Query: 264 NFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
            F+IN D+AT  D+    E+V K V  ++G +LE E+K +GDF
Sbjct: 258 GFIINIDHATCEDMLSFIEEVSKIVNEKTGFVLEREVKLIGDF 300


>gi|117924061|ref|YP_864678.1| UDP-N-acetylmuramate dehydrogenase [Magnetococcus sp. MC-1]
 gi|187609727|sp|A0L5M9|MURB_MAGSM RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|117607817|gb|ABK43272.1| UDP-N-acetylmuramate dehydrogenase [Magnetococcus sp. MC-1]
          Length = 311

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 102/286 (35%), Positives = 150/286 (52%), Gaps = 13/286 (4%)

Query: 23  ENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDAGIRG 82
           EN PL  +T  + GGNA  + +P  +  L  +    P D+P  I+G GSN+LV D G  G
Sbjct: 17  ENVPLAPLTTLKIGGNARWLVRPSGVKGLSRYCRTCPGDLPRFILGGGSNLLVDDNGFHG 76

Query: 83  VVLRLSNAGFSNIEVRNHCE-----MIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
           VV+ L++    N  V  H +     + V A  + +  A+ A ++G+ G  F  GIPG+IG
Sbjct: 77  VVVDLTHT--LNAIVVEHQDAHGGILRVEAGAATRKTAHVARQNGLAGLAFMAGIPGTIG 134

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHV---V 194
           GA  MNAGA  C+    +++   +D  GN H    ++L   YR  ++ K  I       +
Sbjct: 135 GALRMNAGAYGCDVKGVLLDAQLMDATGNLHTRNAQELGLAYRHCDLPKGWIFVSARFHL 194

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
            RG  E+   I + + +  H R   QP++  + GS F+NP G +AWQLI+ +G RG   G
Sbjct: 195 ARGESEA---IKSQMRDYNHKRTQAQPLRYPSAGSVFRNPAGAAAWQLIDAAGLRGHRIG 251

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
            A+ISE H NF +N   A+   +E L E  R +V   SG+ L  EI
Sbjct: 252 DAQISEKHSNFFVNLGAASSLHMEELIELARNRVAQHSGVQLTLEI 297


>gi|253998174|ref|YP_003050237.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylovorus sp.
           SIP3-4]
 gi|253984853|gb|ACT49710.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylovorus sp.
           SIP3-4]
          Length = 310

 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 106/308 (34%), Positives = 159/308 (51%), Gaps = 32/308 (10%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           ++G+   N PL++   +R GG A+ ++ P  + DL+ F+  L  D P+  +GLGSN+LVR
Sbjct: 8   MQGELMLNAPLERYNSWRVGGLADRLYIPAGLQDLQQFMRTLSKDEPVHFIGLGSNLLVR 67

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+RG V+ + N   + +E+ N  E+   A  +   LA  + R G+ G  F  GIPG++
Sbjct: 68  DGGVRGTVIVMHNV-LTGLEMLN-GELYAEAGVTCAKLARFSARQGLQGGEFMAGIPGTV 125

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAG +  ET   V  V  +DR+G  H   R +    YR           HV L 
Sbjct: 126 GGALAMNAGCHGGETWDIVQRVLTMDREGELHKRSRAEFDASYR-----------HVALA 174

Query: 197 GFPE----SQNIISAA---------------IANVCHHRETVQPIKEKTGGSTFKNPTGH 237
           G PE     Q    AA               I  +   R   QP+ +   GSTF+NP G 
Sbjct: 175 GQPEHWLGEQEWFIAAWFSLPAGDAEEAEQKIKQLLARRLATQPLNQPNAGSTFRNPPGD 234

Query: 238 SAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLE 297
            A +LIE+ G +G + GGA++SE H NF++N   A   ++E L   +R+ V  + GI L+
Sbjct: 235 YAARLIEECGLKGYQIGGAQVSEKHANFIVNLGGARAAEIEQLIAHMRESVKAKFGIELQ 294

Query: 298 WEIKRLGD 305
            E++ +G+
Sbjct: 295 QEVRVIGE 302


>gi|114330271|ref|YP_746493.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrosomonas
           eutropha C91]
 gi|122314678|sp|Q0AJE3|MURB_NITEC RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|114307285|gb|ABI58528.1| UDP-N-acetylmuramate dehydrogenase [Nitrosomonas eutropha C91]
          Length = 332

 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 106/299 (35%), Positives = 155/299 (51%), Gaps = 12/299 (4%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRG+ +++ P+KQ   +R GG+A   +QP D+ DL  FL   P D P+ ++GLGSN LVR
Sbjct: 28  LRGELRQHEPMKQHVSWRAGGHAAYFYQPADLEDLAVFLHFWPKDEPVMMIGLGSNFLVR 87

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCE----MIVGARCSGKSLANSALRHGIGGFHFFYGI 132
           D G+ GV++ L +A  +++ +    E    +  GA      LA  A  H + G  F  GI
Sbjct: 88  DGGLPGVMIAL-HAKLNDLLLVEQEEDGGLIYAGAGVPCAKLARFASLHNLAGAEFLAGI 146

Query: 133 PGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE----ITKDL 188
           PG++GGA  MNAG    ET + V  V  IDR G  H    E  +  YR  E    +  D 
Sbjct: 147 PGTVGGALAMNAGCYGSETWERVERVKTIDRDGTLHERTPEDYRIGYRQVELHEVVPPDT 206

Query: 189 IITHVV---LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEK 245
             +  V    R  P  Q     A+  +   R   QP+   + GS F+NP G  A +L+E+
Sbjct: 207 SCSWFVGGWFRLRPGQQESSRQAVKALLGTRIKTQPLGFPSAGSVFRNPPGDYAARLVEQ 266

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            G +G   G A IS LH NF+IN  +AT  ++E +   V+  V+ ++ I L  E++ +G
Sbjct: 267 CGLKGFRIGDAMISTLHANFIINCGHATATEIETVINTVQDIVYKKTEIRLVTEVRIIG 325


>gi|194014879|ref|ZP_03053496.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus pumilus
           ATCC 7061]
 gi|194013905|gb|EDW23470.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus pumilus
           ATCC 7061]
          Length = 303

 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 103/290 (35%), Positives = 162/290 (55%), Gaps = 5/290 (1%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRD 77
           GK  EN PL   T  + GG A+++  P+DI  +K  +  +       T++G GSN+LV D
Sbjct: 14  GKVLENEPLANHTTMKIGGPADLLIIPKDIDAVKTIMDHVKKHHTNWTVIGRGSNLLVLD 73

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            GIRGVVL+L  AG  ++ V N  E+ VG   S   LA S  + G+ G  F  GIPGSIG
Sbjct: 74  KGIRGVVLKLG-AGLDHLTV-NDEEITVGGGYSVVRLATSLSKQGLSGLEFAAGIPGSIG 131

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL--IITHVVL 195
           GA YMNAGA+  + S+ +V+   +   G+   +  EQ+ + YR+S + K+   I+   V 
Sbjct: 132 GAVYMNAGAHGSDISKILVKARILFEDGSIEWLTNEQMNFSYRTSVLQKERPGIVLEAVF 191

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           +   + +  I+  +     +R+  QP      GS F+NP    A QL+EK+  +G + GG
Sbjct: 192 KLKQDDREKITKKMQQNKDYRKETQPYNRPCAGSIFRNPLPEYAGQLVEKANLKGYQIGG 251

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           A+IS++H NF++NA  AT  D+  L + ++KK+     + +  E++ +G+
Sbjct: 252 ARISDMHGNFIVNAGGATAQDVLDLIQFIQKKIKEDYNVEMHTEVEIIGE 301


>gi|320120630|gb|EFE28006.2| UDP-N-acetylmuramate dehydrogenase [Filifactor alocis ATCC 35896]
          Length = 311

 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 162/288 (56%), Gaps = 4/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDA 78
           +  E   +K+ T FR GG+A+ +  P  I +L+  + +L    IP  ++G G+N+LVRD 
Sbjct: 25  QISEKESMKKHTSFRIGGDADFLVLPSSIAELQQLMRMLNEKQIPFFVMGNGTNLLVRDK 84

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIR VV++L+    SN  +R   ++   A  S  +L+   L   + GF F  GIPG++GG
Sbjct: 85  GIRSVVIKLAR-NISNYGIRG-TDIFAEAGLSLSALSRIILEEELTGFEFASGIPGTVGG 142

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRG 197
           A  MNAGA   E    V  V  +D KG    +  E +++ YR+S ++K  L++       
Sbjct: 143 AMVMNAGAYGGEMKDIVKSVLVMDEKGLIFEMKGEDMEFGYRTSILSKQRLLVLGATFSL 202

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
              ++  I   + +    R T QPI+E + GSTFK P G+ A +LIE SG RG+   GA+
Sbjct: 203 EKGNRQEIQEKMDDYALRRNTKQPIQEASAGSTFKRPEGYFAGKLIEDSGLRGVSHRGAQ 262

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S+LHC F+IN  +AT  D+  L   ++K V+++  + LE E++ +G+
Sbjct: 263 VSQLHCGFVINKGDATCEDVLELINMIKKTVYDKFQVSLEEEVRLVGE 310


>gi|295093104|emb|CBK82195.1| UDP-N-acetylmuramate dehydrogenase [Coprococcus sp. ART55/1]
          Length = 304

 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 102/280 (36%), Positives = 153/280 (54%), Gaps = 8/280 (2%)

Query: 31  TWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRGVVLRLSN 89
           T FR GG A+    P D   +   + L    +IP  ++G GSN+LV DAG RG+++ + +
Sbjct: 29  TTFRVGGPADYFASPSDADQVAGLIELCRKCEIPYFVLGNGSNLLVSDAGYRGMIINIMD 88

Query: 90  AGFSNIEVRNHCEMIVGARCSGKSLANSAL--RHGIGGFHFFYGIPGSIGGAAYMNAGAN 147
              + I V      ++ A+   K +  S L   + + G  F  GIPG+IGGA YMNAGA 
Sbjct: 89  -NMNGITVDGD---VITAQAGAKLVRVSRLARDNSLTGLEFASGIPGTIGGAVYMNAGAY 144

Query: 148 NCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFPESQNIIS 206
             E    V  V  +D  G+ + +  ++L + YR S +  + LI+  V ++     Q  I 
Sbjct: 145 GGEMKDVVTSVKVMDADGHIYDMSSDELDFSYRHSAVEAEGLIVLEVTMKLAAGVQQDID 204

Query: 207 AAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFM 266
             +  +   R T QP++  + GSTFK P G+ A +LI ++G RG   GGA++SE HC F+
Sbjct: 205 DRMKELSDSRRTKQPLEYPSAGSTFKRPEGYFAGKLIMEAGLRGYSVGGAQVSEKHCGFV 264

Query: 267 INADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           +N   AT  D+  L   V+KKV +Q G++LE E+K LGDF
Sbjct: 265 VNRGGATAADVTGLIHDVQKKVMDQFGVMLEPEVKMLGDF 304


>gi|317473375|ref|ZP_07932670.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Anaerostipes sp.
           3_2_56FAA]
 gi|316899211|gb|EFV21230.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Anaerostipes sp.
           3_2_56FAA]
          Length = 302

 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 107/286 (37%), Positives = 160/286 (55%), Gaps = 10/286 (3%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFL-TLLPSDIPITIVGLGSNILVRDAGIRGVV 84
           P+K+ T FR GG AE+   P+ I ++++ + T    +IP+ I+G GSN+LV D GI G+V
Sbjct: 22  PMKKHTTFRIGGEAELYIIPETIEEVQWTVKTARKHEIPMFILGNGSNLLVGDRGIDGIV 81

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           L++     + I V N  E+   A     S+A  A    + GF F  GIPG+ GGA  MNA
Sbjct: 82  LQIYK-NMNEITV-NGTEITAQAGALLSSIAREAQNRSLTGFEFAGGIPGTFGGAITMNA 139

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK----DLIITHVVLRGFPE 200
           GA   E  Q + E   + ++G    +  E+L+  YR+S + K     L  T  +  G P 
Sbjct: 140 GAYGGEMIQVLKEATALTKEGEILTLSAEELELGYRTSNVIKCGYTVLSGTLSLKEGDPS 199

Query: 201 SQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISE 260
               I   +      R+T QP++  + GSTFK P G+ A +LI+ +G RG + GGA++S+
Sbjct: 200 E---IKKQMDEYSMARKTKQPLELPSAGSTFKRPKGYFAGKLIDDAGLRGYQVGGARVSD 256

Query: 261 LHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
            HC F++N +NAT  D+  L E V+K V  + G+ LE E+KR+G F
Sbjct: 257 KHCGFVVNQENATAKDVLQLIEDVQKTVKEKFGVDLEPEVKRVGKF 302


>gi|313200243|ref|YP_004038901.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylovorus sp.
           MP688]
 gi|312439559|gb|ADQ83665.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylovorus sp.
           MP688]
          Length = 310

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 106/308 (34%), Positives = 159/308 (51%), Gaps = 32/308 (10%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           ++G+   N PL++   +R GG A+ ++ P  + DL+ F+  L  D P+  +GLGSN+LVR
Sbjct: 8   MQGELMLNAPLERYNSWRVGGLADRLYIPAGLQDLQQFMRTLSKDEPLHFIGLGSNLLVR 67

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+RG V+ + N   + +E+ N  E+   A  +   LA  + R G+ G  F  GIPG++
Sbjct: 68  DGGVRGTVIVMHNV-LTGLEMVN-GELYAEAGVTCAKLARFSARQGLQGGEFMAGIPGTV 125

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAG +  ET   V  V  +DR+G  H   R +    YR           HV L 
Sbjct: 126 GGALAMNAGCHGGETWDIVQRVLTMDRQGELHERSRAEFDASYR-----------HVALA 174

Query: 197 GFPE----SQNIISAA---------------IANVCHHRETVQPIKEKTGGSTFKNPTGH 237
           G PE     Q    AA               I  +   R   QP+ +   GSTF+NP G 
Sbjct: 175 GQPEHWLGEQEWFIAAWFSLPAGDAEEAEQKIKQLLARRLATQPLNQPNAGSTFRNPPGD 234

Query: 238 SAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLE 297
            A +LIE+ G +G + GGA++SE H NF++N   A   ++E L   +R+ V  + GI L+
Sbjct: 235 YAARLIEECGLKGYQIGGAQVSEKHANFIVNLGGARAAEIEQLIAHMRESVKAKFGIELQ 294

Query: 298 WEIKRLGD 305
            E++ +G+
Sbjct: 295 QEVRVIGE 302


>gi|258645509|ref|ZP_05732978.1| UDP-N-acetylmuramate dehydrogenase [Dialister invisus DSM 15470]
 gi|260402863|gb|EEW96410.1| UDP-N-acetylmuramate dehydrogenase [Dialister invisus DSM 15470]
          Length = 301

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 102/293 (34%), Positives = 161/293 (54%), Gaps = 11/293 (3%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDL-KYFLTLLPSDIPITIVGLGSNILVR 76
           + + + N P+ + T F  GG A+    P+ I +L K  + +  +++P  I+G G+N+LVR
Sbjct: 14  KNQIKLNEPMSRHTTFGIGGAADCFVMPETIEELQKVIVEVTKANVPFFILGGGANLLVR 73

Query: 77  DAGIRGVVL---RLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           D GIRGVV+   RL +       +R      V A  S    A +A+ +G+ G  F  GIP
Sbjct: 74  DKGIRGVVIYTGRLQSIIHEGNRLR------VAAGVSTAKAAKAAMEYGLSGMEFAAGIP 127

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITH 192
           G+IGGAAYMNAGA N E +  VV V   +R G   V  + +L Y YR S   ++  II  
Sbjct: 128 GTIGGAAYMNAGAYNGEMADIVVSVLSCNRNGQLSVYNKSKLHYDYRHSLFMENGEIIVE 187

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
           + +   P + + I   +      R   QP+++K+ GSTFK P G+   Q+IE+ G +G  
Sbjct: 188 ITVELAPGNIHDIEVMMEEFNRRRRMKQPLEKKSAGSTFKRPAGYFVGQMIEEMGLKGFA 247

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            G AK+S  H  F+IN  +A+  D+  L  +++++VF+  G+ L  E++ +G+
Sbjct: 248 VGDAKVSMKHAGFLINDGHASCTDMMNLISEIKRRVFDGYGVELMTEVQIVGE 300


>gi|157692197|ref|YP_001486659.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus pumilus
           SAFR-032]
 gi|167017278|sp|A8FCY2|MURB_BACP2 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|157680955|gb|ABV62099.1| UDP-N-acetylmuramate dehydrogenase [Bacillus pumilus SAFR-032]
          Length = 303

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 102/290 (35%), Positives = 161/290 (55%), Gaps = 5/290 (1%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRD 77
           GK  EN PL   T  + GG A+++  P+DI  +K  +  +       T++G GSN+LV D
Sbjct: 14  GKVLENEPLANHTTMKIGGPADLLIIPKDIDAVKTIMDHVKKHQTNWTVIGRGSNLLVLD 73

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            GIRGVVL+L   G  ++ V N  E+ VG   S   LA S  + G+ G  F  GIPGSIG
Sbjct: 74  KGIRGVVLKLG-TGLDHLTV-NDEEITVGGGYSVVRLATSLSKQGLSGLEFAAGIPGSIG 131

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL--IITHVVL 195
           GA YMNAGA+  + S+ +V+   +   G+   +  EQ+ + YR+S + K+   I+   V 
Sbjct: 132 GAVYMNAGAHGSDISKILVKARILFEDGSIEWLTNEQMNFSYRTSVLQKERPGIVLEAVF 191

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           +   + +  I+  +     +R+  QP      GS F+NP    A QL+EK+  +G + GG
Sbjct: 192 KLKQDDREKITKKMQQNKDYRKETQPYNRPCAGSIFRNPLPEYAGQLVEKANLKGYQLGG 251

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           A+IS++H NF++NA  AT  D+  L + ++KK+     + +  E++ +G+
Sbjct: 252 ARISDMHGNFIVNAGGATAQDVLDLIQFIQKKIKEDYNVEMHTEVEIIGE 301


>gi|20808252|ref|NP_623423.1| UDP-N-acetylmuramate dehydrogenase [Thermoanaerobacter
           tengcongensis MB4]
 gi|29336806|sp|Q8R8Z6|MURB_THETN RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|20516850|gb|AAM25027.1| UDP-N-acetylmuramate dehydrogenase [Thermoanaerobacter
           tengcongensis MB4]
          Length = 302

 Score =  170 bits (431), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 111/307 (36%), Positives = 171/307 (55%), Gaps = 13/307 (4%)

Query: 6   ISRLLRERGKQL--RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-I 62
           ++ +L ++ K++   GK   N P+K+ T F+ GG A+V+  P    +L   +  L  + I
Sbjct: 1   MAEILVDKLKEILKEGKLYLNEPMKRHTSFKIGGPADVLAVPGSRDELINLIAYLRQEKI 60

Query: 63  PITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHG 122
           P  I+G G+N+LV + GIRGVV++LS+    N+ V    ++I  A  S   +AN AL H 
Sbjct: 61  PFFILGNGTNLLVSEKGIRGVVVKLSS--LRNVIVEG-TKIIAEAGASLSYIANVALVHE 117

Query: 123 IGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS 182
           + GF F  GIPG++GGA  MNAGA   E    V +V  +D   N  ++  +++K+ YR S
Sbjct: 118 LTGFEFASGIPGTLGGAIVMNAGAYGSEMKDVVEKVEVLDENNNILILSNQEMKFSYRYS 177

Query: 183 EITKDLIITHVVLRGFPESQ----NIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
            + +      +VLR +   +      I   +  +   R+  QP+   + GSTFK P G+ 
Sbjct: 178 ILQEK---EWIVLRAWISLERGNYEEIKKKMEELNQRRKEKQPLDYPSAGSTFKRPPGYY 234

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LIE +G +G   GGAK+SE H  F+IN  NAT YD+  L E ++K V  + G+ L  
Sbjct: 235 AGKLIEDAGLKGYSIGGAKVSEKHSGFIINTGNATFYDVLNLIEYIQKVVKEKFGVELMP 294

Query: 299 EIKRLGD 305
           EIK +G+
Sbjct: 295 EIKIVGE 301


>gi|329769838|ref|ZP_08261238.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Gemella sanguinis
           M325]
 gi|328838014|gb|EGF87636.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Gemella sanguinis
           M325]
          Length = 300

 Score =  170 bits (431), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 101/286 (35%), Positives = 165/286 (57%), Gaps = 6/286 (2%)

Query: 23  ENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIR 81
           EN  LK+ ++ +TGGNA+++ + +   D +  +     +DI +TI+G GSN+L+ D GIR
Sbjct: 18  ENEALKKYSFTKTGGNADILVRVKSEEDFQNIIKYSNDNDIDLTILGNGSNVLISDTGIR 77

Query: 82  GVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAY 141
           G+V+  S    + I +     +   A  + K LA+  + + +    F  GIPGS+GGA +
Sbjct: 78  GIVVITSE--LNTITLSEDNILTCYAGTTLKELADFCIENSLTNLEFSCGIPGSVGGAIF 135

Query: 142 MNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI--TKDLIITHVVLRGFP 199
           MNAGA   E  + V +V    R G +     E++++ YR S I  TK+ II+ V  +   
Sbjct: 136 MNAGAYGGEMKEVVQKVEVFTRNGEKKTYTNEEMQFSYRHSVIQETKE-IISKVYFKMDK 194

Query: 200 ESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKIS 259
            ++  I A + ++   R   QP++  + GS FK P G+ A +LI+ +G +GL  GGA++S
Sbjct: 195 GNKEEIVAKVEDLNKQRSDKQPLEYPSCGSVFKRPEGYFAGKLIQDAGLQGLTVGGAQVS 254

Query: 260 ELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           + H  FM+N +NAT  D + L ++V++KV   SG+ LE E+K LG+
Sbjct: 255 KKHAGFMVNVNNATCEDYKNLIKKVQEKVLENSGVELECEVKILGE 300


>gi|52842819|ref|YP_096618.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|52629930|gb|AAU28671.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
          Length = 312

 Score =  170 bits (431), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 106/289 (36%), Positives = 153/289 (52%), Gaps = 2/289 (0%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRD 77
           +G    N PL + T +R GG A  +++P +I DL  FL+ LP D P+  +GLGSN L+RD
Sbjct: 19  QGTLLFNEPLAEYTTWRVGGPAARLYKPANIDDLALFLSRLPFDEPLLWLGLGSNSLIRD 78

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G  G V+ L+      + + +   + V A  S  S+A  + R+ + G  F+ GIPG++G
Sbjct: 79  GGFSGTVI-LTQGCLKEMTLLSDNCIRVEAGVSCASMARFSARNNLSGGEFWAGIPGTMG 137

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRG 197
           GA  MNAG +  ET Q V+EV  I+R+G       E+ +  YR      D       L+ 
Sbjct: 138 GALRMNAGCHGGETWQSVIEVQTINRRGEIRTRKPEEFEVAYRHVAGLGDEWFISAKLQL 197

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P ++      I ++  HR   QP  E   GS F+NP G  A +LIE  G +G+  GGA 
Sbjct: 198 SPGNKETSLQLIKDLLAHRAKTQPTNEYNCGSVFRNPPGDFAARLIESCGLKGVSIGGAV 257

Query: 258 ISELHCNFMIN-ADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +SE H NF+IN    AT  ++E L   V+ KV  Q+ I L  E+  +GD
Sbjct: 258 VSEKHANFIINHQGTATAANIEALIHLVQTKVREQTSIELIREVHIIGD 306


>gi|296108258|ref|YP_003619959.1| UDP-N-acetylmuramate dehydrogenase [Legionella pneumophila 2300/99
           Alcoy]
 gi|295650160|gb|ADG26007.1| UDP-N-acetylmuramate dehydrogenase [Legionella pneumophila 2300/99
           Alcoy]
          Length = 303

 Score =  170 bits (431), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 106/289 (36%), Positives = 153/289 (52%), Gaps = 2/289 (0%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRD 77
           +G    N PL + T +R GG A  +++P +I DL  FL+ LP D P+  +GLGSN L+RD
Sbjct: 10  QGALLFNEPLAEYTTWRVGGPAARLYKPANIDDLALFLSRLPFDEPLLWLGLGSNSLIRD 69

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G  G V+ L+      + + +   + V A  S  S+A  + R+ + G  F+ GIPG++G
Sbjct: 70  GGFSGTVI-LTQGCLKEMTLLSDNCIRVEAGVSCASMARFSARNNLSGGEFWAGIPGTMG 128

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRG 197
           GA  MNAG +  ET Q V+EV  I+R+G       E+ +  YR      D       L+ 
Sbjct: 129 GALRMNAGCHGGETWQSVIEVQTINRRGEIRTRKPEEFEVAYRHVAGLGDEWFISAKLQL 188

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P ++      I ++  HR   QP  E   GS F+NP G  A +LIE  G +G+  GGA 
Sbjct: 189 SPGNKETSLQLIKDLLAHRAKTQPTNEYNCGSVFRNPPGDFAARLIESCGLKGVSIGGAV 248

Query: 258 ISELHCNFMIN-ADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +SE H NF+IN    AT  ++E L   V+ KV  Q+ I L  E+  +GD
Sbjct: 249 VSEKHANFIINHQGTATAANIEALIHLVQTKVREQTSIELIREVHIIGD 297


>gi|291561485|emb|CBL40284.1| UDP-N-acetylmuramate dehydrogenase [butyrate-producing bacterium
           SS3/4]
          Length = 289

 Score =  170 bits (431), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 101/286 (35%), Positives = 155/286 (54%), Gaps = 5/286 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLK-YFLTLLPSDIPITIVGLGSNILVRDAGIRG 82
           N P+ + T FR GG A+    P+   +L+   L    S  P  ++G GSN+LV D G RG
Sbjct: 6   NEPMARHTSFRVGGPADRFVIPESETELREAVLDCKKSGQPWYMIGNGSNLLVGDKGFRG 65

Query: 83  VVLRLSNAGFSNIEV-RNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAY 141
            ++  S    + +EV +N   +I GA      LAN+A R  + G  F  GIPG++GGA  
Sbjct: 66  TII--STERLAELEVQKNENIIIAGAGVMLSKLANTAAREELTGLEFAAGIPGTVGGAVM 123

Query: 142 MNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGFPE 200
           MNAGA   E    ++    +D+ GN  ++  E+L+  YR+S + +  L       +  P 
Sbjct: 124 MNAGAYGSEMKNVLLWADVMDQDGNVKLMKNEELELGYRTSCLERLGLFTVRAAFKLTPG 183

Query: 201 SQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISE 260
              +I + +  +   R+  QP++  + GSTFK P G+ A +LIE +G +G   GGA +SE
Sbjct: 184 DPEVIRSQMEELARKRKEKQPLEYPSAGSTFKRPEGYFAGKLIEDAGLKGFSVGGAAVSE 243

Query: 261 LHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
            H  F+IN D+ T  D+  L  +V+++V   SG+ LE E+K LG+F
Sbjct: 244 KHAGFVINKDHGTAADILGLCNEVKRRVKASSGVDLELEVKLLGEF 289


>gi|148358652|ref|YP_001249859.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Legionella
           pneumophila str. Corby]
 gi|166222839|sp|A5IAW3|MURB_LEGPC RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|148280425|gb|ABQ54513.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Legionella
           pneumophila str. Corby]
          Length = 308

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 106/289 (36%), Positives = 153/289 (52%), Gaps = 2/289 (0%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRD 77
           +G    N PL + T +R GG A  +++P +I DL  FL+ LP D P+  +GLGSN L+RD
Sbjct: 15  QGALLFNEPLAEYTTWRVGGPAARLYKPANIDDLALFLSRLPFDEPLLWLGLGSNSLIRD 74

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G  G V+ L+      + + +   + V A  S  S+A  + R+ + G  F+ GIPG++G
Sbjct: 75  GGFSGTVI-LTQGCLKEMTLLSDNCIRVEAGVSCASMARFSARNNLSGGEFWAGIPGTMG 133

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRG 197
           GA  MNAG +  ET Q V+EV  I+R+G       E+ +  YR      D       L+ 
Sbjct: 134 GALRMNAGCHGGETWQSVIEVQTINRRGEIRTRKPEEFEVAYRHVAGLGDEWFISAKLQL 193

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P ++      I ++  HR   QP  E   GS F+NP G  A +LIE  G +G+  GGA 
Sbjct: 194 SPGNKETSLQLIKDLLAHRAKTQPTNEYNCGSVFRNPPGDFAARLIESCGLKGVSIGGAV 253

Query: 258 ISELHCNFMIN-ADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +SE H NF+IN    AT  ++E L   V+ KV  Q+ I L  E+  +GD
Sbjct: 254 VSEKHANFIINHQGTATAANIEALIHLVQTKVREQTSIELIREVHIIGD 302


>gi|187935675|ref|YP_001887529.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           botulinum B str. Eklund 17B]
 gi|254764148|sp|B2TQS2|MURB_CLOBB RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|187723828|gb|ACD25049.1| UDP-N-acetylmuramate dehydrogenase [Clostridium botulinum B str.
           Eklund 17B]
          Length = 304

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 159/288 (55%), Gaps = 5/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDA 78
           + QEN  + +   FR GG  +++  P     +   + +   + IP  ++G GSN+LV+D+
Sbjct: 19  QMQENAKMSEHINFRVGGPVDILLTPNTKEQIVETINICKENKIPFYVLGNGSNVLVKDS 78

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIRGVV++LS   F NI VR+   +   +    K ++  AL+  + GF F  GIPGS+GG
Sbjct: 79  GIRGVVIKLSE--FDNI-VRDGNTIKAESGALLKDVSAEALKASLTGFEFACGIPGSVGG 135

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGF 198
           A +MNAGA + E S  + E   +   G    + ++QL+  YR+S I K   I       F
Sbjct: 136 AVFMNAGAYDGEISFVIKEAEVMSEDGKIITLSKDQLELGYRTSAIMKKNYIVITATFCF 195

Query: 199 PESQ-NIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
              + + I   ++ + + RE  QP++  + GSTFK P GH A +LI+ +G +    GGA 
Sbjct: 196 ESGEKDKIEGRVSELTNKREEKQPLEFPSAGSTFKRPEGHFAGKLIQDAGLKDFTLGGAA 255

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S  HC F+IN  NAT  D+  L E ++K+V  Q G+ L  E++ +G+
Sbjct: 256 VSGKHCGFIINKSNATAKDILDLIEYIQKEVKKQFGVDLYPEVRIIGE 303


>gi|115311640|sp|Q5ZSA6|MURB_LEGPH RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
          Length = 308

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 106/289 (36%), Positives = 153/289 (52%), Gaps = 2/289 (0%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRD 77
           +G    N PL + T +R GG A  +++P +I DL  FL+ LP D P+  +GLGSN L+RD
Sbjct: 15  QGTLLFNEPLAEYTTWRVGGPAARLYKPANIDDLALFLSRLPFDEPLLWLGLGSNSLIRD 74

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G  G V+ L+      + + +   + V A  S  S+A  + R+ + G  F+ GIPG++G
Sbjct: 75  GGFSGTVI-LTQGCLKEMTLLSDNCIRVEAGVSCASMARFSARNNLSGGEFWAGIPGTMG 133

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRG 197
           GA  MNAG +  ET Q V+EV  I+R+G       E+ +  YR      D       L+ 
Sbjct: 134 GALRMNAGCHGGETWQSVIEVQTINRRGEIRTRKPEEFEVAYRHVAGLGDEWFISAKLQL 193

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P ++      I ++  HR   QP  E   GS F+NP G  A +LIE  G +G+  GGA 
Sbjct: 194 SPGNKETSLQLIKDLLAHRAKTQPTNEYNCGSVFRNPPGDFAARLIESCGLKGVSIGGAV 253

Query: 258 ISELHCNFMIN-ADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +SE H NF+IN    AT  ++E L   V+ KV  Q+ I L  E+  +GD
Sbjct: 254 VSEKHANFIINHQGTATAANIEALIHLVQTKVREQTSIELIREVHIIGD 302


>gi|54295450|ref|YP_127865.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Legionella
           pneumophila str. Lens]
 gi|81367751|sp|Q5WTI8|MURB_LEGPL RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|53755282|emb|CAH16776.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Legionella
           pneumophila str. Lens]
          Length = 308

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 106/289 (36%), Positives = 153/289 (52%), Gaps = 2/289 (0%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRD 77
           +G    N PL + T +R GG A  +++P +I DL  FL+ LP D P+  +GLGSN L+RD
Sbjct: 15  QGTLLFNEPLAEYTTWRVGGPAARLYKPANIDDLALFLSRLPFDEPLLWLGLGSNSLIRD 74

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G  G V+ L+      + + +   + V A  S  S+A  + R+ + G  F+ GIPG++G
Sbjct: 75  GGFSGTVI-LTQGCLKEMTLLSDNCIRVEAGVSCASMARFSARNNLSGGEFWAGIPGTMG 133

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRG 197
           GA  MNAG +  ET Q V+EV  I+R+G       E+ +  YR      D       L+ 
Sbjct: 134 GALRMNAGCHGGETWQSVIEVQTINRRGEIRTRKPEEFEVAYRHVAGLGDEWFISAKLQL 193

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P ++      I ++  HR   QP  E   GS F+NP G  A +LIE  G +G+  GGA 
Sbjct: 194 SPGNKETSLQLIKDLLAHRAKTQPTNEYNCGSVFRNPPGDFAARLIESCGLKGVSIGGAV 253

Query: 258 ISELHCNFMIN-ADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +SE H NF+IN    AT  ++E L   V+ KV  Q+ I L  E+  +GD
Sbjct: 254 VSEKHANFIINHQGTATAANIEALIHLVQTKVREQTSIELIREVHIIGD 302


>gi|307611492|emb|CBX01163.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Legionella
           pneumophila 130b]
          Length = 310

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 106/289 (36%), Positives = 153/289 (52%), Gaps = 2/289 (0%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRD 77
           +G    N PL + T +R GG A  +++P +I DL  FL+ LP D P+  +GLGSN L+RD
Sbjct: 17  QGTLLFNEPLAEYTTWRVGGPAARLYKPANIDDLALFLSRLPFDEPLLWLGLGSNSLIRD 76

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G  G V+ L+      + + +   + V A  S  S+A  + R+ + G  F+ GIPG++G
Sbjct: 77  GGFSGTVI-LTQGCLKEMTLLSDNCIRVEAGVSCASMARFSARNNLSGGEFWAGIPGTMG 135

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRG 197
           GA  MNAG +  ET Q V+EV  I+R+G       E+ +  YR      D       L+ 
Sbjct: 136 GALRMNAGCHGGETWQSVIEVQTINRRGEIRTRKPEEFEVAYRHVAGLGDEWFISAKLQL 195

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P ++      I ++  HR   QP  E   GS F+NP G  A +LIE  G +G+  GGA 
Sbjct: 196 SPGNKETSLQLIKDLLAHRAKTQPTNEYNCGSVFRNPPGDFAARLIESCGLKGVSIGGAV 255

Query: 258 ISELHCNFMIN-ADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +SE H NF+IN    AT  ++E L   V+ KV  Q+ I L  E+  +GD
Sbjct: 256 VSEKHANFIINHQGTATAANIEALIHLVQTKVREQTSIELIREVHIIGD 304


>gi|323705031|ref|ZP_08116607.1| UDP-N-acetylenolpyruvoylglucosamine reductase
           [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323535457|gb|EGB25232.1| UDP-N-acetylenolpyruvoylglucosamine reductase
           [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 301

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 111/287 (38%), Positives = 163/287 (56%), Gaps = 11/287 (3%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIRG 82
           N P+ + T FR GG A+V+  PQ + +L   + L+ ++ IP  I+G G+NI+V D GIRG
Sbjct: 20  NEPMSRHTSFRIGGPADVLVIPQSVDELIKVMGLIKAENIPYFILGNGTNIIVSDKGIRG 79

Query: 83  VVLRLSNAGFSNIEVRNHCEMIV---GARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           VV++L+      I V    EMIV   GA  S  S+AN+AL + + GF F  GIPG++GGA
Sbjct: 80  VVIKLT--AIRKISV--DGEMIVSEAGALLS--SIANTALDNELTGFEFASGIPGTLGGA 133

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGF 198
             MNAGA   E    V +V  ID  G+ + +    +++ YRSS I  D LI     +   
Sbjct: 134 ITMNAGAYGPEIKDVVEKVEVIDEDGSIYEVKNGNMRFGYRSSLIQLDNLIAIRAWIHLK 193

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
             +   I A +  +   R+  QP++  + GS FK P G  A +LI+ +G  G   GGA++
Sbjct: 194 KGNYKDIKAKMDELNGLRKMKQPLEYPSAGSVFKRPEGFYAGKLIQDAGLSGYTIGGAQV 253

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE HC F+IN  NAT  D+  L   ++K V ++ G+ LE E+K +G+
Sbjct: 254 SEKHCGFIINKGNATADDVLNLIAYIKKTVKDKFGVDLETEVKIIGE 300


>gi|300853520|ref|YP_003778504.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           ljungdahlii DSM 13528]
 gi|300433635|gb|ADK13402.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           ljungdahlii DSM 13528]
          Length = 304

 Score =  169 bits (429), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 102/282 (36%), Positives = 160/282 (56%), Gaps = 5/282 (1%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIRGVV 84
           P+K+ T FR GG  +++  P+   ++   +TL    +IP  I+G GSN+LV+D GIRG++
Sbjct: 25  PMKEHTSFRVGGPVDILVTPKKFQEVVDVITLCKEHNIPYYIMGNGSNLLVKDGGIRGIM 84

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           ++L     + ++V ++ ++I  +  S K ++ +AL + + GF F  GIPGS+GGA  MNA
Sbjct: 85  IKL--IKLNEVKVEDN-KIITESGVSLKDISTTALNNKLSGFEFACGIPGSVGGAVTMNA 141

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGFPESQN 203
           GA N E S  V     ID +G   V+ R+QL+ +YRSS I K    +  V          
Sbjct: 142 GAYNGEISHVVESAKVIDNEGKIKVLDRKQLELEYRSSSILKYKYTVLEVTFNLEHGDYE 201

Query: 204 IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHC 263
            I   + ++   R   QP++  + GSTFK P G+ A +LIE SG +G   GGA++SE H 
Sbjct: 202 KIKNRVEDLNRRRNEKQPLEYPSAGSTFKRPEGYFAAKLIEDSGLKGKSVGGAQVSEKHS 261

Query: 264 NFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            F+IN  +AT  D+  L   V+ KV  +  + L  E++ +G+
Sbjct: 262 GFIINKGSATAKDILDLIAIVQHKVKEKFNVDLYTEVRVIGE 303


>gi|254479442|ref|ZP_05092771.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Carboxydibrachium
           pacificum DSM 12653]
 gi|214034627|gb|EEB75372.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Carboxydibrachium
           pacificum DSM 12653]
          Length = 294

 Score =  169 bits (429), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 109/293 (37%), Positives = 162/293 (55%), Gaps = 11/293 (3%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVR 76
            GK   N P+K+ T F+ GG A+V+  P    +L   +  L  + IP  I+G G+N+LV 
Sbjct: 7   EGKLYLNEPMKRHTSFKIGGPADVLAVPGSRDELINLIAYLRQEKIPFFILGNGTNLLVS 66

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           + GIRGVV++LS+    N+ V    ++I  A  S   +AN AL H + GF F  GIPG++
Sbjct: 67  EKGIRGVVVKLSS--LRNVIVEG-TKIIAEAGASLSYIANVALVHELTGFEFASGIPGTL 123

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGA   E    V +V  +D   N  ++  +++K+ YR S + +      +VLR
Sbjct: 124 GGAIVMNAGAYGSEMKDVVEKVEVLDENNNILILSNQEMKFSYRYSILQEK---EWIVLR 180

Query: 197 GFPESQ----NIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
            +   +      I   +  +   R+  QP+   + GSTFK P G+ A +LIE +G +G  
Sbjct: 181 AWISLERGNYEEIKKKMEELNQRRKEKQPLDYPSAGSTFKRPPGYYAGKLIEDAGLKGYS 240

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            GGAK+SE H  F+IN  NAT YD+  L E ++K V  + G+ L  EIK +G+
Sbjct: 241 IGGAKVSEKHSGFIINTGNATFYDVLNLIEYIQKVVKEKFGVELMPEIKIVGE 293


>gi|270159085|ref|ZP_06187741.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Legionella
           longbeachae D-4968]
 gi|289166079|ref|YP_003456217.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Legionella
           longbeachae NSW150]
 gi|269987424|gb|EEZ93679.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Legionella
           longbeachae D-4968]
 gi|288859252|emb|CBJ13186.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Legionella
           longbeachae NSW150]
          Length = 303

 Score =  169 bits (429), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 102/292 (34%), Positives = 151/292 (51%), Gaps = 2/292 (0%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
           +L+G    N  L + T +R GG A  +++P +I DL  FL  LP   P+  +GLGSN L+
Sbjct: 13  KLQGTLLYNESLAEYTTWRVGGPAAKLYKPANIADLSLFLRQLPETEPLLWLGLGSNSLI 72

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD G  G V+ L+      + + +   + VGA  S  S+A    R+ + G  F+ GIPG+
Sbjct: 73  RDGGFSGTVI-LTQGCLKEVALLDAQTIKVGAGVSCASMARFCARNDLSGGEFWAGIPGT 131

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           +GGA  MNAG +  ET Q V+E+  + R+G   +   E+ +  YR      D        
Sbjct: 132 MGGALRMNAGCHGGETWQSVIELQTMTRRGEIKIRKPEEYEVAYRHVLAPSDEWFVSATF 191

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           +  P ++      I ++  HR   QP  E   GS F+NP G  A +LIE  G +G   GG
Sbjct: 192 KLNPGNKETSLQVIKDLLAHRANTQPTNEYNCGSVFRNPPGDYAARLIESCGLKGFTIGG 251

Query: 256 AKISELHCNFMIN-ADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           A +S+ H NF+IN   +A   D+E L   V+ KV  Q+ I L  E+  +GD+
Sbjct: 252 AVVSQKHANFIINHQGSAIAADIEALIHLVQTKVREQTTIELMREVHIIGDY 303


>gi|188589074|ref|YP_001922470.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           botulinum E3 str. Alaska E43]
 gi|254764147|sp|B2UZY4|MURB_CLOBA RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|188499355|gb|ACD52491.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           botulinum E3 str. Alaska E43]
          Length = 304

 Score =  169 bits (429), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 158/288 (54%), Gaps = 5/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDA 78
           + QEN  + +   FR GG  +++  P     +   + +   + IP  ++G GSN+LV+D+
Sbjct: 19  QIQENAKMSEHINFRVGGPVDILLTPNTKEQIVETIKICKENKIPFYVLGNGSNVLVKDS 78

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIRGVV++LS   F NI VR    +   +    K ++  AL+  + GF F  GIPGS+GG
Sbjct: 79  GIRGVVIKLSE--FDNI-VRTGNTIKAESGALLKDVSAEALKASLTGFEFACGIPGSVGG 135

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGF 198
           A +MNAGA + E S  + E   +   G    + ++QL+  YR+S I K   I       F
Sbjct: 136 AVFMNAGAYDGEISFVIKEAEVMSEDGKIITLSKDQLELGYRTSAIMKKNYIVITATFCF 195

Query: 199 PESQ-NIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
              + + I   ++ + + RE  QP++  + GSTFK P GH A +LI+ +G +    GGA 
Sbjct: 196 ESGEKDKIEGRVSELTNKREEKQPLEFPSAGSTFKRPEGHFAGKLIQDAGLKDFTLGGAA 255

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S  HC F+IN  NAT  D+  L E V+K+V  Q G+ L  E++ +G+
Sbjct: 256 VSGKHCGFIINKSNATAKDILDLIEYVQKEVKKQFGVDLYPEVRIIGE 303


>gi|255282641|ref|ZP_05347196.1| UDP-N-acetylmuramate dehydrogenase [Bryantella formatexigens DSM
           14469]
 gi|255266934|gb|EET60139.1| UDP-N-acetylmuramate dehydrogenase [Bryantella formatexigens DSM
           14469]
          Length = 300

 Score =  169 bits (429), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 107/286 (37%), Positives = 153/286 (53%), Gaps = 10/286 (3%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRGVV 84
           P+ + T FR GG A+    P    +L   + L   S +P  ++G GSN+LV D G+RGVV
Sbjct: 20  PMSRHTTFRIGGPADYFVLPHSSGELAAVIALCRESAVPWYVIGNGSNLLVGDKGVRGVV 79

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           ++L    F  I +      ++ A       A   L   + GF F  GIPG+IGGA  MNA
Sbjct: 80  IQLFK-NFQKIVIEEET-AVLQAGVINSLAAKRLLDAELTGFEFAAGIPGTIGGAVVMNA 137

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVL---RGFPE 200
           GA   E    V  V  +D  G    +P ++L++ YR+S + +   ++T V L   RG  E
Sbjct: 138 GAYGGEMKDIVSSVTVLDENGALQTLPADELEFGYRTSIVARRGYVVTEVTLALQRGCRE 197

Query: 201 SQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISE 260
               I+A +  +   R T QP++  + GSTFK P G+ A +LI  +G RG   GGA++SE
Sbjct: 198 E---IAARMEELKERRITKQPLEYPSAGSTFKRPEGYFAGKLIMDAGLRGFSVGGAQVSE 254

Query: 261 LHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
            HC F+IN   AT  D+  L E V+  V  + G+ LE E+KRLG+F
Sbjct: 255 KHCGFVINTGGATAADVVALMEAVQDTVEKKFGVRLEPEVKRLGEF 300


>gi|182418200|ref|ZP_02949500.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           butyricum 5521]
 gi|237666150|ref|ZP_04526137.1| UDP-N-acetylmuramate dehydrogenase [Clostridium butyricum E4 str.
           BoNT E BL5262]
 gi|182378018|gb|EDT75558.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           butyricum 5521]
 gi|237658240|gb|EEP55793.1| UDP-N-acetylmuramate dehydrogenase [Clostridium butyricum E4 str.
           BoNT E BL5262]
          Length = 304

 Score =  169 bits (428), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 102/301 (33%), Positives = 161/301 (53%), Gaps = 11/301 (3%)

Query: 7   SRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPIT 65
           S++  E   QL  K  E+       +F+ GG  +++  P +I  LK  +T+   ++IP  
Sbjct: 12  SKIYNESQIQLDAKMSEHI------YFKVGGPVDILLTPNNIDQLKETITVCKDNNIPFY 65

Query: 66  IVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGG 125
           ++G GSN+LV+D GIRGVV+++ +   + IE R   ++  G     K ++  A    + G
Sbjct: 66  VIGNGSNLLVKDGGIRGVVIKVCD--LNKIE-RMGNKIKAGTGALLKDVSKEATEAALAG 122

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT 185
           F F  GIPGS+GGA YMNAGA + E S  +     +D      V+ +E+L   YR S + 
Sbjct: 123 FQFACGIPGSVGGAVYMNAGAYDGEISFVIESAEVLDDNQEIRVLSKEELNLGYRQSVVM 182

Query: 186 -KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIE 244
            K  ++        P+  + I + +  +   RE  QP++  + GSTFK P GH A +LIE
Sbjct: 183 QKGYVVLSATFELTPDDHDKIESRVNELTTRREDRQPLEYPSAGSTFKRPEGHFAGKLIE 242

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            +G +G   GGA +SE H  F+IN  N T  D+  +   V+++V  Q G+ L  E++ LG
Sbjct: 243 DAGLKGYTVGGACVSEKHAGFVINKANGTAKDVLDVIHHVQEEVKRQFGVELHPEVRILG 302

Query: 305 D 305
           +
Sbjct: 303 E 303


>gi|319649662|ref|ZP_08003818.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus sp.
           2_A_57_CT2]
 gi|317398824|gb|EFV79506.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus sp.
           2_A_57_CT2]
          Length = 302

 Score =  169 bits (428), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 98/289 (33%), Positives = 158/289 (54%), Gaps = 5/289 (1%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRD 77
           G  +EN P+   T  + GG A++  +P  I +L   + L+ S ++    +G GSN+LV D
Sbjct: 14  GTVKENEPMANHTTMKIGGPADLFIEPSSIENLAKAMELIQSYEMKWRAIGRGSNLLVSD 73

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            GI GVV++L   G   +++ N  E+  G   S  +L+    + G+ G  F  GIPGS+G
Sbjct: 74  GGIEGVVIKLGR-GMDQLDL-NGAELRAGGGYSLVALSTIISKKGLSGLEFASGIPGSVG 131

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL--IITHVVL 195
           GA YMNAGA+  + SQ +   H +   G    +  E++++ YR+S + K    I+   V 
Sbjct: 132 GAVYMNAGAHGSDISQILTRAHVLFEDGKMEWLTNEEMEFSYRTSVLQKKRPGIVLEAVF 191

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           R     +  IS+A+     +R+  QP      GS F+NP    A QLIEK+G +G   GG
Sbjct: 192 RLTEGDREKISSAMQKNKDYRKETQPWNYPCAGSIFRNPLPEYAGQLIEKAGMKGHSIGG 251

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           A+IS +H NF++NA +A   D+  L + ++  +F+  G+ +E E++ +G
Sbjct: 252 AQISNMHGNFIVNAGDAKAEDVLALIQHIKDTIFDLYGVKMETEVEIIG 300


>gi|134298545|ref|YP_001112041.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Desulfotomaculum
           reducens MI-1]
 gi|172044255|sp|A4J2B3|MURB_DESRM RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|134051245|gb|ABO49216.1| UDP-N-acetylmuramate dehydrogenase [Desulfotomaculum reducens MI-1]
          Length = 303

 Score =  169 bits (427), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 103/307 (33%), Positives = 166/307 (54%), Gaps = 7/307 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-P 59
           MIY   + L  E    ++G  Q N P+++ T ++ GG A++   P D  D++  +     
Sbjct: 1   MIY---TSLAGELQSLVKGSIQINEPMRKHTTWKIGGKADLFLNPSDKEDIRQAVEFARE 57

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
             IPIT++G GSN+LV+D GIRG+V+++   G + I +     +  GA      LA  A 
Sbjct: 58  KAIPITVIGNGSNLLVKDGGIRGLVIKVGR-GMAKITIEG-TSIKAGAGALLPELAVFAC 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
           ++ +GGF F  GIPGS+GGA  MNAGA N   S  +  +  ++ +    V+ ++ L + Y
Sbjct: 116 KNSLGGFGFAAGIPGSLGGAIVMNAGAMNGCVSDVLQSIVVLNERNQFEVLTKDHLNFAY 175

Query: 180 RSSEI-TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R+S + ++ LI      +G+ + Q +I          R+  QP      GS FKNP G  
Sbjct: 176 RTSNLQSRGLICVETCWQGYAKDQWLIEQETKEYLAKRKAAQPQGFPNAGSVFKNPEGDF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LIE  G +GL  G A++S  H N+++N   AT  D+  L + +++ V  + G+LL+ 
Sbjct: 236 AGRLIEGCGGKGLRVGDAEVSSKHANWILNLGRATAQDVLILIDHLKQMVQERFGVLLQL 295

Query: 299 EIKRLGD 305
           E+K LG+
Sbjct: 296 EVKVLGE 302


>gi|299143611|ref|ZP_07036691.1| UDP-N-acetylmuramate dehydrogenase [Peptoniphilus sp. oral taxon
           386 str. F0131]
 gi|298518096|gb|EFI41835.1| UDP-N-acetylmuramate dehydrogenase [Peptoniphilus sp. oral taxon
           386 str. F0131]
          Length = 299

 Score =  169 bits (427), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 108/290 (37%), Positives = 165/290 (56%), Gaps = 8/290 (2%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRD 77
           GK   N PLK+ T FR GGNA+ +  P D + L   + L    ++   ++G  +NILV D
Sbjct: 12  GKVLLNEPLKKYTSFRIGGNAKAVLLPVDENALIDSIKLCKEKNMNYIVLGNCTNILVDD 71

Query: 78  AGIRGVVLRLSNAGFSNIEV-RNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
            G  G+ + L      +I V RN      GA    + +A  A+ + +GG  F +GIPGS+
Sbjct: 72  EGFDGLAIILKGV-LDDIRVDRNILTAKSGATL--RQVATIAMENSLGGLEFAHGIPGSV 128

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD--LIITHVV 194
           GG A MNAGA + E    V  V  +D + N   +  E++++ YR+S I +D   II  V 
Sbjct: 129 GGGAIMNAGAYDGELKDVVESVRLLDDELNIIELSNEEMQFSYRNS-IAQDRGYIILSVK 187

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
            + F ++   I   + +  + R   QP++  + GSTF+ PTG+ A +LI+ SG RGL+ G
Sbjct: 188 FKLFEKNIEEIKEKMNDFYNRRREKQPLEYPSAGSTFRRPTGYFAGRLIDDSGLRGLKHG 247

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           GA++S+ HC F+INADNAT  D+  L E V+K V+++  + L+ E+K +G
Sbjct: 248 GAQVSQKHCGFVINADNATAKDVRELIEIVQKTVYDKFNVELKREVKYIG 297


>gi|304436489|ref|ZP_07396463.1| UDP-N-acetylmuramate dehydrogenase [Selenomonas sp. oral taxon 149
           str. 67H29BP]
 gi|304370535|gb|EFM24186.1| UDP-N-acetylmuramate dehydrogenase [Selenomonas sp. oral taxon 149
           str. 67H29BP]
          Length = 303

 Score =  169 bits (427), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 104/295 (35%), Positives = 166/295 (56%), Gaps = 14/295 (4%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVR 76
           R +  EN P++  T FR GG A+++F P +  +++  +      DIP+T++G GSN+L+R
Sbjct: 15  RTRLFENAPMRFHTTFRIGGPADLLFYPHNTEEVRAIIQKAKHYDIPVTVLGNGSNLLIR 74

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSG---KSLANSALRHGIGGFHFFYGIP 133
           D GIRG+V+R S    S I  +    +IV   CSG   K +A+ A + G+ G  F  GIP
Sbjct: 75  DGGIRGLVIRFSRQ-MSAI-TQEGTTLIV---CSGALLKDIASFAQKKGLSGLEFACGIP 129

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI---TKDLII 190
           GSIGGA +MNAGA + E    V+ V  I   G       ++L + YR S      + +  
Sbjct: 130 GSIGGAIFMNAGAYDGEVKSVVMAVKTISPDGEVRRYSADELDFGYRHSVFHTNNEAICE 189

Query: 191 THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRG 250
            H+ LR   +  + I   ++++   RE+ QP+   + GSTFK P G+ A  LI+++G +G
Sbjct: 190 AHLCLR--TDDPSSILERMSDLNQRRESKQPLSYPSAGSTFKRPPGYFAGTLIDQTGLKG 247

Query: 251 LEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           L +GGA++S  H  F+IN   AT  D++ L   V+ +V+ +  + L  E++ +G+
Sbjct: 248 LTYGGAQVSHKHAGFIINIGGATARDVQQLIHSVQNRVYAKHHVRLFPELRIIGE 302


>gi|325478750|gb|EGC81861.1| UDP-N-acetylmuramate dehydrogenase [Anaerococcus prevotii
           ACS-065-V-Col13]
          Length = 300

 Score =  168 bits (426), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 106/287 (36%), Positives = 155/287 (54%), Gaps = 10/287 (3%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIRG 82
           N PLK  T F  GG+A+ + +P    +LK  L +   + I  T++G GSN+L+ D GIRG
Sbjct: 18  NHPLKDYTTFGIGGDADALLKPTCEQELKNILKINHENGIKTTVIGRGSNLLISDKGIRG 77

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL---RHGIGGFHFFYGIPGSIGGA 139
            V+ L++  +  IEV      I+ A  +G SL  +AL      + G     GIPGSIGGA
Sbjct: 78  AVIVLAD-NYDKIEVDGD---IITA-LAGTSLNETALFAIEENLTGMEEISGIPGSIGGA 132

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLRGF 198
             MNAGA   E     + V   D +GN++     ++ + YR S+I  +DLI++    +  
Sbjct: 133 VAMNAGAYGGEIKDICLLVKAFDFEGNEYEFTNTEMNFSYRHSKIFEQDLIVSSASFKLK 192

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
               + I     +    R + QP+  K+ GSTFK P G  A +LI++ G RG   G  ++
Sbjct: 193 QGIHDEIVEKYQDYTSRRTSKQPLDRKSAGSTFKRPVGSYASKLIDECGLRGYRKGQCQV 252

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE HC F+IN DNAT  D+    E+V K V  ++G +LE E+K +GD
Sbjct: 253 SEKHCGFIINVDNATCTDMLAFIEEVSKIVNEKTGFVLEREVKLIGD 299


>gi|147678194|ref|YP_001212409.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Pelotomaculum
           thermopropionicum SI]
 gi|189028925|sp|A5D143|MURB_PELTS RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|146274291|dbj|BAF60040.1| UDP-N-acetylmuramate dehydrogenase [Pelotomaculum thermopropionicum
           SI]
          Length = 313

 Score =  168 bits (426), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 106/297 (35%), Positives = 169/297 (56%), Gaps = 4/297 (1%)

Query: 11  RERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGL 69
           RE  + L G+ +   P+K+ T +R GG ++V  +P+   +L+  +      D P+ ++G 
Sbjct: 8   RELAELLPGRVRAGEPMKKHTTWRIGGPSDVFVEPEGREELRRVVCYASRRDAPLYVIGN 67

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
           GSN+LV D G+RG+V+++   G S I ++ + ++I  A      +A +A   G+GGF F 
Sbjct: 68  GSNLLVADGGVRGIVVKIGK-GLSRISIKGN-KIIAEAGARLAGVAAAAGEAGLGGFEFL 125

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DL 188
            GIPG+IGGA  MNAGAN       V EV  +D  G      +E++K+ YRSS I K  L
Sbjct: 126 AGIPGTIGGAVAMNAGANGFSLGNLVEEVLLLDFHGEFCRKTKEEMKFGYRSSIIQKAPL 185

Query: 189 IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGC 248
           I+   +   +P ++  I   +      R+  QP+   + GS FKNP G +A +LIE +G 
Sbjct: 186 ILVEALFSCYPRNKEEIREEMERFLARRKLTQPLCYPSAGSVFKNPPGDTAGRLIEMAGL 245

Query: 249 RGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +G+  G A+IS LH NF++N  +AT  D+  L E+ R+ V  + G+ L+ E+K +G+
Sbjct: 246 KGMRVGDAQISTLHANFIVNLGSATARDVLALIEKAREAVLARFGVELKLEVKIIGN 302


>gi|121998868|ref|YP_001003655.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Halorhodospira
           halophila SL1]
 gi|121590273|gb|ABM62853.1| UDP-N-acetylmuramate dehydrogenase [Halorhodospira halophila SL1]
          Length = 301

 Score =  168 bits (426), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 110/301 (36%), Positives = 157/301 (52%), Gaps = 17/301 (5%)

Query: 12  ERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGS 71
           ER +   G+++E  P+   T +R GG A  +F P D   L   L  L ++ P+   GLGS
Sbjct: 6   ERRRIRPGEWREQEPMAGYTTWRVGGPARRLFCPADRAGLLDCLARLSAEEPLHWCGLGS 65

Query: 72  NILVRDAGIRGVVLRLSNAGFSNIEV-----RNHCEMIVGARCSGKSLANSALRHGIGGF 126
           N+LVRD G+ G V+ LS  G   + V     R H E  V    +G  LA +A+R G+ G 
Sbjct: 66  NLLVRDGGVAGTVI-LSQGGLDGLAVDGAQGRVHAEAGV----AGGRLARAAVREGLAGL 120

Query: 127 HFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK 186
            F  GIPG++GGA  +NAGA   ET   VVEV  +DR G          +  YR      
Sbjct: 121 EFLAGIPGTVGGALALNAGAWGGETWSRVVEVETVDRHGCVRRRTPADFRVGYRRVVGPA 180

Query: 187 D---LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
               L  T  +  G P++ N     +  +   R   QP+ + T GS F+NP G +A +LI
Sbjct: 181 GEWFLAATWALPSGDPQALN---ERVRALLRRRNAAQPVGQPTCGSVFRNPPGDAAGRLI 237

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           E++G +G   GGA++SE H NF+IN +  +  D+E L E VR++V    G+ LE E+  +
Sbjct: 238 EQAGLKGARRGGARVSERHANFIIN-EGGSAADIEGLIEVVRQRVAEVHGVRLETEVHVI 296

Query: 304 G 304
           G
Sbjct: 297 G 297


>gi|167464922|ref|ZP_02330011.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Paenibacillus larvae
           subsp. larvae BRL-230010]
 gi|322384119|ref|ZP_08057837.1| UDP-N-acetylenolpyruvoylglucosamine reductase-like protein
           [Paenibacillus larvae subsp. larvae B-3650]
 gi|321151199|gb|EFX44508.1| UDP-N-acetylenolpyruvoylglucosamine reductase-like protein
           [Paenibacillus larvae subsp. larvae B-3650]
          Length = 301

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 106/289 (36%), Positives = 160/289 (55%), Gaps = 4/289 (1%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRD 77
           G+   +  L   T ++ GG A+V+  P+   +L   + +L     P  I+G GSN+LV D
Sbjct: 14  GEICPDEVLAPYTTWKIGGPADVLVIPESKEELAAAIAVLHRHRTPWMILGRGSNLLVCD 73

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            GIRG V++L N+ F  + + NH  +   A  S   L+  A + G+ G  F  GIPGS+G
Sbjct: 74  KGIRGAVIKLGNS-FDTVRLENHL-IYADAAYSIIKLSVMAGKAGLTGLEFAGGIPGSVG 131

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLR 196
           GA YMNAGA+  + S+ + +   I   G    + +E L+Y YR S + T   I+T  V  
Sbjct: 132 GAVYMNAGAHGSDVSRILKQADVILDTGELVTMQQEDLQYAYRHSILHTLPGIVTEAVFE 191

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
             P  +  I+AA+A     R   QP+     GS F+NP  H A +LIE+SG +G   GGA
Sbjct: 192 LEPGDRKEIAAALAAYKDRRLRTQPLGLACAGSVFRNPDKHYAAKLIEESGLKGTSVGGA 251

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +IS LH NF++N  NAT  D+  L +++++ V++  GI LE E+  +G+
Sbjct: 252 EISPLHANFIVNTGNATAEDVLTLIQKIQQTVWDHHGIGLEPEVLVVGE 300


>gi|251779399|ref|ZP_04822319.1| UDP-N-acetylmuramate dehydrogenase [Clostridium botulinum E1 str.
           'BoNT E Beluga']
 gi|243083714|gb|EES49604.1| UDP-N-acetylmuramate dehydrogenase [Clostridium botulinum E1 str.
           'BoNT E Beluga']
          Length = 304

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 157/288 (54%), Gaps = 5/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDA 78
           + QEN  + +   FR GG  +++  P     +   + +   + IP  ++G GSN+LV+D+
Sbjct: 19  QIQENAKMSEHINFRVGGPVDILLTPNTKEQIVETIKICKENKIPFYVLGNGSNVLVKDS 78

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIRGVV++LS   F NI VR    +   +    K ++  AL+  + GF F  GIPGS+GG
Sbjct: 79  GIRGVVIKLSE--FDNI-VRTGNTIKAESGALLKEVSAEALKASLTGFEFACGIPGSVGG 135

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGF 198
           A +MNAGA + E S  + E   +   G    + ++QL+  YR+S I K   I       F
Sbjct: 136 AVFMNAGAYDGEISFVIKEAEVMSEDGKIITLSKDQLELGYRTSAIMKKNYIVITATFCF 195

Query: 199 PE-SQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
               ++ I   +  + + RE  QP++  + GSTFK P GH A +LI+ +G +    GGA 
Sbjct: 196 KSGEKDKIEGRVYELTNKREEKQPLEFPSAGSTFKRPEGHFAGKLIQDAGLKDFTLGGAA 255

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S  HC F+IN  NAT  D+  L E V+K+V  Q G+ L  E++ +G+
Sbjct: 256 VSGKHCGFIINKSNATAKDILDLIEYVQKEVKKQFGVDLYPEVRIIGE 303


>gi|196230906|ref|ZP_03129767.1| UDP-N-acetylmuramate/alanine ligase [Chthoniobacter flavus
           Ellin428]
 gi|196225247|gb|EDY19756.1| UDP-N-acetylmuramate/alanine ligase [Chthoniobacter flavus
           Ellin428]
          Length = 766

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 104/283 (36%), Positives = 154/283 (54%), Gaps = 7/283 (2%)

Query: 26  PLKQITWFRTGGNAEVMFQPQD---IHDLKYFLTLLPSDIPITIVGLGSNILVRDAGIRG 82
           PL + T  R GG A+   +P+       L  F TL  ++IP+ ++G GSN+LVRD GIRG
Sbjct: 482 PLSKHTTMRVGGPAQFWAEPETEEAFARLVRFCTL--NEIPLFVMGRGSNLLVRDGGIRG 539

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           VV+ L+   F  IEV++  ++  G     K LA +A    IGGF +  GIPG+IGGA  M
Sbjct: 540 VVVHLARGEFKTIEVKD-GKIQAGVGVKQKELAYAARDAEIGGFEWLEGIPGNIGGALRM 598

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPESQ 202
           NAGA   ET + VV V  +D  GN H+    ++  +YR     +          G P + 
Sbjct: 599 NAGAMGGETFRQVVSVRFVDPHGNFHMKTPAEMDVRYRHCGTLEKNFAVSATFVGHPGNA 658

Query: 203 NIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELH 262
             I   +    H R T QP +E + G  FKNP    A +L+++ G +G   GGAK+SE+H
Sbjct: 659 EEIEKLLEASTHKRRTSQP-RESSAGCIFKNPEQCPAGKLVDELGLKGTRVGGAKVSEVH 717

Query: 263 CNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            NF++N   AT  D+  + ++V++    + GI LE E++ +G+
Sbjct: 718 GNFIVNDGGATAADVLAVIDKVKEVALRERGIQLETEVQIVGE 760


>gi|218289900|ref|ZP_03494090.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Alicyclobacillus
           acidocaldarius LAA1]
 gi|218240040|gb|EED07226.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Alicyclobacillus
           acidocaldarius LAA1]
          Length = 316

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 107/295 (36%), Positives = 164/295 (55%), Gaps = 11/295 (3%)

Query: 15  KQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNI 73
           K +RG+     P+K+ T +R GG A+   +P  ++ L+  +    +  +PIT++G GSN 
Sbjct: 16  KVIRGE-----PMKRHTTWRIGGPADYFVEPDSVNALRASVCAARAHGLPITVIGRGSNT 70

Query: 74  LVRDAGIRGVVLRLSNAGFSNIEVR-NHCEMIVGARCSGKSLANSALRHGIGGFHFFYGI 132
           LV D GIRG+V++L +A F++ EV+ + C +   A  S  +LAN A+RHG+ G  F  GI
Sbjct: 71  LVLDGGIRGLVIKLHDA-FASYEVKEDECAVYAMAGRSYVALANLAIRHGLSGLEFATGI 129

Query: 133 PGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL--II 190
           PGS+GGA  MNAGA   ET + +     +D  G    +    L++ YR S + KD   I+
Sbjct: 130 PGSVGGAVMMNAGAYGRETCEVLAWAEVMDETGAITRLSNGDLRFGYRYS-VLKDRFGIV 188

Query: 191 THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRG 250
           T    +  P  ++ +   +      R   QP+     GS F+NP G  A +LIE++G +G
Sbjct: 189 TWAKFQLKPGDRDEMRRVVREWSQRRIATQPLSFPNCGSVFRNPEGTHAARLIEEAGLKG 248

Query: 251 LEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           L  G A IS+ H NF+IN  NA+  D+ +L    +  V  + GI LE E++ LG+
Sbjct: 249 LRRGQAMISDKHANFIINLGNASASDVLWLIRHAQAVVRERFGIALETEVRVLGE 303


>gi|167745940|ref|ZP_02418067.1| hypothetical protein ANACAC_00635 [Anaerostipes caccae DSM 14662]
 gi|167654455|gb|EDR98584.1| hypothetical protein ANACAC_00635 [Anaerostipes caccae DSM 14662]
          Length = 302

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 105/286 (36%), Positives = 160/286 (55%), Gaps = 10/286 (3%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFL-TLLPSDIPITIVGLGSNILVRDAGIRGVV 84
           P+K+ T FR GG AE+   P+ I ++++ + T    +IP+ I+G GSN+LV D GI G+V
Sbjct: 22  PMKKHTTFRIGGEAELYIIPETIEEVQWTVKTARKHEIPMFILGNGSNLLVGDRGIDGIV 81

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           L++     + I V N  E+   A     S+A  A    + GF F  GIPG+ GGA  MNA
Sbjct: 82  LQIYK-NMNEITV-NGTEITAQAGALLSSIAREAQNRSLTGFEFAGGIPGTFGGAITMNA 139

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPE---- 200
           GA   E  Q + E   + ++G    +  E+L+  YR+S +   +   + VL G       
Sbjct: 140 GAYGGEMIQVLKEATVLTKEGEILTLSAEELELGYRTSNV---ITCGYTVLSGTLSLKEG 196

Query: 201 SQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISE 260
             + I   +      R+T QP++  + GSTFK P G+ A +LI+ +G RG + GGA++S+
Sbjct: 197 DPSEIKKQMDEYSMARKTKQPLELPSAGSTFKRPEGYFAGKLIDDAGLRGYQVGGARVSD 256

Query: 261 LHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
            HC F++N +NAT  D+  L E V+K V  + G+ LE E+KR+G F
Sbjct: 257 KHCGFVVNQENATAKDVLQLIEDVQKTVKEKFGVDLEPEVKRVGKF 302


>gi|227484661|ref|ZP_03914977.1| UDP-N-acetylmuramate dehydrogenase [Anaerococcus lactolyticus ATCC
           51172]
 gi|227237381|gb|EEI87396.1| UDP-N-acetylmuramate dehydrogenase [Anaerococcus lactolyticus ATCC
           51172]
          Length = 300

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 100/283 (35%), Positives = 152/283 (53%), Gaps = 6/283 (2%)

Query: 27  LKQITWFRTGGNAEVMFQPQDIHDLKYFLTL-LPSDIPITIVGLGSNILVRDAGIRGVVL 85
           L   T F  GG A+V+ +P  + +L+  L     ++I   ++G GSN+LV D GIRG V+
Sbjct: 21  LNTYTTFGIGGPADVLAKPTSVEELEELLKFNHENNIKTFVMGKGSNLLVSDKGIRGCVI 80

Query: 86  RLSNAGFSNIEVR-NHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
            L++  F ++++  N+   + G   +  SLA  A+  G+ G     GIPGS+GGA  MNA
Sbjct: 81  VLAD-NFDDVKIEGNYLTALSGTSLNKASLA--AIDEGLAGMEEISGIPGSVGGAVSMNA 137

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFPESQN 203
           GA   E     VE+   D +G  H    E++ + YR S I  D LI+     +     ++
Sbjct: 138 GAYGGEIKDIAVEIKAFDFEGKLHTFKNEEMSFSYRHSRIFDDNLIVVSAKFKLEKGDKH 197

Query: 204 IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHC 263
           II+    +  + R+T QP+ +K+ GSTFK P G  A +LI++ G RG   G  ++SE HC
Sbjct: 198 IITEKYLDYTNRRQTKQPLDKKSAGSTFKRPEGSYASKLIDECGLRGFREGDCQVSEKHC 257

Query: 264 NFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
            F+IN D AT   +      V   V  ++G +LE E+K +GD 
Sbjct: 258 GFIINRDKATCKQMLDFINHVSSIVKEETGFVLEREVKLVGDL 300


>gi|78221635|ref|YP_383382.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacter
           metallireducens GS-15]
 gi|123572779|sp|Q39YL7|MURB_GEOMG RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|78192890|gb|ABB30657.1| UDP-N-acetylmuramate dehydrogenase [Geobacter metallireducens
           GS-15]
          Length = 300

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 105/291 (36%), Positives = 149/291 (51%), Gaps = 4/291 (1%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNIL 74
           +LRG+   + P+ + T  + GG A+    P D  DL   L LL  +  P  +VG G N+L
Sbjct: 12  ELRGEILRDEPMARHTSLKVGGAADFFVTPADRDDLTALLALLAETGTPYLVVGGGYNLL 71

Query: 75  VRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPG 134
           VRD GIRGVV+ L+      + +     ++ GA  + +         G+GG  F  GIPG
Sbjct: 72  VRDGGIRGVVISLAR--LDEMTLLAGERVMAGAGVTNRQFVQLLRDRGLGGLEFLCGIPG 129

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVV 194
           ++GGA  MNAGA+       V E+  I R G      R+ L Y YR   +    II    
Sbjct: 130 TVGGALAMNAGAHGGAVVDRVEELLTI-RDGEMLQTGRDGLDYGYRFLRLAPGEIIVGAT 188

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
            R  P   + I A IA    HR   Q +     GS FKNP G +AW+LI+++G RG   G
Sbjct: 189 FRLDPADPDQIGARIAGYLEHRAASQKVGFPNAGSFFKNPEGTAAWRLIDETGLRGERVG 248

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           GA++SE H NF+IN   AT  D   L  ++ + V  ++GI LE E++ +G+
Sbjct: 249 GAQVSEAHANFLINRGGATAADFLALATRINEAVKQRTGITLEEEVRIVGE 299


>gi|225175386|ref|ZP_03729381.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Dethiobacter
           alkaliphilus AHT 1]
 gi|225169138|gb|EEG77937.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Dethiobacter
           alkaliphilus AHT 1]
          Length = 307

 Score =  167 bits (424), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 99/287 (34%), Positives = 164/287 (57%), Gaps = 7/287 (2%)

Query: 25  FP---LKQITWFRTGGNAEVMFQPQDIHDLKYFLT-LLPSDIPITIVGLGSNILVRDAGI 80
           FP   +K+ T F+TGG A+++ +PQ I +L   +  +L  ++P  I+G GSN+LV D G+
Sbjct: 21  FPDEDMKKHTTFKTGGTADLLVEPQSIDELHKLMKFVLNEEVPYIIIGRGSNLLVSDQGV 80

Query: 81  RGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAA 140
           R +V+R+ +   S  E +N   + V A  +   +A+ A R+ + G  F  GIPG++GGA 
Sbjct: 81  RELVIRI-DKNLSKYETKNET-LEVEAGAAIIDVAHFAQRNSLSGLEFASGIPGTVGGAV 138

Query: 141 YMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFP 199
           +MNAGA   E    + EV  +   G+  V   ++L   YR+S + ++  I+     +   
Sbjct: 139 FMNAGAYGGEVKDVLEEVLVLTTDGHLVVKSVDELGLGYRTSVMQRNGDIVLKAKFKLQK 198

Query: 200 ESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKIS 259
            +Q +I   I  +   RE  QP++  + GSTFK PTG+ A +LI+ +G +G   GGA++S
Sbjct: 199 GNQEVIQNEINELKRKREESQPLELPSAGSTFKRPTGYFAGKLIQDAGLKGYRIGGAQVS 258

Query: 260 ELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
             H  F++N+ NA+  D+  L   ++ +V  Q G+ LE E+K +G+F
Sbjct: 259 LKHAGFVVNSGNASSSDIYNLIRHIQAEVKKQFGVTLETEVKLIGEF 305


>gi|325845029|ref|ZP_08168346.1| UDP-N-acetylmuramate dehydrogenase [Turicibacter sp. HGF1]
 gi|325488937|gb|EGC91329.1| UDP-N-acetylmuramate dehydrogenase [Turicibacter sp. HGF1]
          Length = 302

 Score =  167 bits (424), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 102/292 (34%), Positives = 156/292 (53%), Gaps = 6/292 (2%)

Query: 13  RGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGS 71
           +GK + G   EN PL + T FR GG A  +  P     L   + L+   ++P  ++G GS
Sbjct: 10  KGKNI-GLLLENEPLSKHTTFRVGGPARCLVIPNSKQSLVETMKLINKYELPFKVIGRGS 68

Query: 72  NILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYG 131
           N+L  D    G++++  + G  ++E+ +  ++ VGA  S   LAN   +  + G  F  G
Sbjct: 69  NLLPSDRLFEGIIVK-CDKGLDHVEI-DGTQVTVGAGVSTILLANKVAKCELAGLEFISG 126

Query: 132 IPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS--EITKDLI 189
           +PGS+GGA YMNAGA N E    +V+   +D  G    +  E++ + YR S  +  K+ I
Sbjct: 127 VPGSVGGAIYMNAGAYNREIQDVLVKALILDEAGELKWLTVEEMGFSYRQSILQTHKNWI 186

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
           +   VL+    S   I   +      R   QP    + GSTF+NP  H +WQLIE+SG R
Sbjct: 187 VVEAVLQLEKGSYEEIMELMKARKVRRIESQPTNLPSAGSTFRNPLPHYSWQLIERSGLR 246

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           G+  GGA++S+ HCNF++N   AT  D+  L + V+  VF + GI L  E++
Sbjct: 247 GVRIGGAEVSQKHCNFIVNVGGATATDIYELIQHVQAVVFEKHGIQLHPEVE 298


>gi|293376449|ref|ZP_06622679.1| UDP-N-acetylmuramate dehydrogenase [Turicibacter sanguinis PC909]
 gi|292644926|gb|EFF63006.1| UDP-N-acetylmuramate dehydrogenase [Turicibacter sanguinis PC909]
          Length = 302

 Score =  167 bits (424), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 102/292 (34%), Positives = 156/292 (53%), Gaps = 6/292 (2%)

Query: 13  RGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGS 71
           +GK + G   EN PL + T FR GG A  +  P     L   + L+   ++P  ++G GS
Sbjct: 10  KGKNI-GLLLENEPLSKHTTFRVGGPARCLVIPNSKQSLVETMKLINKYELPFKVIGRGS 68

Query: 72  NILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYG 131
           N+L  D    G++++  + G  ++E+ +  ++ VGA  S   LAN   +  + G  F  G
Sbjct: 69  NLLPSDRLFEGIIVK-CDKGLDHVEI-DGTQVTVGAGVSTILLANKVAKCELAGLEFISG 126

Query: 132 IPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS--EITKDLI 189
           +PGS+GGA YMNAGA N E    +V+   +D  G    +  E++ + YR S  +  ++ I
Sbjct: 127 VPGSVGGAIYMNAGAYNREIQDVLVKALILDEAGELKWLTVEEMGFSYRQSILQTHRNWI 186

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
           +   VL+    S   I   +      R   QP    + GSTF+NP  H +WQLIEKSG R
Sbjct: 187 VVEAVLQLEKGSYEEIMELMKARKVRRIESQPTNLPSAGSTFRNPLPHYSWQLIEKSGLR 246

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           G+  GGA++S+ HCNF++N   AT  D+  L + V+  VF + GI L  E++
Sbjct: 247 GVRIGGAEVSQKHCNFIVNVGGATATDIYELIQHVQAVVFEKHGIQLHPEVE 298


>gi|325261391|ref|ZP_08128129.1| UDP-N-acetylmuramate dehydrogenase [Clostridium sp. D5]
 gi|324032845|gb|EGB94122.1| UDP-N-acetylmuramate dehydrogenase [Clostridium sp. D5]
          Length = 314

 Score =  167 bits (424), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 106/284 (37%), Positives = 152/284 (53%), Gaps = 6/284 (2%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAGIRGVV 84
           P+ + T FR GG A+    P D  D+K  + L    ++P  I+G GSN+LV D G RGV+
Sbjct: 34  PMSRHTTFRIGGPADYFTVPGDTDDVKKVIDLCKKEEVPYYILGNGSNLLVGDKGYRGVI 93

Query: 85  LRLSNAGFSNIEVR-NHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMN 143
           +++     S I    N      GA  S   +A  AL H + GF F  GIPG++GGA  MN
Sbjct: 94  IQIYK-NMSEIHTDGNRIFAQAGALLS--KVAAEALSHSLKGFEFASGIPGTLGGAVMMN 150

Query: 144 AGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGFPESQ 202
           AGA   E  Q +     +  +G    +  E+L   YR+S I K + I+   V+R      
Sbjct: 151 AGAYGGEMKQVLESARVLTPEGEIKTLKEEELDLGYRTSVIAKKNYIVLEAVIRLETGDA 210

Query: 203 NIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELH 262
             I + +  +   R T QP++  + GSTFK P G+ A +LIE +G RG + G A++S+ H
Sbjct: 211 ESIRSYMEELKEKRVTKQPLEYPSAGSTFKRPEGYFAGKLIEDAGLRGFQVGNAQVSQKH 270

Query: 263 CNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           C F+IN   AT  ++  L  QV  KV   SG+ LE E+KR+G+F
Sbjct: 271 CGFVINRGGATAAEVISLMGQVADKVEAASGVRLEPEVKRIGEF 314


>gi|302669474|ref|YP_003829434.1| UDP-N-acetylenolpyruvoylglucosamine reductase MurB [Butyrivibrio
           proteoclasticus B316]
 gi|302393947|gb|ADL32852.1| UDP-N-acetylenolpyruvoylglucosamine reductase MurB [Butyrivibrio
           proteoclasticus B316]
          Length = 303

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 103/296 (34%), Positives = 157/296 (53%), Gaps = 6/296 (2%)

Query: 15  KQLRGKFQENF--PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGS 71
           KQ+    + N    + + T F+TGG A +  +P  +  LK  + LL  +++   I+G GS
Sbjct: 10  KQIDSDLEMNINEKMSRHTTFKTGGPASLFIRPDSLEQLKKVVALLKRAEVSYFILGNGS 69

Query: 72  NILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYG 131
           N+LV D G  G ++  S   F++I + +   +   A     ++A  A  + + GF F  G
Sbjct: 70  NLLVSDKGYDGAII--STDKFTDIRLEDEKTIYAEAGVKNSAIAAFARDNSLTGFEFAAG 127

Query: 132 IPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLII 190
           IPGS+GGA  MNAGA   E    V EV  +  +G    +  E L++ YR+S +  KD I+
Sbjct: 128 IPGSLGGAVIMNAGAYGGEMKLIVKEVRALSPQGEIIRLDNEALRFDYRTSALKGKDFIV 187

Query: 191 THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRG 250
              +L      ++ ISA +  +   R+  QP++  + GSTFK P G+ A +LIE SG RG
Sbjct: 188 ISALLELEKGDKDEISAQMNELALKRKEKQPLEYPSAGSTFKRPEGYFAGKLIEDSGLRG 247

Query: 251 LEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
              GGA +S+ HC F+IN   AT  D+  L   V+  V+ + G+ LE E+  LG F
Sbjct: 248 YTVGGAMVSDKHCGFVINKGEATSKDIYTLILNVQNTVYEKFGVRLEPEVILLGKF 303


>gi|54298602|ref|YP_124971.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Legionella
           pneumophila str. Paris]
 gi|81369791|sp|Q5X1S7|MURB_LEGPA RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|53752387|emb|CAH13819.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Legionella
           pneumophila str. Paris]
          Length = 303

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 105/289 (36%), Positives = 152/289 (52%), Gaps = 2/289 (0%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRD 77
           +G    N PL + T +R GG A  +++P +I DL  FL+ LP D P+  +GLGSN L+RD
Sbjct: 10  QGTLLFNEPLAEYTTWRVGGPAARLYKPANIDDLALFLSRLPFDEPLLWLGLGSNSLIRD 69

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G  G V+ L+      + + +   + V A  S  S+A  + R+ +    F+ GIPG++G
Sbjct: 70  GGFSGTVI-LTQGCLKEMTLLSDNCIRVEAGVSCASMARFSARNNLSEGEFWAGIPGTMG 128

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRG 197
           GA  MNAG +  ET Q V+EV  I+R+G       E+ +  YR      D       L+ 
Sbjct: 129 GALRMNAGCHGGETWQSVIEVQTINRRGEIRTRKPEEFEVAYRHVAGLGDEWFISAKLQL 188

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P ++      I ++  HR   QP  E   GS F+NP G  A +LIE  G +G+  GGA 
Sbjct: 189 TPGNKETSLQLIKDLLAHRAKTQPTNEYNCGSVFRNPPGDFAARLIESCGLKGVSIGGAV 248

Query: 258 ISELHCNFMIN-ADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +SE H NF+IN    AT  ++E L   V+ KV  Q+ I L  E+  +GD
Sbjct: 249 VSEKHANFIINHQGTATAANIEALIHLVQTKVREQTSIELIREVHIIGD 297


>gi|292670911|ref|ZP_06604337.1| UDP-N-acetylmuramate dehydrogenase [Selenomonas noxia ATCC 43541]
 gi|292647532|gb|EFF65504.1| UDP-N-acetylmuramate dehydrogenase [Selenomonas noxia ATCC 43541]
          Length = 303

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 106/288 (36%), Positives = 168/288 (58%), Gaps = 8/288 (2%)

Query: 23  ENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIR 81
           ++ P++  T FR GG A+++F P++  +++  + L    D  +T +G GSNILVRD GIR
Sbjct: 20  QDAPMRFHTTFRIGGPADLLFYPKNTEEVQKIIRLAKKYDELVTWLGNGSNILVRDGGIR 79

Query: 82  GVVLRLSNAGFSNIEVRNHC--EMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           G+V+R S+     +E  +H   ++IVGA    + +A+ A   G+ G  F  GIPGSIGGA
Sbjct: 80  GLVIRFSH----KMEDISHEGEDLIVGAGALLRDVASFAQERGLSGLEFACGIPGSIGGA 135

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLRGF 198
            +MNAGA + E    VV V  +   G+  V   E L + YR S   T D  I  + L   
Sbjct: 136 VFMNAGAYDDEMKSVVVSVKTVSLNGDIRVYLSEDLDFSYRHSIFQTCDEAICEIRLHLR 195

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
            + + +I A + ++   R++ QP+   + GSTFK P G+ A  LI+++G +GL  GGA++
Sbjct: 196 EDDKTLILARMKDLNQRRKSKQPLAYPSAGSTFKRPPGYFAGTLIDQTGLKGLTVGGAQV 255

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           S+ H  F+IN  NAT  D++ L   V+K+V+ +  + L  E++ +G+F
Sbjct: 256 SQKHAGFVINIGNATANDVQQLISAVQKRVYAKHEVQLFPELRIIGEF 303


>gi|89099611|ref|ZP_01172486.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus sp. NRRL
           B-14911]
 gi|89085764|gb|EAR64890.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus sp. NRRL
           B-14911]
          Length = 302

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 103/290 (35%), Positives = 159/290 (54%), Gaps = 7/290 (2%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRD 77
           GK +E  PL   T  + GG A++  +P  I +    + L+   DI   ++G GSN+LV D
Sbjct: 14  GKVKEQEPLANHTTMKIGGPADLFVEPSSIDNFIKTMELIREHDIKWRVIGRGSNLLVSD 73

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            GI G V++L   G   +EV +  E+  G   S  SL+    R G+ G  F  GIPGS+G
Sbjct: 74  KGIEGAVIKL-GPGLDKLEV-DGSEVTAGGGFSIVSLSVQISRKGLSGLEFASGIPGSVG 131

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD---LIITHVV 194
           GA YMNAGA+  + S+ + +   +   G    +  EQ+K+ YR+S + K+   +++  V 
Sbjct: 132 GAVYMNAGAHGSDISKILKKAFVLFEDGTMEWLTNEQMKFSYRTSVLQKERPGIVLEAVF 191

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
                E  +I++    N  + +ET QP      GS F+NP    A QLIE +G +G   G
Sbjct: 192 SLQEGERDSIVAEMQKNKDYRKET-QPYNYPCAGSIFRNPLPQYAGQLIESAGLKGHSIG 250

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           GAKISELH NF++NA +A+  D+  L E V+  +++Q  + +E E++ +G
Sbjct: 251 GAKISELHGNFIVNAGSASAEDVLGLIEHVKDTIYSQFKVKMETEVEIIG 300


>gi|229816069|ref|ZP_04446390.1| hypothetical protein COLINT_03125 [Collinsella intestinalis DSM
           13280]
 gi|229808383|gb|EEP44164.1| hypothetical protein COLINT_03125 [Collinsella intestinalis DSM
           13280]
          Length = 316

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 105/291 (36%), Positives = 160/291 (54%), Gaps = 13/291 (4%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFL-TLLPSDIPITIVGLGSNILVRDAGIRGVV 84
           P+++ T F+ GG A+V+  P+    L   L T     +P+TIVG GS++LV D GIRGVV
Sbjct: 29  PMREHTTFKIGGPADVLVTPRTADALVRVLDTCYAGGVPVTIVGNGSDLLVGDRGIRGVV 88

Query: 85  LRLSNAGFSNIEVRN-HCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMN 143
           + L +  F+ IEV   H  +   A    + +A +A   G+ G    +GIP ++GGA +MN
Sbjct: 89  VLLRD-NFAGIEVDAPHWRVTAEAGALLRDVALAAADQGLSGMEPLWGIPATVGGACFMN 147

Query: 144 AGANNCETSQ-------YVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVL 195
           AGA +  T +       YV   HG   +G+   +    L   YR S +  D LI+     
Sbjct: 148 AGAYDGTTGEVLEFVRVYVPSKHG--NRGSVVTLEARDLNLGYRKSRVHDDGLIVISATF 205

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           +  P S+ +I AA+ +    RE  QP++  + GSTFK P G+ A +LI  +G RG   G 
Sbjct: 206 KLSPASEGMIRAAMDDYQRRREEKQPLEMASAGSTFKRPEGYFAGKLIMDAGLRGACVGD 265

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           A++SE HC F++N   A+  D+  L E V+ +V +Q G+ LE E++ +G+F
Sbjct: 266 AQVSEKHCGFVVNTGRASAKDVLGLIEHVQGEVKSQFGVDLEPEVRMIGEF 316


>gi|160939918|ref|ZP_02087265.1| hypothetical protein CLOBOL_04809 [Clostridium bolteae ATCC
           BAA-613]
 gi|158437352|gb|EDP15117.1| hypothetical protein CLOBOL_04809 [Clostridium bolteae ATCC
           BAA-613]
          Length = 298

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 107/293 (36%), Positives = 150/293 (51%), Gaps = 14/293 (4%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDL-KYFLTLLPSDIPITIVGLGSNILVRDA 78
           +F E  P+   T FR GG AE    P +  +L K        DIP  ++G GSN+LV D 
Sbjct: 14  RFME--PMSNHTTFRIGGPAEAYVCPGNEDELGKVICMCREHDIPWNVLGNGSNLLVSDR 71

Query: 79  GIRGVVLRLSN----AGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPG 134
           GI+GVV+ +      AG     +R     ++G       +A  AL H + G  F  GIPG
Sbjct: 72  GIKGVVIAMEGNWCYAGAEGSVIRAGAGELLG------RVARVALDHCLTGMEFAAGIPG 125

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHV 193
           S+GGA  MNAGA   E    +     +  +G    +  ++L+  YR+S I  +   +   
Sbjct: 126 SVGGALVMNAGAYGSEIKNILKSARVMTNEGEVLELSVDELELGYRTSCIPHRGYTVLEA 185

Query: 194 VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEF 253
             +  P  Q  I A +  +   R   QP++  + GSTFK P G+ A +LIE +G RG   
Sbjct: 186 SFQLEPGDQEAIEARMKELAARRREKQPLEYPSAGSTFKRPQGYFAGKLIEDAGLRGYGM 245

Query: 254 GGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           GGA++SE HC F+IN  NAT  D+  L   +RK V  QSG+ LE E+KR G+F
Sbjct: 246 GGARVSEKHCGFVINGGNATASDVMALCGHIRKTVMEQSGVELEMEVKRWGEF 298


>gi|160872534|ref|ZP_02062666.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsiella
           grylli]
 gi|159121333|gb|EDP46671.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsiella
           grylli]
          Length = 293

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 97/291 (33%), Positives = 149/291 (51%), Gaps = 1/291 (0%)

Query: 15  KQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNIL 74
           K L+G+  +N  L + T +  GG+A  +++P DI DL +F+  L  + P+  +GLGSN L
Sbjct: 3   KNLKGELLKNTKLAEYTSWHVGGHANQLYKPSDIDDLIHFIKQLSPEEPLFFLGLGSNTL 62

Query: 75  VRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPG 134
           +RD GI G V+ ++    + +   N   +   A  +  + A  A R  + G  F  GIPG
Sbjct: 63  IRDNGINGTVV-ITQGSLTQLNRINDVTLYADAGVASPAFARFAARKNLMGAEFLAGIPG 121

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVV 194
           +IGGA  MNAG + CET   V  V  ++R G + +         YR+  +          
Sbjct: 122 TIGGALVMNAGCDGCETWNIVQSVLVVNRHGEKKIRYPRDYNIAYRTVSVFPGEYYLGAE 181

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
               P ++      I ++  +R   QP  E   GS F+NP G  A +LIE  G +GL  G
Sbjct: 182 FHLKPGNKEDAFNNIRHLLKYRTDTQPTNEPNCGSVFRNPPGDYAARLIEACGLKGLSIG 241

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            A +S  H NF++N  NA+  D+E L E++ + VF+Q  I L  E++ +GD
Sbjct: 242 NAAVSTKHANFILNKGNASAADIEALIEKIAETVFHQFHIRLIPEVRIIGD 292


>gi|330813737|ref|YP_004357976.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Candidatus
           Pelagibacter sp. IMCC9063]
 gi|327486832|gb|AEA81237.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Candidatus
           Pelagibacter sp. IMCC9063]
          Length = 299

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 101/289 (34%), Positives = 156/289 (53%), Gaps = 6/289 (2%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
           +L+ + + N+ L + +WF  GG A + FQP +  +L  FL  +       I+G GSNIL 
Sbjct: 12  KLKDRIKNNYLLNKNSWFGIGGCANIFFQPNNKEELILFLKNINFK-NFIIIGSGSNILF 70

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           +D+   GVV++L    F  IE  N  +++ GA      ++  A  +    F F   IPG+
Sbjct: 71  KDSDFDGVVIKLGKE-FCKIEEVNS-QIVAGAGALKSRVSEFAKNNEYANFEFLSSIPGT 128

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           +GG   MNAG    + S  V ++  ID +G + +I  + + + YR +E+    II  V+ 
Sbjct: 129 VGGGVSMNAGCFGSDMSDIVSQISVIDLRGEEKIITLKNIGFDYRKTELLSSYIIIEVLF 188

Query: 196 RGFPESQN-IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS--AWQLIEKSGCRGLE 252
           +   + Q+ +I   I  +   +   QP   +TGGSTFKNP G S  AW+LI ++GC  L 
Sbjct: 189 KKTKKIQSSVIENKINLLKKKKNENQPSGIRTGGSTFKNPIGSSKKAWELIREAGCDKLS 248

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           +G AK S  HCNF+ N++ A+  D+E L  + +KK+    GI LE EIK
Sbjct: 249 YGNAKFSSHHCNFVDNSNLASSSDIEKLISETQKKIKKNYGIDLELEIK 297


>gi|238917909|ref|YP_002931426.1| UDP-N-acetylmuramate dehydrogenase [Eubacterium eligens ATCC 27750]
 gi|238873269|gb|ACR72979.1| UDP-N-acetylmuramate dehydrogenase [Eubacterium eligens ATCC 27750]
          Length = 311

 Score =  166 bits (420), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 108/289 (37%), Positives = 156/289 (53%), Gaps = 14/289 (4%)

Query: 27  LKQITWFRTGGNAEVMFQPQ---DIHDLKYFLTLLPSDIPITIVGLGSNILVRDAGIRGV 83
           +K  T FR GG A+    PQ    I D+  FL    SDI   ++G GSNILV D G RGV
Sbjct: 25  MKTHTTFRIGGAADYYVTPQAEKQIADVIAFLK--KSDIKYIVIGNGSNILVSDEGFRGV 82

Query: 84  VLRLSNAGFSNIEV-----RNHCEMIVGARCSGK--SLANSALRHGIGGFHFFYGIPGSI 136
           V+ L + GFS+ E       N  E++V A    K   L N    +GI GF F  GIPG I
Sbjct: 83  VVELGD-GFSDYEFLQDSQDNSDEVLVKASAGMKLTRLGNQLAANGIAGFEFATGIPGCI 141

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVL 195
           GGA  MNAGA   E    +V    ID +G    +  ++L+  YR+S + K ++I+    L
Sbjct: 142 GGAVRMNAGAYGGEFKDILVSAKVIDDEGVIRELSADELELGYRTSIVAKSNMIVLEATL 201

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           +      +II   I+ +   R   QP++  + GSTFK P G+ A +LIE +G +G   GG
Sbjct: 202 KLRKGEPDIIRNNISELAAKRRQKQPLEYPSAGSTFKRPEGYFAAKLIEDAGLKGCARGG 261

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           A++SE H  F++N  +AT  D+  L + ++ +V  + G+ LE E+ ++G
Sbjct: 262 AQVSEKHAGFVVNKGDATAKDVCELTDYIKSEVMGKFGVGLELEVVKVG 310


>gi|308233671|ref|ZP_07664408.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Atopobium vaginae
           DSM 15829]
 gi|328943618|ref|ZP_08241083.1| UDP-N-acetylmuramate dehydrogenase [Atopobium vaginae DSM 15829]
 gi|327491587|gb|EGF23361.1| UDP-N-acetylmuramate dehydrogenase [Atopobium vaginae DSM 15829]
          Length = 308

 Score =  166 bits (420), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 105/305 (34%), Positives = 159/305 (52%), Gaps = 19/305 (6%)

Query: 15  KQLRGKFQE---------NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPI 64
           + L  KFQ          N P+ + T F+ GG A++   P    D++  + +   + +P 
Sbjct: 9   QALAAKFQAIVGEDNVVCNEPMSEHTTFKIGGPADIFVIPDTPEDVQSLVKICKDEQVPY 68

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            I+G GS++LV DAG RGV++ +++ G  N+ + N C+M   A  S +  +  A   G+ 
Sbjct: 69  FILGRGSDLLVGDAGYRGVIIAIAD-GLVNVSI-NECQMTCQAGVSLREASEMACELGLT 126

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           GF F  GIPGSIGGA +MNAGA +   +  +  V  +   G   VIP E+L   YR S +
Sbjct: 127 GFEFACGIPGSIGGACFMNAGAYDGCIADILTSVRVLMPDGTLCVIPAEELNLGYRHSRV 186

Query: 185 TKDLII----THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
             D ++    T  +  G P     I A + ++   RE  QP++  + GSTFK P GH   
Sbjct: 187 KDDGLVVVSATFTLREGDPSE---IRAKMDDLTAKREEKQPLEYPSAGSTFKRPVGHFVG 243

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
            LI K+G RG + G A IS  H  F+IN   AT  D+  + E V+ ++  Q  + LE E+
Sbjct: 244 PLITKAGLRGYQSGNAAISTKHAGFVINLGGATARDVHNVIEHVQAEIKRQFDVELEPEV 303

Query: 301 KRLGD 305
           + LG+
Sbjct: 304 RFLGE 308


>gi|325288831|ref|YP_004265012.1| UDP-N-acetylmuramate dehydrogenase [Syntrophobotulus glycolicus DSM
           8271]
 gi|324964232|gb|ADY55011.1| UDP-N-acetylmuramate dehydrogenase [Syntrophobotulus glycolicus DSM
           8271]
          Length = 295

 Score =  166 bits (420), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 99/288 (34%), Positives = 156/288 (54%), Gaps = 4/288 (1%)

Query: 15  KQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDL-KYFLTLLPSDIPITIVGLGSNI 73
           + +RGK + +F LK++  +  GGNAE++F P    DL K       + + + ++G GSNI
Sbjct: 8   RNVRGKIERDFSLKKLNTWHIGGNAELVFWPVSCEDLLKGRSWCQKNKVKMLLLGRGSNI 67

Query: 74  LVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           L+ D GI+G+V+  S     NI  +    ++V A      LA  A   G+ G  F  GIP
Sbjct: 68  LLPDEGIKGMVIVTSM--LKNITWQEK-RIMVEAGYPLSQLARQAADKGLEGLEFACGIP 124

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHV 193
           G++GGA  +NAGA+  E S  V +V  +D+KG    + REQ+++ YR+S +     I   
Sbjct: 125 GTVGGAVMVNAGAHGAEISDLVRQVRVLDQKGEIMTLDREQIEFSYRTSSLQGKYWILEC 184

Query: 194 VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEF 253
           VL   P    ++   I      R+  QP++    GS F+NP   SA  LIE++G +G   
Sbjct: 185 VLELVPGEPAVLKEKIRVFTEQRKNAQPLEYPNAGSVFRNPPHLSAGALIEQAGWKGKTV 244

Query: 254 GGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           GGA++S  H NF+IN   AT  D++ L   + + + ++ GI L+ E++
Sbjct: 245 GGAQVSAKHANFIINTGKATALDVKTLINAITEDIEDKFGIQLKTEVQ 292


>gi|83949548|ref|ZP_00958281.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Roseovarius
           nubinhibens ISM]
 gi|83837447|gb|EAP76743.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Roseovarius
           nubinhibens ISM]
          Length = 259

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 139/254 (54%), Gaps = 21/254 (8%)

Query: 67  VGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGF 126
           +G+GSN++VRD G+R VV+RL   GF+ IE+  +  +I GA      +A  A   G+   
Sbjct: 1   MGVGSNLIVRDGGLRAVVIRLGR-GFNGIEIDGNT-VIAGAAALDAHVAKKAADAGLD-L 57

Query: 127 HFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK 186
            F   IPGSIGGA  MNAG     T+ + +    + R G    +  E L++QYR +   +
Sbjct: 58  TFLRTIPGSIGGAVRMNAGCYGTYTADHFIWAEVVTRTGEIMRLGPEDLQFQYRQTAWPE 117

Query: 187 DLIITHVVLR---GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS----- 238
             ++         G PE    + A +      R+  QP K++T GSTF+NP G S     
Sbjct: 118 GAVLIRAAFEASEGVPEE---LHARMQEQLAKRDETQPTKDRTAGSTFRNPAGFSSTGRA 174

Query: 239 -------AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQ 291
                  AW++I+ +G RG   GGA++S  H NF++N   A+  DLE LGE+VRK+VF  
Sbjct: 175 DDSHDLKAWKVIDDAGMRGAMRGGAQMSPKHSNFLVNTGEASADDLESLGEEVRKRVFQN 234

Query: 292 SGILLEWEIKRLGD 305
           SGI LEWEI R+G+
Sbjct: 235 SGIELEWEIMRVGE 248


>gi|312144351|ref|YP_003995797.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Halanaerobium sp.
           'sapolanicus']
 gi|311905002|gb|ADQ15443.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Halanaerobium sp.
           'sapolanicus']
          Length = 308

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 91/291 (31%), Positives = 167/291 (57%), Gaps = 7/291 (2%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTL-LPSDIPITIVGLGSNILVRDA 78
           + ++N  L + T F+ GG A+++ +PQ+I   +  + L + S +P  I+G GSN++V D 
Sbjct: 21  EIEKNKKLAEFTSFKVGGPADLLLKPQEIEAAQKLIPLIMKSKLPFFILGQGSNLIVSDK 80

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           G RGV++   +   ++ +++    +   +    + +A+ AL++ + G  F  GIPGS+GG
Sbjct: 81  GYRGVIIYTGD--LNDYQIKGES-ISAESGIELEEIADIALKNSLSGLEFASGIPGSLGG 137

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI---TKDLIITHVVL 195
           A YMNAGA + E    +     +++KG    + +++L+  YR+S +   + + +   V L
Sbjct: 138 ALYMNAGAYDGEMKDIITSALFVNQKGELLKLSKKELELDYRNSILQNKSLNYLALKVNL 197

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           +   + +  I A +  +   R + QP++  + GS FK P GH    LIEK+G +G + GG
Sbjct: 198 KLKKDKKANIKAKMEELHQKRWSKQPMELPSAGSIFKRPEGHYTGALIEKAGLKGYQIGG 257

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           A++S+ H  F++N  +AT  D+  L E+++ +++  SG+ LE E + LGDF
Sbjct: 258 AQVSKKHAGFIVNKGDATAEDIIKLIEKIKDEIYKMSGVQLEVEPRFLGDF 308


>gi|229823689|ref|ZP_04449758.1| hypothetical protein GCWU000282_00990 [Catonella morbi ATCC 51271]
 gi|229786728|gb|EEP22842.1| hypothetical protein GCWU000282_00990 [Catonella morbi ATCC 51271]
          Length = 300

 Score =  166 bits (419), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 94/287 (32%), Positives = 158/287 (55%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAG 79
            + N PL   T+ +TGG A+++  P+ + +++  L  +  + +P+T++G  SN++V+D G
Sbjct: 16  IKANEPLSNYTYTKTGGPADLLVFPRSVEEVQRVLAAVKQENLPLTVLGNASNLIVKDGG 75

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRG+V+ L++     +E  N  +   GA     S    A   G+ G  F  GIPGSIGGA
Sbjct: 76  IRGLVMILTDMQELVLE-GNQLKAASGAALIEAS--RQAAAAGLTGLEFACGIPGSIGGA 132

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            YMNAGA   E    + +V  + R G           + YR S   + D +I  V     
Sbjct: 133 IYMNAGAYGGEVKDVISQVQTMTRDGQLKTYAGADCDFSYRHSRFQEGDEVILGVTFDLA 192

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P  Q+ I + +A + H R++ QP++  + GS FK P G+ A +LI+ +G +G + GGA++
Sbjct: 193 PGDQSTIDSKVAELTHLRQSKQPLEYPSCGSVFKRPEGYFAGKLIQDAGLQGYQVGGAQV 252

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           S  H  F++N D+AT  D   + E +R  V+ ++G+ +E E++ +G+
Sbjct: 253 STKHAGFIVNVDHATATDYLEVIEHIRLVVWARTGVFMEPEVRIIGE 299


>gi|260589286|ref|ZP_05855199.1| UDP-N-acetylmuramate dehydrogenase [Blautia hansenii DSM 20583]
 gi|331082693|ref|ZP_08331816.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lachnospiraceae
           bacterium 6_1_63FAA]
 gi|260540367|gb|EEX20936.1| UDP-N-acetylmuramate dehydrogenase [Blautia hansenii DSM 20583]
 gi|330400312|gb|EGG79954.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lachnospiraceae
           bacterium 6_1_63FAA]
          Length = 304

 Score =  166 bits (419), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 102/283 (36%), Positives = 155/283 (54%), Gaps = 4/283 (1%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIRGVV 84
           P+K+ T FR GG A+    P    +L+  L +   + +   I+G GSN+LV D G RGVV
Sbjct: 24  PMKKHTTFRIGGPADYYLCPHSTEELQKILQICRENKLEFFILGNGSNLLVSDKGYRGVV 83

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           ++L    FS+IE  ++  + V A      +A  AL   + G  F  GIPG++GGA  MNA
Sbjct: 84  IQLWK-NFSDIETEDNT-ITVKAGALLSKVAAEALEESLTGMEFASGIPGTMGGAVMMNA 141

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLRGFPESQN 203
           GA   E    + EV  + R+G    + +E++ + YR+S +  K  ++    L+     + 
Sbjct: 142 GAYGGEMKDIIREVTVLTREGELLTLSKEEMNFGYRTSVVKEKGYVVISAELQLRKGDRE 201

Query: 204 IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHC 263
            I   +  +   R T QP+   + GSTFK P G+ A +LI  +G RG   GGA+ISE HC
Sbjct: 202 EIRKVMDELKERRVTKQPLDMPSAGSTFKRPEGYFAGKLIMDAGLRGFSVGGAQISEKHC 261

Query: 264 NFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
            F++N  +AT  D+  L  +V+K+V  + G+ LE E+K LG+F
Sbjct: 262 GFVVNKGDATAADVLGLIGEVQKRVQEKFGVALEPEVKFLGEF 304


>gi|303241085|ref|ZP_07327594.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acetivibrio
           cellulolyticus CD2]
 gi|302591345|gb|EFL61084.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acetivibrio
           cellulolyticus CD2]
          Length = 314

 Score =  166 bits (419), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 97/283 (34%), Positives = 157/283 (55%), Gaps = 4/283 (1%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAGIRGVV 84
           P+K+ T F+ GG A+++  P  +  L   + L    ++PI I+G G+N+LV D GIRGVV
Sbjct: 34  PMKRHTSFKIGGPADLLITPASVSQLGELIKLCNRQNLPIFIMGNGTNLLVSDKGIRGVV 93

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           +++ +   +   V+  C    G     K L+  AL + + G  F  GIPG++GGA  MNA
Sbjct: 94  IKIYD-NLNGYTVKEDCIEAYGGILLSK-LSGIALENELAGLEFASGIPGTLGGAVAMNA 151

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL-IITHVVLRGFPESQN 203
           GA   E    V+E   ID+ G+  V+  ++ ++ YR+S I K   I+   +++     + 
Sbjct: 152 GAYGGEIKDVVIETEFIDKDGDIKVLRGDEHQFGYRTSFIQKQSGIVVRSIIKLKKGDKT 211

Query: 204 IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHC 263
            I   I ++   R+  QP++  + GS FK P G+ A +LIE  G RG   GGA++S+ HC
Sbjct: 212 SIKTLIDDLTGRRKDKQPLEMPSAGSVFKRPEGYFAGKLIEDCGLRGYSIGGAQVSDKHC 271

Query: 264 NFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
            F++N  NAT  D+  L   ++K V ++    L+ EI+ +GD+
Sbjct: 272 GFIVNTGNATSKDIMDLISHIQKTVKDKFNAELQTEIRIVGDY 314


>gi|329767246|ref|ZP_08258773.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Gemella haemolysans
           M341]
 gi|328836913|gb|EGF86560.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Gemella haemolysans
           M341]
          Length = 300

 Score =  166 bits (419), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 101/285 (35%), Positives = 166/285 (58%), Gaps = 6/285 (2%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRG 82
           N PL++ ++ +TGGNAEV+ +  +  DL+  +     ++I +TI+G GSN+L+ D GI G
Sbjct: 19  NEPLRKYSFTKTGGNAEVLVKITNEQDLQNIIKYSNENNIELTILGNGSNVLISDNGIAG 78

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           +V   S+   + IE+ +   +   A  + K L +  + + +    F  GIPGS+GGA +M
Sbjct: 79  IVAITSD--MNKIELLDGDVISCYAGLTLKELTDFCIENSLTNLEFSCGIPGSVGGAIFM 136

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI--TKDLIITHVVLRGFPE 200
           NAGA   E  + V +V    R G + +   EQ+++ YR S I  TK+ II+ V  +    
Sbjct: 137 NAGAYGGEMKEVVQKVEVFTRDGEKKIYTNEQMEFSYRHSLIQETKE-IISRVYFQMKKG 195

Query: 201 SQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISE 260
           ++  I + +  +   R   QP++  + GS FK P G+ A +LI+ +G +GL  GGA++S+
Sbjct: 196 NKEEIISKVEELNKMRSDKQPLEYPSCGSVFKRPEGYFAGKLIQDAGLQGLTVGGAQVSK 255

Query: 261 LHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            H  FM+N D+AT  D + L ++V++KV   SG+ LE E+K LG+
Sbjct: 256 KHAGFMVNIDSATCEDYKNLIKEVQQKVLEDSGVELECEVKILGE 300


>gi|300112945|ref|YP_003759520.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrosococcus
           watsonii C-113]
 gi|299538882|gb|ADJ27199.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrosococcus
           watsonii C-113]
          Length = 299

 Score =  165 bits (418), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 102/291 (35%), Positives = 153/291 (52%), Gaps = 7/291 (2%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRD 77
           RG+ Q +  +   T +R GG A  +++P    DL  FL  LP D P+  +GLGSN+LVRD
Sbjct: 11  RGRLQHHVAMANHTSWRVGGPARCLYRPAGRDDLITFLRFLPRDEPLFWLGLGSNLLVRD 70

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            GI G V+ ++ A  + IE R    + V A      LA    R G+ G  F  GIPG++G
Sbjct: 71  GGISGTVIAIAGA-LNKIERRTVTTVWVEAGVPCAKLAKFCAREGLRGAEFLAGIPGTVG 129

Query: 138 GAAYMNAGANNCETSQYV--VEVHGIDRKGNQHVIPRE-QLKYQYRSSEITKDLIITHVV 194
           GA  MNAGA      + V  VEV G+  + N+  +P+E Q+ Y+       +  +   + 
Sbjct: 130 GALAMNAGAFGGAMWELVTAVEVVGVGGE-NRRRLPQEYQVSYREVHGPEREWFLAAELC 188

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
           L   P +  +    I  +   R   QP ++   GS F+NP    A +LIE  G +G   G
Sbjct: 189 L--TPGNSQVAQQQIRRLLRQRNGCQPTRQPCAGSVFRNPRNDKAGRLIEACGLKGASIG 246

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           GA++SE H NF++N  NA+  D+EYL + V + V  ++G+ L  E+  +G+
Sbjct: 247 GARVSERHANFIVNTGNASAADVEYLIQWVAETVARRAGVSLVPEVHMVGE 297


>gi|313623798|gb|EFR93929.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria innocua FSL
           J1-023]
          Length = 298

 Score =  165 bits (418), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 104/284 (36%), Positives = 153/284 (53%), Gaps = 5/284 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRG 82
           N PL + T+ +TGGNA+V   P+ I + K  +T    S +P+TI+G GSN++++D GIRG
Sbjct: 16  NEPLSKYTYTKTGGNADVFVMPKTIEETKEIVTYCHQSKLPLTILGNGSNLIIKDGGIRG 75

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           V++ L      +IE R + ++I  +       A  AL   + G  F  GIPGSIGGA +M
Sbjct: 76  VIVHLDL--LQSIE-RKNTQIIAMSGAKLIDTAKFALDESLSGLEFACGIPGSIGGALHM 132

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLRGFPES 201
           NAGA   E S  +     + + G    + R +LK  YR S I  K  I+         E 
Sbjct: 133 NAGAYGGEISDVLEAATVLTQSGELKKLKRSELKAAYRFSTIAEKKYIVLDATFSLELED 192

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
           +NII A +  +   RE  QP++  + GS FK P GH A +LI+ SG +G   GGA++S  
Sbjct: 193 KNIIQAKMDELTALREAKQPLEYPSCGSVFKRPPGHFAGKLIQDSGLQGHIIGGAQVSLK 252

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           H  F++N   AT  D   L   V++ V  +  + LE E+K +G+
Sbjct: 253 HAGFIVNIGGATATDYMNLIAHVQQTVREKFDVELETEVKIIGE 296


>gi|166031416|ref|ZP_02234245.1| hypothetical protein DORFOR_01105 [Dorea formicigenerans ATCC
           27755]
 gi|166028821|gb|EDR47578.1| hypothetical protein DORFOR_01105 [Dorea formicigenerans ATCC
           27755]
          Length = 303

 Score =  165 bits (418), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 107/285 (37%), Positives = 158/285 (55%), Gaps = 10/285 (3%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAGIRGVV 84
           P+ + T FR GG A+    P+   +++  + +   + +P  I+G GSN+LV DAG RGV+
Sbjct: 23  PMSRHTTFRVGGPADFFVTPKAKEEVRDVIRICKEAGMPYYIIGNGSNLLVSDAGYRGVI 82

Query: 85  LRLSNAGFSNIEVRNHCEMI---VGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAY 141
           +++        EV+   +++    GA  SG  +A  AL   + GF F  GIPG+IGGA  
Sbjct: 83  VQIYK---EMNEVKVEGDLVKAQAGALLSG--IAAKALGAELSGFEFASGIPGTIGGACV 137

Query: 142 MNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFPE 200
           MNAGA   E    +  V  +  +G    + R +L+  YR+S I K   I+   VL+    
Sbjct: 138 MNAGAYGGEMKDVLEFVTVLTGEGKIIELGRNELELGYRTSVIAKKGYIVLGAVLKLERG 197

Query: 201 SQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISE 260
               I   +  +   R T QP++  + GSTFK P G+ A +LIE +G RG + GGA++SE
Sbjct: 198 DGEKIKTYMDELKEKRVTKQPLEYPSAGSTFKRPEGYFAGKLIEDAGLRGFQVGGAQVSE 257

Query: 261 LHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            HC F+IN D+AT  D+  L  QV+ +V   SG+ LE E+KRLGD
Sbjct: 258 KHCGFVINRDHATAADIMELMRQVQIRVKENSGVDLEPEVKRLGD 302


>gi|83589696|ref|YP_429705.1| UDP-N-acetylmuramate dehydrogenase [Moorella thermoacetica ATCC
           39073]
 gi|123524769|sp|Q2RK77|MURB_MOOTA RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|83572610|gb|ABC19162.1| UDP-N-acetylmuramate dehydrogenase [Moorella thermoacetica ATCC
           39073]
          Length = 302

 Score =  165 bits (417), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 101/290 (34%), Positives = 154/290 (53%), Gaps = 4/290 (1%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILV 75
           L+ +   N PL + T +R GG A+++ +P+   +L Y L+      +P+ I+G GSN+LV
Sbjct: 14  LKLQVLTNEPLSRHTTWRLGGPADLLARPRSREELDYCLSFARRKGLPLHILGNGSNLLV 73

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
            D G+RG+V++        IE R   +++  A      L   A + G+GG  F  GIP +
Sbjct: 74  LDGGVRGLVVQTREWRQVIIEGR---KILATAGTLLPGLLQVASKKGLGGLEFAAGIPAT 130

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           +GGA  MNAG         VV V  +D  G +H++   ++ + YR S + +   +  V L
Sbjct: 131 VGGAVVMNAGTPAGCLGDLVVGVEVLDYDGRRHILENREITFTYRHSSLHRAGTVVTVTL 190

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
              P+    I   I    H R + QP++    GS FKNP G+ A +LIE  G +G   GG
Sbjct: 191 ELVPDEVPAIRERIEANLHRRRSRQPLEWPNAGSVFKNPPGYYAGRLIEAVGAKGWRVGG 250

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           A+++E H NF+IN   AT  D+  L ++VR+ V  Q GI LE EI+  G+
Sbjct: 251 AEVAEKHANFIINRGQATAADVMELIDRVREAVARQLGIDLELEIEVWGE 300


>gi|57651576|ref|YP_185675.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus COL]
 gi|71151972|sp|Q5HHT2|MURB_STAAC RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|57285762|gb|AAW37856.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus COL]
          Length = 307

 Score =  165 bits (417), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 98/288 (34%), Positives = 159/288 (55%), Gaps = 5/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTL-LPSDIPITIVGLGSNILVRDA 78
           K + + PLK+ T+ +TGGNA+    P    +++  +     ++IP+T +G GSNI++R+ 
Sbjct: 18  KIKVDEPLKRYTYTKTGGNADFYITPTKNEEVQAVVKYAYQNEIPVTYLGNGSNIIIREG 77

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIRG+V+ L      +IEV +   +I G+  +   ++  AL + + G  F  GIPGSIGG
Sbjct: 78  GIRGIVISL--LSLDHIEVSDDA-IIAGSGAAIIDVSRVALDYALTGLEFACGIPGSIGG 134

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRG 197
           A YMNAGA   E    +     ++ +G+   +  ++L+  YR+S I K+ L++       
Sbjct: 135 AVYMNAGAYGGEVKDCIDYALCVNEQGSLIKLTTKELELDYRNSIIQKEHLVVLEAAFTL 194

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P     I A + ++   RE+ QP++  + GS F+ P GH A +LI+ S  +G   GG +
Sbjct: 195 APGKMTEIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHFAGKLIQDSNLQGHRIGGVE 254

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S  H  FM+N DN T  D E L   V+K V  + GI L  E++ +G+
Sbjct: 255 VSTKHAGFMVNVDNGTATDYENLIHYVQKTVKEKFGIELNREVRIIGE 302


>gi|298507095|gb|ADI85818.1| UDP-N-acetylenolpyruvylglucosamine reductase [Geobacter
           sulfurreducens KN400]
          Length = 300

 Score =  165 bits (417), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 106/305 (34%), Positives = 148/305 (48%), Gaps = 14/305 (4%)

Query: 7   SRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPIT 65
            RL      ++RG+   + P+ + T  R GG A+    P D  D++  L +L  +  P  
Sbjct: 3   DRLAARLEAEVRGEILRDEPMARHTSLRVGGPADFFVTPADPDDMRALLAILVETGTPWL 62

Query: 66  IVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGG 125
            VG G N+L+RD G RGVV+  S A  + +E        VGA  +   L       G+ G
Sbjct: 63  AVGGGYNLLIRDGGFRGVVI--SPARMTTLERLERNRAGVGAGVANGRLTAFLRDEGLAG 120

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEV-----HGIDRKGNQHVIPREQLKYQYR 180
             F  GIPG++GGA  MNAGA+       V ++      G++RK       REQL Y YR
Sbjct: 121 LEFLCGIPGTVGGALAMNAGAHGGAILDRVEDILTVGTAGVERK------RREQLDYGYR 174

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
              +    II         +    IS  I     HR   Q +     GS FKNP G +AW
Sbjct: 175 YLRLQPGEIIIGATFVLDSDDPRWISERIDGYRAHRTASQQVGFPNAGSFFKNPPGQAAW 234

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LIE +G RG+  GGA++SE+H NF++N   AT  D   L  +++  V  +SG  LE E+
Sbjct: 235 RLIEDAGLRGVRVGGAQVSEVHTNFLVNRGGATAADFLALAARIKDAVKLKSGTALEEEV 294

Query: 301 KRLGD 305
           K  GD
Sbjct: 295 KIFGD 299


>gi|297583950|ref|YP_003699730.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           selenitireducens MLS10]
 gi|297142407|gb|ADH99164.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           selenitireducens MLS10]
          Length = 315

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 99/287 (34%), Positives = 156/287 (54%), Gaps = 4/287 (1%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILV 75
           LRGK   +    + + +R GG A+VM++P D+ D+   L  L ++ IP  I+G GSN++ 
Sbjct: 10  LRGKITYDEMTGKYSTWRIGGKADVMYEPSDVEDVTNLLAYLRAEKIPYFILGKGSNLMF 69

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
            D GIRGVV+++++A  +N+    +  + VGA  S   LA    R+G+ G  F  GIP +
Sbjct: 70  PDEGIRGVVIKMADA-LTNLTEEGNT-VTVGAGYSLVKLAAKMSRNGLSGLEFAAGIPAT 127

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVV 194
           +GGA +MNAGA+  E +  +  +H +   G       E L++ YR S +  ++LI     
Sbjct: 128 VGGAVFMNAGAHGGEMADVISRIHVLRPDGTDAWFEGESLQFSYRHSFLQDEELICLEAE 187

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
           L         IS+ +     +R+  QP  E + GS FKNP    A +LIE +G +G  FG
Sbjct: 188 LTLQSGDSEDISSVLEKNKQYRKDTQPYGEPSCGSVFKNPRPLFAAKLIEDAGLKGKRFG 247

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           G K+SE H NF++N    T  D+  L   ++KK+   + + LE E++
Sbjct: 248 GVKVSEKHANFIVNDQQGTAEDVLNLMVYIQKKIEQTAMVTLEPEVQ 294


>gi|297539590|ref|YP_003675359.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylotenera sp.
           301]
 gi|297258937|gb|ADI30782.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylotenera sp.
           301]
          Length = 299

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 99/295 (33%), Positives = 158/295 (53%), Gaps = 7/295 (2%)

Query: 15  KQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNIL 74
           +Q  GK   N P+ + T +R GG A+ ++ P D+ DL+ FL  + ++  I  VGLGSN+L
Sbjct: 7   QQRTGKLLLNEPMARYTSWRVGGKADQLYIPADLEDLQEFLRNVDANQAIYFVGLGSNLL 66

Query: 75  VRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPG 134
           VRD G+RG V+ + N   + +++             GK LA  + +    G  FF GIPG
Sbjct: 67  VRDGGVRGTVIIMHNV-LTGLKMDGDLVYAEAGVTCGK-LAKFSAKEAKQGAEFFAGIPG 124

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT---KDLIIT 191
           ++GGA  MNAG    ET   V  V  I+R+G  +     +    YR  ++    +  I  
Sbjct: 125 TLGGALAMNAGCYGTETWNVVNSVTTINRQGELNKRSAAEFIASYRHVDMPVAGEWFIAA 184

Query: 192 HVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGL 251
            + LR     ++  +  I ++   R   QP+   + GSTF+NP G  A +L+E SG +G 
Sbjct: 185 WLTLRAGDAHES--AKKIKDLLATRLASQPLNLPSAGSTFRNPQGDYAARLVEASGLKGY 242

Query: 252 EFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
             GGA++SE H NF++N  +A   D+E L + +R+ V  + G+ L+ E+K +G++
Sbjct: 243 IIGGAQVSEKHANFIVNIGDANALDIELLIKHMRETVLEKQGVALQQEVKVIGEY 297


>gi|328954819|ref|YP_004372152.1| UDP-N-acetylmuramate dehydrogenase [Coriobacterium glomerans PW2]
 gi|328455143|gb|AEB06337.1| UDP-N-acetylmuramate dehydrogenase [Coriobacterium glomerans PW2]
          Length = 323

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 108/299 (36%), Positives = 157/299 (52%), Gaps = 22/299 (7%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAGIRGVV 84
           P+ + T FR GG A+VM  P+ I      L +   + IP+ IVG GSN+LV D GIRGVV
Sbjct: 29  PMAKHTTFRIGGPADVMVSPRSIDACAASLDVCAQAGIPVLIVGNGSNLLVGDRGIRGVV 88

Query: 85  LRLSN--AGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           +R+       S  + R   E   GA  S   +A  A    + GF    GIP ++GGA +M
Sbjct: 89  IRMRENLDAISVDDTRIRAE--AGALLS--DVARVAESESLTGFEPISGIPATVGGACFM 144

Query: 143 NAGANNCETSQYVVEV----------HGID----RKGNQHVIPREQLKYQYRSSEITKDL 188
           NAGA    T + +  V           G+D    ++G+   I R  L+  YRSS ++++ 
Sbjct: 145 NAGAYGSSTGEVLESVTAYVPGDSGNRGLDPDSRKRGSVVEIARADLELDYRSSRVSREG 204

Query: 189 IITHVVLRGFPESQNI-ISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSG 247
           +I           ++  I AA+ +    RE  QP+   + GSTF+ P G  A +LI  +G
Sbjct: 205 LIVLAATFALDRGESAAIRAAMRDFRMQRERKQPLDVPSAGSTFRRPPGRFAGKLIMDAG 264

Query: 248 CRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
            RG   GGA++S+ HC F++NAD AT  D+  L   V+K+V    G+ LE EI+R+G+F
Sbjct: 265 LRGTCVGGARVSDKHCGFVVNADRATAADVCALMALVQKRVKRSFGVDLEPEIRRVGEF 323


>gi|39998158|ref|NP_954109.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacter
           sulfurreducens PCA]
 gi|47605781|sp|P61435|MURB_GEOSL RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|39985104|gb|AAR36459.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacter
           sulfurreducens PCA]
          Length = 288

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 103/290 (35%), Positives = 145/290 (50%), Gaps = 4/290 (1%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILV 75
           +RG+   + P+ + T  R GG A+    P D  D++  L +L  +  P   VG G N+L+
Sbjct: 1   MRGEILRDEPMARHTSLRVGGPADFFVTPADPDDMRALLAILAETGTPWLAVGGGYNLLI 60

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD G RGVV+  S+A  +++E       +VGA  +   L       G+ G  F  GIPG+
Sbjct: 61  RDGGFRGVVI--SSARMTSLERLEGNRAVVGAGVANGRLTAFLRNEGLAGLEFLCGIPGT 118

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           +GGA  MNAGA+       V E+  I   G +    RE L Y YR  ++    II     
Sbjct: 119 VGGALAMNAGAHGGAILDRVEEILTIGTAGFE-CKGRELLDYGYRYLKLQPGEIIIGATF 177

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
               +    IS  I     HR   Q +     GS FKNP G +AW+LIE +G RG   GG
Sbjct: 178 VLDSDDPRRISERIDGCRAHRTASQQVGFPNAGSFFKNPPGQAAWRLIEDAGLRGARVGG 237

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           A++SE+H NF++N   AT  D   L  +++  V  +SG  LE E+K  GD
Sbjct: 238 AQVSEVHTNFLVNRGGATAADFLALAARIKDAVKLKSGTALEEEVKIFGD 287


>gi|319758027|gb|ADV69969.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus suis
           JS14]
          Length = 302

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 104/294 (35%), Positives = 156/294 (53%), Gaps = 13/294 (4%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDA 78
           +F E  PLK+ T+ + GG  + +  P++ +++   +     + IP  ++G  SNI+VRD 
Sbjct: 15  RFDE--PLKEYTYTKVGGAVDYLAFPRNRYEIVRIVEFAKREGIPWQVLGNSSNIIVRDG 72

Query: 79  GIRGVVLRLSNAGFSNIEVRNHC-EMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
           GIRG V+R+     +++ V  +  E   GA          AL H + GF F  GIPGSIG
Sbjct: 73  GIRGFVIRMDK--LNSVTVSGYTIEAEAGANLI--ETTKVALFHSLSGFEFACGIPGSIG 128

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD---LIITHVV 194
           GA YMNAGA   E +  +V    +   G    +   +L++ YRSS + ++   ++     
Sbjct: 129 GAVYMNAGAYGGEVAHILVSAQILTPAGYVETLDNRELRFGYRSSILQENGAIVLSAKFA 188

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
           LR  P +  +I   +A + H RE  QP++  + GS FK P GH A QLI  +G +G   G
Sbjct: 189 LR--PGNHTVIQQEMARLTHLRELKQPLEYPSCGSVFKRPLGHFAGQLIMDTGLKGYRIG 246

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFD 308
           G ++SE H  FM+N +N T  D E L   V + V   SGI LE E++ +GD  D
Sbjct: 247 GVEVSEKHAGFMVNIENGTASDYENLIAHVIQVVEKSSGITLEREVRIIGDPAD 300


>gi|114566546|ref|YP_753700.1| UDP-N-acetylmuramate dehydrogenase [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
 gi|122318390|sp|Q0AY75|MURB_SYNWW RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|114337481|gb|ABI68329.1| UDP-N-acetylmuramate dehydrogenase [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 299

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 99/284 (34%), Positives = 150/284 (52%), Gaps = 4/284 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRG 82
           N P+K+ + F+ GG  ++M  P+ I +++         DIP  + GLGSNILVRD GIRG
Sbjct: 17  NEPMKEHSSFKIGGPVDLMVLPESIEEIQRITHYCRKKDIPCFVFGLGSNILVRDKGIRG 76

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           V +++ N    NI + N   +   A      L+ +A  + + G  F  GIPGS+GGA  M
Sbjct: 77  VAIKVGN-NLKNISICNDT-IFAEAGVRLAELSQAAADYSLSGLEFAEGIPGSLGGAVVM 134

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLRGFPES 201
           NAGA   E    + EV  I   GN      E++K +YR S    ++LI+   +++   E 
Sbjct: 135 NAGAYGGEMKDVLKEVRAITPDGNLSSFKPEEMKLRYRGSIFQEEELIVVSALMQLHKER 194

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
              I A + +    R   QP++  + GSTF+ P G     +IE+ G +G + GGA++S  
Sbjct: 195 AEDIRARMQDFAKRRREKQPLEYPSAGSTFRRPAGFFVGPMIEEMGLKGFKVGGAEVSRK 254

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           H  F+IN+ NAT  ++  L   V+ K     GI LE E+K +G+
Sbjct: 255 HAGFIINSGNATANEVLELIAIVKAKAKEHYGIELETEVKVVGE 298


>gi|294101820|ref|YP_003553678.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Aminobacterium
           colombiense DSM 12261]
 gi|293616800|gb|ADE56954.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Aminobacterium
           colombiense DSM 12261]
          Length = 299

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 99/289 (34%), Positives = 152/289 (52%), Gaps = 4/289 (1%)

Query: 15  KQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNIL 74
           + + G  +E+FPL  +T F  GG+A+V   P    DL   L  +  D  + I+G GSN++
Sbjct: 11  RSIAGPVREHFPLSPLTTFGVGGSADVCIWPASTQDL-VTLVKMKEDTSLNIIGGGSNLI 69

Query: 75  VRDAGIRGVVLRLSN-AGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           + D  I+G VL     + FS     N  ++ VG   S   L +  LR+G  G  F  GIP
Sbjct: 70  ISDGDIKGFVLCTKYLSSFSLFRKNNEVDIEVGTGVSLGVLVSFGLRYGFSGMEFGIGIP 129

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITH 192
           G++GGA   NAG      S  +  V  +D  G      +E+L + YR S +  ++ I+T 
Sbjct: 130 GTVGGAIIGNAGVQGETVSDVIQWVEVVDESGEVLRFKKEELPWGYRRSVLQERNYIVTA 189

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
             LR   +    +     N    R++ QP   K+ G  FKNP G SA +L+++ GC+GL 
Sbjct: 190 CGLRLQAKDPYWVKEKADNFLQKRKS-QPRGFKSAGCIFKNPDGESAGKLLDECGCKGLR 248

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
            GGA +SE H NF++N  +A   D+  L E+ R++VF ++G +LE E++
Sbjct: 249 VGGAIVSEAHANFILNMGDAKAADIWALIEECRRRVFEKTGYVLELEVR 297


>gi|146318458|ref|YP_001198170.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus suis
           05ZYH33]
 gi|146320651|ref|YP_001200362.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus suis
           98HAH33]
 gi|253751592|ref|YP_003024733.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus suis
           SC84]
 gi|253753493|ref|YP_003026634.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus suis
           P1/7]
 gi|253755681|ref|YP_003028821.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus suis
           BM407]
 gi|187609741|sp|A4W0S3|MURB_STRS2 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|187609742|sp|A4VUI1|MURB_STRSY RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|145689264|gb|ABP89770.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus suis 05ZYH33]
 gi|145691457|gb|ABP91962.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus suis 98HAH33]
 gi|251815881|emb|CAZ51492.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus suis
           SC84]
 gi|251818145|emb|CAZ55942.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus suis
           BM407]
 gi|251819739|emb|CAR45602.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus suis
           P1/7]
 gi|292558243|gb|ADE31244.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus suis GZ1]
          Length = 302

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 104/294 (35%), Positives = 156/294 (53%), Gaps = 13/294 (4%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDA 78
           +F E  PLK+ T+ + GG  + +  P++ +++   +     + IP  ++G  SNI+VRD 
Sbjct: 15  RFDE--PLKEYTYTKVGGAVDYLAFPRNRYEIVRIVEFAKREGIPWQVLGNSSNIIVRDG 72

Query: 79  GIRGVVLRLSNAGFSNIEVRNHC-EMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
           GIRG V+R+     +++ V  +  E   GA          AL H + GF F  GIPGSIG
Sbjct: 73  GIRGFVIRMDK--LNSVTVSGYTIEAEAGANLI--ETTKVALFHSLSGFEFACGIPGSIG 128

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD---LIITHVV 194
           GA YMNAGA   E +  +V    +   G    +   +L++ YRSS + ++   ++     
Sbjct: 129 GAVYMNAGAYGGEVAHILVSAQILTPAGYVETLDNRELRFGYRSSILQENGAIVLSAKFA 188

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
           LR  P +  +I   +A + H RE  QP++  + GS FK P GH A QLI  +G +G   G
Sbjct: 189 LR--PGNHTVIQQEMARLTHLRELKQPLEYPSCGSVFKRPLGHFAGQLIMDAGLKGYRIG 246

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFD 308
           G ++SE H  FM+N +N T  D E L   V + V   SGI LE E++ +GD  D
Sbjct: 247 GVEVSEKHAGFMVNIENGTASDYENLIAHVIQVVEKSSGITLEREVRIIGDPAD 300


>gi|94271503|ref|ZP_01291964.1| UDP-N-acetylenolpyruvoylglucosamine reductase [delta
           proteobacterium MLMS-1]
 gi|93450432|gb|EAT01622.1| UDP-N-acetylenolpyruvoylglucosamine reductase [delta
           proteobacterium MLMS-1]
          Length = 315

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 104/294 (35%), Positives = 151/294 (51%), Gaps = 6/294 (2%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRD 77
           G  Q   PL  +T  R GG A V+ +P  +  L+  L LL +   P  ++G GSN+LV D
Sbjct: 26  GSCQPLAPLAPLTTLRIGGPAAVLARPASLAGLEQLLALLATHGCPWRVLGRGSNLLVAD 85

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G  GVV+ L     + I+ ++H  + V A CS  +L   AL  G+ G  F  GIPGS+G
Sbjct: 86  RGYPGVVILLDRQ-LAGIKEQDHHRVRVEAGCSLAALLGWALGRGLSGLEFLVGIPGSLG 144

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS-SEITKDLIITHVVLR 196
           GA  +NAGA      Q VVEV  +   G + V P  +L + YR    + +  ++    + 
Sbjct: 145 GALMLNAGAWGGNLGQRVVEVELVAATGARKV-PAAELTFAYRRLGGVAEGEVVAAATIA 203

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
             P +  +I   +      R   QP    + GS FKNP G  A +LIEK+G +G+  G A
Sbjct: 204 LEPAAPGLIRQRLRQYASQRRRAQPRGVASAGSFFKNPPGDYAGRLIEKAGLKGVGVGQA 263

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQ 310
           +++E H NF++N   A+  ++  L   VR +V   SGI LE E+  LG  FD +
Sbjct: 264 RVAEEHANFLVNGGGASAAEMLALARLVRDQVRRDSGIELELEVHLLG--FDEE 315


>gi|323485853|ref|ZP_08091188.1| hypothetical protein HMPREF9474_02939 [Clostridium symbiosum
           WAL-14163]
 gi|323400841|gb|EGA93204.1| hypothetical protein HMPREF9474_02939 [Clostridium symbiosum
           WAL-14163]
          Length = 304

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 104/288 (36%), Positives = 149/288 (51%), Gaps = 3/288 (1%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRD 77
           G+   +  + + T FR GG A     P     LK  L L   + +P  I+G GSN+LV D
Sbjct: 15  GQVTRDEMMNRHTTFRVGGPASYFVSPDGDEALKKVLLLCREEQMPYYILGNGSNLLVSD 74

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G  GV++ L   GF+ I      E+  GA      +A  A  H + GF F  GIPG++G
Sbjct: 75  KGYGGVMI-LMGEGFAQIREDVSGELAAGAGVLLSRIAREAQEHSLTGFEFAAGIPGTLG 133

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLR 196
           GA  MNAGA + E    +  V  +D+ G    +   +L+  YR S I  K+ I+   V+ 
Sbjct: 134 GAVVMNAGAYDGEMKNVLKTVRVMDKNGRILELSANELELGYRRSCIQEKEYIVLSAVIT 193

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
                +  I   +A +   R   QP++  + GSTFK P G+ A +LIE +G RG   GGA
Sbjct: 194 LKQGDKEAIQTKMAELAGKRRDKQPLEYPSAGSTFKRPAGYFAGKLIEDAGLRGYREGGA 253

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           ++SE HC F+IN+  AT  D+  L   V+KKV   SG+ LE E++ +G
Sbjct: 254 QVSEKHCGFVINSGGATAEDIRLLCRSVQKKVKETSGVDLETEVRMIG 301


>gi|154484302|ref|ZP_02026750.1| hypothetical protein EUBVEN_02015 [Eubacterium ventriosum ATCC
           27560]
 gi|149734779|gb|EDM50696.1| hypothetical protein EUBVEN_02015 [Eubacterium ventriosum ATCC
           27560]
          Length = 300

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 106/300 (35%), Positives = 167/300 (55%), Gaps = 18/300 (6%)

Query: 12  ERGKQLRGK--FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVG 68
           E+ K++ G+   +EN  +     FR GGNAE+   P  I +L   + L   +D+   ++G
Sbjct: 7   EKIKEVVGEKYVKENESMASHCTFRCGGNAELFVTPGSIDELTQVVALCRENDVEFLVIG 66

Query: 69  LGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHF 128
            GSN+LV+D G +GV++ + N+  S I+V    +++  A     ++A +A+ + +GGF F
Sbjct: 67  NGSNLLVKDEGYKGVIIEV-NSRISFIDVIGE-DIVADAGAKLSAVAVTAMENDLGGFEF 124

Query: 129 FYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL 188
            +GIPG+IGGA  MNAGA   E  Q +  V  +D +GN   +   +L+  YR+S I K  
Sbjct: 125 AHGIPGNIGGAVMMNAGAYGGEMKQVLKWVKVLDNEGNIITLDASELEMGYRTSIIEKK- 183

Query: 189 IITHVVLRG-------FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
              ++VL+        F E   +I   +      R   QP++  + GSTFK P G+ A +
Sbjct: 184 --GYIVLQARIGLNIEFSEDIGLI---MQMFMQKRRASQPLEYPSAGSTFKRPEGYFAGK 238

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           LI+ +G RG + GGA +SE HC F+IN DNAT  D+  L + V+ KV  +  + LE E++
Sbjct: 239 LIDDAGLRGYKVGGAMVSEKHCGFVINYDNATATDVINLMKDVQAKVKEKFDVQLEPEVR 298


>gi|312867325|ref|ZP_07727534.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus parasanguinis
           F0405]
 gi|311097026|gb|EFQ55261.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus parasanguinis
           F0405]
          Length = 298

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 103/303 (33%), Positives = 158/303 (52%), Gaps = 14/303 (4%)

Query: 9   LLRERGKQLRG---KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPI 64
           ++ E  + L G   +FQE  PLK  T+ + GGNAE +  P++ ++LK  +     + IP 
Sbjct: 1   MIEEMNQILEGIDIRFQE--PLKHYTYTKVGGNAEFLAFPRNQYELKRIVQFANQEQIPW 58

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANS--ALRHG 122
            ++G  SNI+VRD GI G V+        +I V  +   ++ A    K +  +  AL H 
Sbjct: 59  MVLGNASNIIVRDGGIPGFVIMFDR--LRDISVDGY---VIEAEAGAKLIDTTHVALHHS 113

Query: 123 IGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS 182
           + GF F  GIPGS+GGA +MNAGA   E +  +V    + + G    +   +L + YR S
Sbjct: 114 LKGFEFASGIPGSVGGAVFMNAGAYGGEIAHVLVSCKVLTKDGEIETLSASELAFGYRHS 173

Query: 183 EITKD-LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
           +I +   ++        P +   I   +  + H R+  QP++  + GS FK P GH A Q
Sbjct: 174 KIQETGAVVISAKFALSPGNHEAIKQEMDRLTHLRQLKQPLEYPSCGSVFKRPVGHFAGQ 233

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           LI ++G +G   GG ++SE H  FM+N DN T  D E L   V + V   SG+ LE E++
Sbjct: 234 LISEAGLKGYRIGGVEVSEKHAGFMVNVDNGTAKDYEDLIAHVIEAVEAHSGVRLEPEVR 293

Query: 302 RLG 304
            +G
Sbjct: 294 IIG 296


>gi|223933875|ref|ZP_03625840.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus suis
           89/1591]
 gi|302023703|ref|ZP_07248914.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus suis
           05HAS68]
 gi|330832738|ref|YP_004401563.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus suis
           ST3]
 gi|223897464|gb|EEF63860.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus suis
           89/1591]
 gi|329306961|gb|AEB81377.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus suis
           ST3]
          Length = 302

 Score =  164 bits (415), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 103/292 (35%), Positives = 154/292 (52%), Gaps = 9/292 (3%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDA 78
           +F E  PLK+ T+ + GG  + +  P++ +++   +     + IP  ++G  SNI+VRD 
Sbjct: 15  RFDE--PLKEYTYTKVGGAVDYLAFPRNRYEIVRIVEFAKREGIPWQVLGNSSNIIVRDG 72

Query: 79  GIRGVVLRLSNAGFSNIEVRNHC-EMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
           GIRG V+R+     +++ V  +  E   GA          AL H + GF F  GIPGSIG
Sbjct: 73  GIRGFVIRMDK--LNSVTVSGYTIEAEAGANLI--ETTKVALFHSLSGFEFACGIPGSIG 128

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLR 196
           GA YMNAGA   E +  +V    +   G    +   +L++ YRSS + ++  I+      
Sbjct: 129 GAVYMNAGAYGGEVAHILVSAQILTPAGYVETLDNRELRFGYRSSILQENGAIVLSAKFA 188

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
             P +  +I   +A + H RE  QP++  + GS FK P GH A QLI  +G +G   GG 
Sbjct: 189 LKPGNHTVIQQEMARLTHLRELKQPLEYPSCGSVFKRPLGHFAGQLIMDAGLKGYRIGGV 248

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFD 308
           ++SE H  FM+N +N T  D E L   V + V   SGI LE E++ +GD  D
Sbjct: 249 EVSEKHAGFMVNIENGTASDYENLIAHVIEVVEKSSGITLEREVRIIGDPAD 300


>gi|319946698|ref|ZP_08020932.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus australis ATCC
           700641]
 gi|319746746|gb|EFV99005.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus australis ATCC
           700641]
          Length = 300

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 103/286 (36%), Positives = 156/286 (54%), Gaps = 11/286 (3%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRG 82
           N PLKQ T+ + GG A+ +  P++ ++LK  +T     +IP  ++G  SNI+VRD+GI G
Sbjct: 19  NEPLKQYTYTKVGGAADYLAFPRNQYELKRIVTFANAQEIPWMVLGNSSNIIVRDSGIEG 78

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGK--SLANSALRHGIGGFHFFYGIPGSIGGAA 140
            V+   +  F +I V  +   ++ A    K   + + A  H + GF F  GIPGSIGGA 
Sbjct: 79  FVIMFDH--FHDIRVNGY---VIEAEAGAKLIDVTHVARYHSLTGFEFACGIPGSIGGAV 133

Query: 141 YMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI--TKDLIITHVVLRGF 198
           YMNAGA   E +  +     +  +G    +  E+L + YR S+I  T D++I        
Sbjct: 134 YMNAGAYGGEIAHILKSCKVLTPEGEIKTLTAEELAFGYRHSKIQETGDVVIAAKFALA- 192

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P + + I+  +A + H RE  QP++  + GS FK P GH A QLI ++G +G   GG ++
Sbjct: 193 PGNYDQINQEMARLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGHRIGGVEV 252

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           SE H  FMIN D+ T  + E L   V   V   +G+ LE E++ +G
Sbjct: 253 SEKHAGFMINVDHGTAKNYEDLIAHVIATVEKSAGVTLEREVRIIG 298


>gi|291566623|dbj|BAI88895.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Arthrospira
           platensis NIES-39]
          Length = 320

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 99/284 (34%), Positives = 161/284 (56%), Gaps = 6/284 (2%)

Query: 27  LKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIRGVVL 85
           L  +T FR GG A+    PQ +  L   L    S+ +PIT++G GSN+LV D G+RG+V+
Sbjct: 36  LASLTSFRVGGPADWYTAPQRLDQLLACLEWANSEELPITLLGGGSNLLVSDRGLRGLVI 95

Query: 86  RLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAG 145
                  ++ + +   ++ VG+  S   LA  A R G  G  +  GIPG++GGA  MNAG
Sbjct: 96  GTRYLRHTHFD-QETGQLTVGSGASLPRLAWKAARMGWRGLEWAVGIPGTVGGAVVMNAG 154

Query: 146 ANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGFP--ESQ 202
           A++  T+  ++  H ++R G  HV+P ++L Y+YR+S +     ++T    +  P  + Q
Sbjct: 155 AHSSCTADILINTHILERSGTLHVLPPQKLGYRYRTSNLQGGSRLVTQATFQLQPGYDPQ 214

Query: 203 NIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELH 262
            +++    +    R   QP    + GS F+NP  H A  LIE++G +G + GGA+++E H
Sbjct: 215 QVMAETTEHF-QQRRLSQPYHLPSCGSVFRNPGPHKAGWLIEQTGLKGYQIGGAQVAERH 273

Query: 263 CNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
            NF++N  +AT  D+  L   V+++V +Q   LLE E++ LG+F
Sbjct: 274 ANFILNCGSATASDIFQLIHHVQERVQHQWYCLLEPEVRILGEF 317


>gi|323693192|ref|ZP_08107410.1| UDP-N-acetylmuramate dehydrogenase [Clostridium symbiosum
           WAL-14673]
 gi|323502675|gb|EGB18519.1| UDP-N-acetylmuramate dehydrogenase [Clostridium symbiosum
           WAL-14673]
          Length = 304

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 103/276 (37%), Positives = 144/276 (52%), Gaps = 3/276 (1%)

Query: 31  TWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIRGVVLRLSN 89
           T FR GG A     P     LK  L L   + +P  I+G GSN+LV D G  GV++ L  
Sbjct: 27  TTFRVGGPASYFVSPDGDEALKKVLLLCREEQMPYYILGNGSNLLVSDKGYGGVMI-LMG 85

Query: 90  AGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNC 149
            GF+ I      E+  GA      +A  A  H + GF F  GIPG++GGA  MNAGA + 
Sbjct: 86  EGFAQIREDVPGELAAGAGALLSRIAREAQEHSLTGFEFAAGIPGTLGGAVVMNAGAYDG 145

Query: 150 ETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLRGFPESQNIISAA 208
           E    +  V  +D+ G    +   +L+  YR S I  K+ I+   V+      +  I   
Sbjct: 146 EMKNVLKTVSVMDKNGRILELSANELELGYRRSCIQEKEYIVLSAVISLKQGDKEAIQTK 205

Query: 209 IANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMIN 268
           +A +   R   QP++  + GSTFK P G+ A +LIE +G RG   GGA++SE HC F+IN
Sbjct: 206 MAELAGKRRDKQPLEYPSAGSTFKRPAGYFAGKLIEDAGLRGYREGGAQVSEKHCGFVIN 265

Query: 269 ADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           +  AT  D+  L   V+KKV   SG+ LE E++ +G
Sbjct: 266 SGGATAEDIRLLCRSVQKKVKETSGVDLETEVRMIG 301


>gi|284051262|ref|ZP_06381472.1| UDP-N-acetylmuramate dehydrogenase [Arthrospira platensis str.
           Paraca]
          Length = 318

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 99/284 (34%), Positives = 161/284 (56%), Gaps = 6/284 (2%)

Query: 27  LKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIRGVVL 85
           L  +T FR GG A+    PQ +  L   L    S+ +PIT++G GSN+LV D G+RG+V+
Sbjct: 34  LASLTSFRVGGPADWYTAPQRLDQLLACLEWANSEELPITLLGGGSNLLVSDRGLRGLVI 93

Query: 86  RLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAG 145
                  ++ + +   ++ VG+  S   LA  A R G  G  +  GIPG++GGA  MNAG
Sbjct: 94  GTRYLRHTHFD-QETGQLTVGSGASLPRLAWKAARMGWRGLEWAVGIPGTVGGAVVMNAG 152

Query: 146 ANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGFP--ESQ 202
           A++  T+  ++  H ++R G  HV+P ++L Y+YR+S +     ++T    +  P  + Q
Sbjct: 153 AHSSCTADILINTHILERSGTLHVLPPQKLGYRYRTSNLQGGSRLVTQATFQLQPGYDPQ 212

Query: 203 NIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELH 262
            +++    +    R   QP    + GS F+NP  H A  LIE++G +G + GGA+++E H
Sbjct: 213 QVMAETTEHF-QQRRLSQPYHLPSCGSVFRNPGPHKAGWLIEQTGLKGYQIGGAQVAERH 271

Query: 263 CNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
            NF++N  +AT  D+  L   V+++V +Q   LLE E++ LG+F
Sbjct: 272 ANFILNCGSATASDIFQLIHHVQERVQHQWYCLLEPEVRILGEF 315


>gi|16800527|ref|NP_470795.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria innocua
           Clip11262]
 gi|29336875|sp|Q92BT5|MURB_LISIN RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|16413932|emb|CAC96690.1| lin1459 [Listeria innocua Clip11262]
          Length = 298

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 103/284 (36%), Positives = 153/284 (53%), Gaps = 5/284 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRG 82
           N PL + T+ +TGGNA+V   P+ I + K  +T    + +P+TI+G GSN++++D GIRG
Sbjct: 16  NEPLSKYTYTKTGGNADVFVMPKTIEETKEIVTYCHQNKLPLTILGNGSNLIIKDGGIRG 75

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           V++ L      +IE R + ++I  +       A  AL   + G  F  GIPGSIGGA +M
Sbjct: 76  VIVHLDL--LQSIE-RKNTQIIAMSGAKLIDTAKFALDESLSGLEFACGIPGSIGGALHM 132

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLRGFPES 201
           NAGA   E S  +     + + G    + R +LK  YR S I  K  I+         E 
Sbjct: 133 NAGAYGGEISDVLEAATVLTQSGELKKLKRSELKAAYRFSTIAEKKYIVLDATFSLELED 192

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
           +NII A +  +   RE  QP++  + GS FK P GH A +LI+ SG +G   GGA++S  
Sbjct: 193 KNIIQAKMDELTALREAKQPLEYPSCGSVFKRPPGHFAGKLIQDSGLQGHIIGGAQVSLK 252

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           H  F++N   AT  D   L   V++ V  +  + LE E+K +G+
Sbjct: 253 HAGFIVNIGGATATDYMNLIAHVQQTVREKFDVELETEVKIIGE 296


>gi|322389765|ref|ZP_08063312.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus parasanguinis
           ATCC 903]
 gi|321143604|gb|EFX39035.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus parasanguinis
           ATCC 903]
          Length = 298

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 100/289 (34%), Positives = 152/289 (52%), Gaps = 11/289 (3%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDA 78
           +FQE  PLK  T+ + GGNAE +  P++ ++LK  +     + IP  ++G  SNI+VRD 
Sbjct: 15  RFQE--PLKHYTFTKVGGNAEFLAFPRNQYELKRIVQFANQEQIPWMVLGNASNIIVRDG 72

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANS--ALRHGIGGFHFFYGIPGSI 136
           GI G V+        +I V  +   ++ A    K +  +  AL H + GF F  GIPGS+
Sbjct: 73  GIPGFVIMFDR--LRDISVDGY---VIEAEAGAKLIDTTHVALHHSLKGFEFASGIPGSV 127

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVL 195
           GGA +MNAGA   E +  +V    + + G    +   +L + YR S+I +   ++     
Sbjct: 128 GGAVFMNAGAYGGEIAHVLVSCKVLTKDGEIETLSASELAFGYRHSKIQETGAVVISAKF 187

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
              P +   I   +  + H R+  QP++  + GS FK P GH A QLI ++G +G   GG
Sbjct: 188 ALSPGNHEAIKQEMDRLTHLRQLKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGYRIGG 247

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            ++SE H  FM+N DN T  D E L   V + V   SG+ LE E++ +G
Sbjct: 248 VEVSEKHAGFMVNVDNGTAKDYEDLIAHVIEAVEAHSGVRLEAEVRIIG 296


>gi|332798690|ref|YP_004460189.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Tepidanaerobacter
           sp. Re1]
 gi|332696425|gb|AEE90882.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Tepidanaerobacter
           sp. Re1]
          Length = 303

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 108/311 (34%), Positives = 167/311 (53%), Gaps = 14/311 (4%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-P 59
           M   +I  ++RE   + + K  E  P+K+ T FR GG A++M  P +I ++   + +   
Sbjct: 1   MDVTKIYEIMREFLPESQVKINE--PMKKHTSFRIGGPADIMVLPTNIGEVTSIIKVCRQ 58

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSG----KSLA 115
           +DIP  ++G G+N+LV+D GIRGVV++L+   F++  V  +       RC       +L+
Sbjct: 59  NDIPFFVMGNGTNLLVKDEGIRGVVMKLAQ-NFNDANVNKNI-----IRCKAGVPLSALS 112

Query: 116 NSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQL 175
             AL   + G  F  GIPG++GGA  MNAGA   E +  V +V  +D  G  + + +E+L
Sbjct: 113 RIALESSLSGLEFANGIPGTVGGAVVMNAGAYGGEMADVVKKVTVVDMNGRLYEMQKEEL 172

Query: 176 KYQYRSSEITK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNP 234
            Y YR   +   D I+  V +   P +   I   +      R+  QP+   + GS FK P
Sbjct: 173 DYSYRRCILQDGDRILLEVEMELLPGNYEDIKRQMEEFAACRKAKQPLNLPSAGSAFKRP 232

Query: 235 TGHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGI 294
            GH A  LIEK+G +G   GGA +S+ H  F++N +NAT  D+  L   V+K+V  +  +
Sbjct: 233 PGHFAGALIEKAGLKGYRIGGAMVSDKHAGFIVNVENATFKDVISLISHVQKEVKRKFNV 292

Query: 295 LLEWEIKRLGD 305
            LE EIK +GD
Sbjct: 293 DLESEIKIIGD 303


>gi|326792000|ref|YP_004309821.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           lentocellum DSM 5427]
 gi|326542764|gb|ADZ84623.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           lentocellum DSM 5427]
          Length = 303

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 101/282 (35%), Positives = 154/282 (54%), Gaps = 6/282 (2%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIRGVV 84
           P+K  T F+ GG A++M +P++   L   L +  ++ +P  I+G GSN+LV DAG RGV+
Sbjct: 24  PMKNYTTFKIGGLADIMVKPENKEQLSTILQVCATEKVPYYILGNGSNLLVSDAGYRGVI 83

Query: 85  LRLSNAGFSNIEVR-NHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMN 143
           ++L N  F+ I V  N      GA  +   +A  AL + + GF F +GIPG++GGA  MN
Sbjct: 84  IQLYNQ-FAEITVEDNRITAQSGALLA--RIAAKALENELTGFEFAHGIPGTLGGAVVMN 140

Query: 144 AGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFPESQ 202
           AGA   E    +     +  +G    +  E+L+  YR+S I K   I+        P  +
Sbjct: 141 AGAYGGEMKHVIASCEVMTPEGEILKLSNEELELGYRTSVIQKKGYIVLEATFILEPGDK 200

Query: 203 NIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELH 262
             I   + +    R   QP+ + + GSTFK P G+ A +LI  SG RG + GGA IS+ H
Sbjct: 201 EKIQELMKDYAGRRRDKQPLDKPSAGSTFKRPEGYFAGKLIMDSGLRGFQVGGAMISDKH 260

Query: 263 CNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           C F++N   AT  D+ +L ++V++ V  +  + LE E+K LG
Sbjct: 261 CGFVVNTGEATCEDVIHLIQEVKRIVKEKFDVELEPEVKMLG 302


>gi|296876296|ref|ZP_06900348.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus parasanguinis
           ATCC 15912]
 gi|296432586|gb|EFH18381.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus parasanguinis
           ATCC 15912]
          Length = 298

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 100/289 (34%), Positives = 154/289 (53%), Gaps = 11/289 (3%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDA 78
           +FQE  PLK  T+ + GGNAE +  P++ ++LK  +     + IP  ++G  SNI+VRD 
Sbjct: 15  RFQE--PLKHYTFTKVGGNAEFLAFPRNQYELKRIVQFANQEQIPWMVLGNASNIIVRDG 72

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANS--ALRHGIGGFHFFYGIPGSI 136
           GI G V+        +I V  +   ++ A    K +  +  AL H + GF F  GIPGS+
Sbjct: 73  GIPGFVIMFDR--LRDISVDGY---VIEAEAGAKLIDTTHVALHHSLKGFEFASGIPGSV 127

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVL 195
           GGA +MNAGA   E +  +V    + ++G    +  ++L + YR S+I +   ++     
Sbjct: 128 GGAVFMNAGAYGGEIAHVLVSCKVLTKEGEIETLSAKELAFGYRHSKIQETGAVVISAKF 187

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
              P +   I   +  + H R+  QP++  + GS FK P GH A QLI ++G +G   GG
Sbjct: 188 ALSPGNHEQIKQEMERLTHLRQLKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGYRIGG 247

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            ++SE H  FM+N DN T  D E L   V + V   SG+ LE E++ +G
Sbjct: 248 VEVSEKHAGFMVNVDNGTAKDYEDLIAHVIEAVEAHSGVRLEPEVRIIG 296


>gi|253576132|ref|ZP_04853464.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Paenibacillus sp.
           oral taxon 786 str. D14]
 gi|251844475|gb|EES72491.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Paenibacillus sp.
           oral taxon 786 str. D14]
          Length = 301

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 100/284 (35%), Positives = 150/284 (52%), Gaps = 4/284 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIRG 82
           N P+ + T ++ GG A+ M  PQ    L   + LL ++ IP  ++G GSN+LV D GIRG
Sbjct: 19  NEPMSKYTTWKIGGPADAMAVPQTTRQLAELMRLLHAEGIPWMMIGKGSNLLVSDKGIRG 78

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
            V+RL    F  I V +  E+  G   S   L+  A + G+ G  F  GIPG++GGA YM
Sbjct: 79  CVIRLGGE-FEQI-VFDGTEVSAGGGASTVRLSIMAGKEGLTGLEFAGGIPGTVGGAVYM 136

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPESQ 202
           NAGA+  + S+       +   G       E +K+ YR S + +   I            
Sbjct: 137 NAGAHGSDVSRIFKSADIVLETGELVTYTAEDMKFAYRHSVLHEQRGIVAQARFSLAAGD 196

Query: 203 NI-ISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
            + ++AA+A     R   QP+ +   GS F+NP G  A +LIE +G +G++ GGA++S L
Sbjct: 197 RLEVAAAMAAYKDRRRKTQPLSQPCAGSVFRNPPGDHAARLIEAAGLKGMKVGGAEVSTL 256

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           H NF++N   AT  D+  L EQV+  V +Q G+ L  E+  +G+
Sbjct: 257 HANFIVNTGQATAEDVLALMEQVKAAVQDQFGVALVPEVFFVGE 300


>gi|217964432|ref|YP_002350110.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes HCC23]
 gi|254764202|sp|B8DE89|MURB_LISMH RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|217333702|gb|ACK39496.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes HCC23]
 gi|307571003|emb|CAR84182.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes L99]
          Length = 298

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 103/284 (36%), Positives = 152/284 (53%), Gaps = 5/284 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRG 82
           N PL + T+ +TGG A+V   P+ I + +  +     + IP+TI+G GSN++++D GIRG
Sbjct: 16  NEPLSKYTYTKTGGEADVFVMPKTIEEAQEVVAYCHQNKIPLTILGNGSNLIIKDGGIRG 75

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           V+L L       IE RN+ ++I  +       A  AL   + G  F  GIPGSIGGA +M
Sbjct: 76  VILHLDL--LQTIE-RNNTQIIAMSGAKLIDTAKFALDESLSGLEFACGIPGSIGGALHM 132

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLRGFPES 201
           NAGA   E S  +     + + G    + R +LK  YR S I  K+ I+         E 
Sbjct: 133 NAGAYGGEISDVLEAATVLTQTGELKKLKRSELKAAYRFSTIAEKNYIVLDATFSLALEE 192

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
           +N+I A +  +   RE  QP++  + GS FK P GH A +LI+ SG +G   GGA++S  
Sbjct: 193 KNLIQAKMDELTAAREAKQPLEYPSCGSVFKRPPGHFAGKLIQDSGLQGHIIGGAQVSLK 252

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           H  F++N   AT  D   L   V+K V  +  + LE E+K +G+
Sbjct: 253 HAGFIVNIGGATATDYMNLIAYVQKTVREKFDVELETEVKIIGE 296


>gi|241890112|ref|ZP_04777410.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Gemella haemolysans
           ATCC 10379]
 gi|241863734|gb|EER68118.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Gemella haemolysans
           ATCC 10379]
          Length = 300

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 99/285 (34%), Positives = 166/285 (58%), Gaps = 6/285 (2%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRG 82
           N PL+  ++ +TGGNAE++ +  +  DL+  +     ++I +TI+G GSN+L+ D GI+G
Sbjct: 19  NEPLRNYSFTKTGGNAEILVKINNEKDLQNVIAYSNENNIELTILGNGSNVLISDNGIQG 78

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           +V   S+   ++IE+     +   A  + K L +  + + +    F  GIPGS+GGA +M
Sbjct: 79  IVALTSD--MNDIELLEGDVISCYAGLTLKELTDFCIENSLTNLEFSCGIPGSVGGAIFM 136

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI--TKDLIITHVVLRGFPE 200
           NAGA   E  + V +V    + G + +   EQ+++ YR S I  TK+ II+ V  +    
Sbjct: 137 NAGAYGGEMKEVVQKVEVFTKNGEKKIYTNEQMEFSYRHSIIQETKE-IISKVYFQMKKG 195

Query: 201 SQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISE 260
           ++  I + +  +   R   QP++  + GS FK P G+ A +LI+ +G +GL  GGA++S+
Sbjct: 196 NKEEIVSKVEELNKMRSDKQPLEYPSCGSVFKRPEGYFAGKLIQDAGLQGLTVGGAQVSK 255

Query: 261 LHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            H  FM+N ++AT  D + L ++V+KKV   SG+ LE E+K LG+
Sbjct: 256 KHAGFMVNINSATCEDYKNLIKEVQKKVLEDSGVELECEVKILGE 300


>gi|154499870|ref|ZP_02037908.1| hypothetical protein BACCAP_03527 [Bacteroides capillosus ATCC
           29799]
 gi|150271468|gb|EDM98725.1| hypothetical protein BACCAP_03527 [Bacteroides capillosus ATCC
           29799]
          Length = 305

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 104/312 (33%), Positives = 162/312 (51%), Gaps = 20/312 (6%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD 61
           I+  +  +L     +L  + +E  P+ + T FR GG A +M  P+D  ++K    +  +D
Sbjct: 3   IFSAVRMVLERECPELELRTEE--PMARHTTFRVGGPARLMAFPRDKKEIKA--AVRAAD 58

Query: 62  ----IPITIVGLGSNILVRDAGIRGVVLR---LSNAGFSNIEVRNHCEMIVGARCSGKSL 114
               IP   +G GSN+LV D G+   V++   L      N  +R  C + +        L
Sbjct: 59  EMGVIPF-FLGNGSNLLVADEGVEAFVIKTGGLDQTREVNRRLRAECGIPL------SRL 111

Query: 115 ANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQ 174
           A +AL  G+ G  F +GIPGS+GGA  MNAGA   E  Q +  V  +D+ G +H +P  +
Sbjct: 112 AVAALGRGLTGLEFAHGIPGSLGGAVVMNAGAYGGEMVQVLTAVTYLDKHGQEHTVPASE 171

Query: 175 LKYQYRSSEITK--DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFK 232
               YR S  T   + ++    +         I A + ++   R++ QP++  + GSTFK
Sbjct: 172 CGLTYRHSMFTDHPEWLVLEAEMELEQGDAEEIRAKMEDLAQRRKSKQPLEYPSAGSTFK 231

Query: 233 NPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQS 292
            P GH A  LIE+ G +GL  GGA++SE H  F+IN   AT  D+  L EQ+++ V  ++
Sbjct: 232 RPEGHFAAALIEQCGLKGLTVGGAQVSEKHAGFVINRGGATCADILKLTEQIKETVLRET 291

Query: 293 GILLEWEIKRLG 304
           G+ LE E++ LG
Sbjct: 292 GVTLELEVRTLG 303


>gi|118581687|ref|YP_902937.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Pelobacter
           propionicus DSM 2379]
 gi|187609735|sp|A1AU59|MURB_PELPD RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|118504397|gb|ABL00880.1| UDP-N-acetylmuramate dehydrogenase [Pelobacter propionicus DSM
           2379]
          Length = 295

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 99/296 (33%), Positives = 148/296 (50%), Gaps = 10/296 (3%)

Query: 14  GKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSN 72
           G  +RG    + P+ + T  R GG A++   P+D  DL+  L  L    IP   +G G+N
Sbjct: 5   GLNMRGLLLADEPMSRHTSLRVGGPADLFAIPEDADDLQGLLRQLKERGIPWLAIGRGNN 64

Query: 73  ILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGI 132
           +LVRD+GIRG V+ L    F+ +E      +  GA     ++   A   G+GG  F  GI
Sbjct: 65  LLVRDSGIRGAVISLER--FNRVEALGQGRIRAGAGAENLAVVRFAQEQGLGGIGFISGI 122

Query: 133 PGSIGGAAYMNAGANNC---ETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLI 189
           PG++GGA  MNAGA      E ++ +  +H     GN     R++L+Y YR  ++    I
Sbjct: 123 PGTVGGAIRMNAGAYGTGIMERTESLTLLH----DGNVREFGRDELEYGYRHLDLAAGDI 178

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
           I   + R            I      R     +   + GS FKNP G +AW+LI+ +G R
Sbjct: 179 ILEALFRLDQREAEQTEEEIRKDLELRRAKHSVGFPSAGSFFKNPAGQTAWRLIDATGMR 238

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           G   GGA++S++H NF++N   AT  D   L   V+K V    G+ LE E++ +G+
Sbjct: 239 GERVGGAQVSQVHSNFLVNTGGATAGDFLELSRVVKKAVLASCGVTLEEEVRIVGE 294


>gi|94264636|ref|ZP_01288419.1| UDP-N-acetylenolpyruvoylglucosamine reductase [delta
           proteobacterium MLMS-1]
 gi|93454931|gb|EAT05172.1| UDP-N-acetylenolpyruvoylglucosamine reductase [delta
           proteobacterium MLMS-1]
          Length = 315

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 104/294 (35%), Positives = 151/294 (51%), Gaps = 6/294 (2%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRD 77
           G  Q   PL  +T  R GG + V+ +P  +  L+  L LL +   P  ++G GSN+LV D
Sbjct: 26  GSCQPLAPLAPLTTLRIGGPSAVLARPASLAGLEQLLALLATHGCPWRVLGRGSNLLVAD 85

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G  GVV+ L     + I+ ++H  + V A CS  +L   AL  G+ G  F  GIPGS+G
Sbjct: 86  RGYPGVVILLDRQ-LAGIKEQDHHRVRVEAGCSLAALLGWALGRGLSGLEFLVGIPGSLG 144

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS-SEITKDLIITHVVLR 196
           GA  +NAGA      Q VVEV  +   G + V P  +L + YR    I +  ++    + 
Sbjct: 145 GALMLNAGAWGGNLGQRVVEVELVAATGARKV-PAAELTFAYRRLGGIAEGEVVAAATIA 203

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
             P +  +I   +      R   QP    + GS FKNP G  A +LIEK+G +G+  G A
Sbjct: 204 LEPAAPGLIRQRLRQYASRRRRAQPRGVASAGSFFKNPPGDYAGRLIEKAGLKGVGVGQA 263

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQ 310
           +++E H NF++N   A+  ++  L   VR +V   SGI LE E+  LG  FD +
Sbjct: 264 RVAEEHANFLVNGGGASAAEMLALARLVRDQVRRDSGIELELEVHLLG--FDEE 315


>gi|306824973|ref|ZP_07458316.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sp. oral taxon
           071 str. 73H25AP]
 gi|304432800|gb|EFM35773.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sp. oral taxon
           071 str. 73H25AP]
          Length = 304

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 102/301 (33%), Positives = 157/301 (52%), Gaps = 20/301 (6%)

Query: 15  KQLRG---KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLG 70
           +QL G   +F+E  PLK  T+ + GG A+ +  P++ +++   +      +IP  ++G  
Sbjct: 12  EQLEGIDIRFKE--PLKTYTYTKVGGRADYLVLPRNRYEMARVVQFANQENIPWMVLGNA 69

Query: 71  SNILVRDAGIRGVVL---RLSNAGFS--NIEVRNHCEMIVGARCSGKSLANSALRHGIGG 125
           SNI+VRD GIRG V+   +L+N       IE      +I   R         ALRH + G
Sbjct: 70  SNIIVRDGGIRGFVILCDKLNNVSVDGYTIEAEAGANLIETTRI--------ALRHSLTG 121

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT 185
           F F  GIPGS+GGA +MNAGA   E +  +     + ++G    +  ++L + YR S + 
Sbjct: 122 FEFACGIPGSVGGAVFMNAGAYGGEIAHILQSCQILTKEGEIETLSAKELAFGYRHSAVQ 181

Query: 186 KD-LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIE 244
               ++        P +  +I   +  + H RE  QP++  + GS FK P GH A QLI 
Sbjct: 182 DSGAVVLSAKFALSPGNHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLIS 241

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           ++G +G   GG ++SE H  FMIN  + T  D E L + V +KV   SG+ LE E++ LG
Sbjct: 242 EAGLKGYRIGGVEVSEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGVTLEREVRILG 301

Query: 305 D 305
           +
Sbjct: 302 E 302


>gi|306829755|ref|ZP_07462944.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus mitis ATCC 6249]
 gi|304428106|gb|EFM31197.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus mitis ATCC 6249]
          Length = 304

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 105/301 (34%), Positives = 156/301 (51%), Gaps = 20/301 (6%)

Query: 15  KQLRG---KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLG 70
           +QL G   +F+E  PLK  T+ + GG A+ +  P++ +++   +      +IP  ++G  
Sbjct: 12  EQLEGIDIRFKE--PLKTYTYTKVGGRADYLVLPRNRYEMARVVQFANQENIPWMVLGNA 69

Query: 71  SNILVRDAGIRGVVL---RLSNAGFS--NIEVRNHCEMIVGARCSGKSLANSALRHGIGG 125
           SNI+VR+ GIRG V+   +L+N       IE      +I   R         ALRH + G
Sbjct: 70  SNIIVREGGIRGFVILCDKLNNVSVDGYTIEAEAGANLIETTRI--------ALRHSLTG 121

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT 185
           F F  GIPGSIGGA +MNAGA   E +  +     + ++G    +  + L + YR S I 
Sbjct: 122 FEFACGIPGSIGGAVFMNAGAYGGEIAHILQSCQILTKEGEIETLSAKDLAFGYRHSAIQ 181

Query: 186 KD-LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIE 244
               I+        P +  +I   +  + H RE  QP++  + GS FK P GH A QLI 
Sbjct: 182 DSGAIVLSAKFALAPGNHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLIS 241

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           ++G +G   GG ++SE H  FMIN  + T  D E L E V +KV   SG+ LE E++ LG
Sbjct: 242 EAGLKGYRIGGVEVSEKHAGFMINVADGTARDYEDLIESVIEKVKEHSGVTLEREVRILG 301

Query: 305 D 305
           +
Sbjct: 302 E 302


>gi|291518009|emb|CBK73230.1| UDP-N-acetylmuramate dehydrogenase [Butyrivibrio fibrisolvens 16/4]
          Length = 287

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 100/281 (35%), Positives = 149/281 (53%), Gaps = 3/281 (1%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDAGIRGVVL 85
           P+K  T FR GG A++  +P     +     L   D P  ++G GSN+L+ D GI GVV+
Sbjct: 4   PMKTHTTFRIGGPADIYVEPSIYQMVPLIAYLREIDAPFMVIGNGSNLLISDDGIEGVVV 63

Query: 86  RLSNAGFSNIEVRNHCEMIVGARCSG-KSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
            L  A  S I +    + +V A  +   S+AN A   G+ G  F  GIPG+IGGA YMNA
Sbjct: 64  ALGKA-MSEIVIDESTQTVVAAAGAMLSSVANRAAEAGLTGLEFASGIPGTIGGAIYMNA 122

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGFPESQN 203
           GA   E    +V    ++  G    I  + L   YR S + + + I+    L+    + +
Sbjct: 123 GAYGGEMKDVIVSATILEGNGELKEIYVDDLDLSYRHSALMENEWIVISAKLQLAAGNVD 182

Query: 204 IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHC 263
            I A IA++   R   QP+   + GSTFK P G+ A +LI+ +G RG   GGA++SE HC
Sbjct: 183 EIKATIADIRDKRIEKQPLNFPSAGSTFKRPEGYFAGKLIDDAGLRGYTVGGAQVSEKHC 242

Query: 264 NFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            F+IN  +AT  D+  L + V + V+ + G+ L  E++ +G
Sbjct: 243 GFVINKSDATASDVLQLMKNVDQIVYEKFGVHLTPEVRIIG 283


>gi|312111932|ref|YP_003990248.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus sp.
           Y4.1MC1]
 gi|311217033|gb|ADP75637.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus sp.
           Y4.1MC1]
          Length = 308

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 100/285 (35%), Positives = 162/285 (56%), Gaps = 11/285 (3%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIRGVV 84
           PLK  T  + GG A+ +  P+    +   + L     +P T++G GSN++VRD GIRG+V
Sbjct: 26  PLKYHTLVKIGGKADFLVWPETYEQVVEVIRLKEKHHLPFTLLGNGSNVIVRDGGIRGIV 85

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           ++L +   + I+V    ++I  +    K+++  AL H + G  F  GIPGS+GGA  MNA
Sbjct: 86  VQLKH--LTEIKVEGE-KIIAQSGADIKAVSRVALEHSLTGLEFACGIPGSVGGAIMMNA 142

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK--DLIITHV--VLRGFPE 200
           GA + E    +  V  + + G Q ++ ++ L+  YR+S I+K  D+++  V  + +G P+
Sbjct: 143 GAYDGEIKDVIDHVKVVTQTGEQKILRKDDLQLGYRTSIISKTNDIVLEAVFQLKKGDPQ 202

Query: 201 SQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISE 260
               I   + ++   RE+ QP++  + GS FK P G+ A +LI+ SG +G   GGA++S 
Sbjct: 203 K---IKEKMDDLTFRRESKQPLEYPSVGSVFKRPPGYFAGKLIQDSGLQGKGVGGAEVST 259

Query: 261 LHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            H  F+IN +NAT  D     E VRK V  + G+ LE E+K +G+
Sbjct: 260 KHAGFIINKNNATASDYIATIELVRKTVKEKFGVDLELEVKIIGE 304


>gi|254495867|ref|ZP_05108777.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Legionella
           drancourtii LLAP12]
 gi|254354903|gb|EET13528.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Legionella
           drancourtii LLAP12]
          Length = 300

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 104/295 (35%), Positives = 146/295 (49%), Gaps = 2/295 (0%)

Query: 12  ERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGS 71
           E   + +G    N PL + T +R GG A  +++P    DL  FL  LP   P+  +GLGS
Sbjct: 6   ELTAEYQGTLLYNEPLAEYTTWRVGGPAAKLYKPAHAADLALFLRNLPEREPLLWLGLGS 65

Query: 72  NILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYG 131
           N L++D G  G V+ L+      I + +   + V A  S  S+A    R+ + G  F+ G
Sbjct: 66  NSLIKDNGFSGTVV-LTQGCLKEINLLSAQTVKVDAGVSCASMARFCARNNLSGGEFWAG 124

Query: 132 IPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIIT 191
           IPG++GGA  MNAG +  ET Q VVEV  I R G   +   E+ +  YR      D    
Sbjct: 125 IPGTMGGALRMNAGCHGGETWQSVVEVQTITRSGEIKIRKPEEYEVAYRHVSGPADEWFI 184

Query: 192 HVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGL 251
               +    ++      I ++  HR   QP  E   GS F+NP G  A +LIE  G +G 
Sbjct: 185 SATFKLLAGTKETSLQVIKDLLAHRANTQPTSECNCGSVFRNPPGDFAARLIESCGLKGF 244

Query: 252 EFGGAKISELHCNFMINADN-ATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
             GGA +S+ H NF+IN    AT  D+E L   V+ KV  Q+ I L  E+  +GD
Sbjct: 245 SIGGAMVSQKHANFIINHQGLATAADIEALIHLVQTKVREQTTIELMREVHIIGD 299


>gi|150019666|ref|YP_001311920.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           beijerinckii NCIMB 8052]
 gi|189028920|sp|A6M2Y4|MURB_CLOB8 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|149906131|gb|ABR36964.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           beijerinckii NCIMB 8052]
          Length = 304

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 104/306 (33%), Positives = 155/306 (50%), Gaps = 21/306 (6%)

Query: 7   SRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPIT 65
           S+L  E   QL  K  E+       +F+ GG  +++  P  I  +K  +T+   ++IP  
Sbjct: 12  SKLYEESQIQLDAKMSEHI------YFKVGGPVDILLTPNSIQQVKETITICKENNIPFY 65

Query: 66  IVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMI---VGARCSG--KSLANSALR 120
           ++G GSNILV+D GIRGVV++L           N  E I   + A C    K ++ +A  
Sbjct: 66  VIGNGSNILVKDGGIRGVVIKLCEL--------NKIECIGNKIIAECGALLKDVSKAATE 117

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             + GF F  GIPGS+GGA +MNAGA + E S  +     +D      +IP+ +L   YR
Sbjct: 118 GSLAGFQFACGIPGSVGGAVFMNAGAYDGEISFVIESAEVLDDNQEIRIIPKSELNLGYR 177

Query: 181 SSEIT-KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
            S +  K  I+           +  I A +  +   RE  QP++  + GSTFK P G+ A
Sbjct: 178 QSVVMQKGYIVLRATFNLVNGDKEKIQARVDELTKRREERQPLEYPSAGSTFKRPEGYFA 237

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LIE +G +G   GGA +SE H  F+IN  N T  D+  +   VR +V  Q G+ L  E
Sbjct: 238 GKLIEDAGLKGFAIGGACVSEKHAGFVINCKNGTAKDVLDVIYHVRDEVKKQFGVDLYPE 297

Query: 300 IKRLGD 305
           ++  G+
Sbjct: 298 VRIWGE 303


>gi|77166310|ref|YP_344835.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrosococcus oceani
           ATCC 19707]
 gi|254435175|ref|ZP_05048682.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrosococcus oceani
           AFC27]
 gi|115311641|sp|Q3J791|MURB_NITOC RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|76884624|gb|ABA59305.1| UDP-N-acetylmuramate dehydrogenase [Nitrosococcus oceani ATCC
           19707]
 gi|207088286|gb|EDZ65558.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrosococcus oceani
           AFC27]
          Length = 298

 Score =  163 bits (412), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 104/293 (35%), Positives = 153/293 (52%), Gaps = 9/293 (3%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RG  + +  +   T +R GG A+ +++P D  DL  FL  LP + P+  +GLGSN+LVR
Sbjct: 9   VRGWLRHHVVMASHTSWRVGGPAQRLYRPADRDDLIAFLRFLPRNEPLLWLGLGSNLLVR 68

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GI G V+ ++    + IE R    + V A  S   LA    R G+ G  F  GIPG++
Sbjct: 69  DGGISGTVIAIAGV-LNRIERRTDTTVWVEAGVSCAKLAKFCAREGLRGAEFLAGIPGTV 127

Query: 137 GGAAYMNAGANNCETSQYV--VEVHGIDRKGNQHV--IPREQLKYQYRSSEITKDLIITH 192
           GGA  MNAGA      + V  VEV GI   G +H   +P+E  +  YR     +      
Sbjct: 128 GGALAMNAGAFGGTMWELVTAVEVAGI---GGEHCRRLPQE-YQVSYREVHGPEREWFLA 183

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
             LR    +  +    I  +   R   QPI++   GS F+NP    A +LIE  G +G  
Sbjct: 184 AELRLTLGNSQVAQQQIRRLLRQRNGCQPIRQPCAGSVFRNPWNDKAGRLIEACGLKGAS 243

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            GGA++SE H NF++N  NA+  D+E+L + V + V  Q+G+ L  E+  +G+
Sbjct: 244 IGGARVSERHANFIVNTGNASAADVEHLIQWVAETVARQAGVSLVPEVHMVGE 296


>gi|15893801|ref|NP_347150.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           acetobutylicum ATCC 824]
 gi|29336903|sp|Q97LP4|MURB_CLOAB RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|15023372|gb|AAK78490.1|AE007565_9 UDP-N-acetylenolpyruvoylglucosamine reductase (murB) [Clostridium
           acetobutylicum ATCC 824]
 gi|325507924|gb|ADZ19560.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           acetobutylicum EA 2018]
          Length = 305

 Score =  163 bits (412), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 102/287 (35%), Positives = 160/287 (55%), Gaps = 11/287 (3%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIRG 82
           + P+K  T F+ GG  +V+  P+   ++   + L    D+   I+G GSN+LVRD G+RG
Sbjct: 23  DVPMKNHTSFKVGGPVDVLVMPEKYEEINRIIELCEKYDVNYYIIGNGSNLLVRDGGLRG 82

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           V ++L     + +++ N+ ++I G       L+  A    + G  F  GIPGS+GGA  M
Sbjct: 83  VAIKLLK--LNKLQIGNN-KIIAGCGVPLGYLSRKARDKSLTGLEFACGIPGSVGGAVAM 139

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK----DLIITHVVLRGF 198
           NAGA N E S  V  V  ID KG    + R++L++ YRSS I K     L +T  + +G 
Sbjct: 140 NAGAYNGEISNVVESVLVIDNKGKMKRLYRDELQFGYRSSAILKHKYIALEVTFTLQKGD 199

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
            E    I+  I ++   R   QP++  + GSTFK P GH A +LIE SG +G   GGA++
Sbjct: 200 REK---IANRIDDLMRRRIEKQPLEYPSAGSTFKRPVGHFAAKLIEDSGLKGKGIGGAQV 256

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           S+ H  F+IN ++AT  D+  L + V+  V ++  + L+ E++ +G+
Sbjct: 257 SDKHSGFIINKNDATAKDILDLIKFVQNTVKSKFNVELDTEVRIIGE 303


>gi|222150736|ref|YP_002559889.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Macrococcus
           caseolyticus JCSC5402]
 gi|254764208|sp|B9EAD2|MURB_MACCJ RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|222119858|dbj|BAH17193.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Macrococcus
           caseolyticus JCSC5402]
          Length = 304

 Score =  163 bits (412), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 93/284 (32%), Positives = 155/284 (54%), Gaps = 5/284 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRG 82
           N PLK+ T+ +TGGNA++   P    +++  L +   +DIP+T +G GSNI++RD GIRG
Sbjct: 22  NEPLKKYTYTKTGGNADIYIMPTSYTEVQAALNIARQNDIPVTFLGNGSNIIIRDGGIRG 81

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           +V+ L N   + I V  H  +   +  +   ++  A  H + G  F  GIPGS+GGA +M
Sbjct: 82  IVISLLN--LTKIRVHGHS-ITASSGAAIIDVSRIARDHHLTGLEFACGIPGSVGGAVFM 138

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFPES 201
           NAGA   E    +     I+ +G    +  + L+  YR+S I K+  ++     +  P  
Sbjct: 139 NAGAYGGEIKDVIDHALVINHEGEIISLDNQALELDYRTSIIQKEHFVVLEASFKLAPGD 198

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
              I + +  +   RE+ QP++  + GS F+ P GH A +LI+ +  +G   GG ++SE 
Sbjct: 199 IQSIQSQMDILTERRESKQPLEYPSCGSVFRRPPGHFAGKLIQDAQLQGHTIGGVQVSEK 258

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           H  F++N +  T  D E +   +++ V+  SGI LE E++ +G+
Sbjct: 259 HAGFIVNVNEGTATDYENMIAHIQETVYKNSGIALETEVRIIGE 302


>gi|307706854|ref|ZP_07643656.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus mitis
           SK321]
 gi|307617727|gb|EFN96892.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus mitis
           SK321]
          Length = 295

 Score =  163 bits (412), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 102/293 (34%), Positives = 152/293 (51%), Gaps = 17/293 (5%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDA 78
           +F+E  PL   ++ + GG A+ +  P++  +L   +     +DIP  ++G  SNI+VRD 
Sbjct: 11  RFKE--PLHSYSYTKVGGEADYLVFPRNRFELARVVKFANQADIPWMVLGNASNIIVRDG 68

Query: 79  GIRGVVL---RLSNAGFS--NIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           GIRG V+   +L+N       IE      +I   R         ALRH + GF F  GIP
Sbjct: 69  GIRGFVILCDKLNNVSVDGYTIEAEAGANLIETTRI--------ALRHSLTGFEFACGIP 120

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITH 192
           GS+GGA +MNAGA   E +  +     + + G    +  ++L + YR S I +   ++  
Sbjct: 121 GSVGGAVFMNAGAYGGEIAHILQSCKVLTKDGEIETLSVKELAFGYRHSVIQESGAVVLS 180

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
                 P S  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G  
Sbjct: 181 AKFALAPGSHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGYR 240

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            GG ++SE H  FMIN  + T  D E L E V +KV   SG+ LE E++ LG+
Sbjct: 241 IGGVEVSEKHAGFMINVADGTAKDYEDLIESVIEKVKEHSGVTLEREVRILGE 293


>gi|153006724|ref|YP_001381049.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Anaeromyxobacter sp.
           Fw109-5]
 gi|187609688|sp|A7HH69|MURB_ANADF RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|152030297|gb|ABS28065.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Anaeromyxobacter sp.
           Fw109-5]
          Length = 318

 Score =  163 bits (412), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 109/299 (36%), Positives = 153/299 (51%), Gaps = 16/299 (5%)

Query: 15  KQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNI 73
           +++RG+   + PL   T  R GG A+++ +P D   L   L  +    +P+TI+G G+N 
Sbjct: 19  RRVRGEVLRDAPLAPRTAVRVGGPADLLVRPADPGALAALLRAVRELSVPLTILGGGANT 78

Query: 74  LVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           LV DAG+RGVVLRL   GF   E R+   +++GA      L   A   G+ G  F  GIP
Sbjct: 79  LVADAGVRGVVLRLPQ-GFGE-EARDGERLVLGAGAPTSRLWVRAHAAGLVGIEFVAGIP 136

Query: 134 GSIGGAAYMNAGANNCETSQYV--VEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIIT 191
           G++GGA  MNAG    E    V  VE+   D  G    +P   L + YR+  +    +IT
Sbjct: 137 GTLGGAVAMNAGTKIGEMKDVVSAVELATADGAG---FVPAASLGFAYRTCRLPAGAVIT 193

Query: 192 HVVLRGFP----ESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSG 247
            V L   P    ES+ I+ A        R   QP+   T GSTF NP G  A +L+E  G
Sbjct: 194 RVQLTLRPGDVAESERIMQAD----RDGRRRTQPLDRPTFGSTFTNPPGDFAGRLVEAVG 249

Query: 248 CRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
            +G   GGA  S++H NF+ N   AT  D+  L    R +V  + GI LE E++ +G+F
Sbjct: 250 LKGHRVGGATWSDVHANFVSNLGGATARDVLALMRLARTRVKQRFGISLETEVRLVGEF 308


>gi|332653511|ref|ZP_08419256.1| UDP-N-acetylmuramate dehydrogenase [Ruminococcaceae bacterium D16]
 gi|332518657|gb|EGJ48260.1| UDP-N-acetylmuramate dehydrogenase [Ruminococcaceae bacterium D16]
          Length = 307

 Score =  163 bits (412), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 99/281 (35%), Positives = 155/281 (55%), Gaps = 4/281 (1%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRGVV 84
           P+ + T FR GG   +M +P +   +   + L   + IP+ ++G GSN+LV D G++  V
Sbjct: 29  PMARHTTFRIGGPVPLMARPTNEEQVLACVRLARENQIPLVVLGNGSNLLVADEGVQAFV 88

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           L ++  G S +E     E+ VGA  +   LA+ A   G+ G  F  GIPG++GGA  MNA
Sbjct: 89  LDMT--GLSRLERTGEREITVGAGVTLARLASFAAGEGLTGLEFAGGIPGTLGGAVMMNA 146

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGFPESQN 203
           GA   E  Q V     +  +G    I  E+ ++ YR S  ++ + +I   VL   P  + 
Sbjct: 147 GAYGGEMVQVVRRTRCLTPEGAVKEIVGEEHEFSYRHSVFSQGEDVILSSVLELEPGQEE 206

Query: 204 IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHC 263
            I A +A +   R++ QP++  + GS FK P G+ A  LI++ G +G   GGA++SE H 
Sbjct: 207 NIRAQMAELAQKRKSKQPLEYPSAGSMFKRPQGYFAAALIDQCGLKGFTVGGAQVSEKHA 266

Query: 264 NFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            F+IN   AT  D+  L  +V+++V  Q+G+ LE E++RLG
Sbjct: 267 GFVINRGGATCADVLALVREVQRRVREQTGVELEMEVRRLG 307


>gi|91776619|ref|YP_546375.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacillus
           flagellatus KT]
 gi|91710606|gb|ABE50534.1| UDP-N-acetylmuramate dehydrogenase [Methylobacillus flagellatus KT]
          Length = 294

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 104/290 (35%), Positives = 147/290 (50%), Gaps = 7/290 (2%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDA 78
           G+     PL + T +RTGG A+ ++ P  +  L+ FL+ LP   P+  +GLGSN+LVRD 
Sbjct: 5   GRLLHREPLARYTSWRTGGVADQLYIPASMEGLQQFLSGLPDAEPLHFIGLGSNLLVRDG 64

Query: 79  GIRGVVLRLSNA--GFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           G+RG V+ +  A  G    + R + E   G  C+   LA  A R    G  F  GIPG++
Sbjct: 65  GVRGTVILMHGALTGLRVDQGRIYAE--AGVTCA--KLARFAARQHQHGAEFMAGIPGTV 120

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVL 195
           GGA  MNAG +  ET + V  V  IDR G  H    +     YR  E+   D        
Sbjct: 121 GGALAMNAGCHGGETWEIVDRVLTIDRVGKLHERNHQAFATAYRHVEMPVADEWFVAAWF 180

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           R          + I  +   R   QP+     GS F+NP G  A +LIE SG +G   GG
Sbjct: 181 RLADGDAEEAESKIKQLLAMRLATQPLNLPNAGSVFRNPPGDHAARLIEASGLKGYRIGG 240

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           A++SE H NF++N  +AT  D+E L   V+  V  Q G+ L+ E++ +G+
Sbjct: 241 AQVSEKHANFIVNQGDATARDIEQLILHVQAVVKQQQGVDLQPEVRVIGE 290


>gi|325109141|ref|YP_004270209.1| UDP-N-acetylmuramate dehydrogenase [Planctomyces brasiliensis DSM
           5305]
 gi|324969409|gb|ADY60187.1| UDP-N-acetylmuramate dehydrogenase [Planctomyces brasiliensis DSM
           5305]
          Length = 294

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 92/278 (33%), Positives = 152/278 (54%), Gaps = 7/278 (2%)

Query: 27  LKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRGVVL 85
           L   TW + GG A+   +P+ + +L   +     SDIP+ ++G GSN+L+RD G+ G VL
Sbjct: 17  LAPYTWLKLGGPAQYFIEPRSVEELCEVVKCCQESDIPLHVLGDGSNLLIRDEGVSGAVL 76

Query: 86  RLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAG 145
           RLS   F+++ +    E+  GA  +   + + A+  G+ G     GIPG+IGGA   NAG
Sbjct: 77  RLSAGDFADVSIEG-TEVKAGAGAALSHVISRAVAAGLTGLEDLAGIPGTIGGAIVGNAG 135

Query: 146 ANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL--RGFPESQN 203
             + E    V  +  I  +G    IP + + +QYR S I   ++++  +   +G P   N
Sbjct: 136 GRSGELGSKVTSIDVITHRGEVETIPADLINFQYRGSHIDAPVVLSATLQLEQGDP---N 192

Query: 204 IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHC 263
            I+  +      ++  QP+  ++ G  FKNP G SA  LIE++G +G   G  ++S++H 
Sbjct: 193 EITRRLRKTWIMKKASQPLSSQSAGCIFKNPRGLSAGALIEQAGLKGTRIGDCEVSDVHA 252

Query: 264 NFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           NF+I  +N T  D+  L + V+ KV +++G+ LE E+K
Sbjct: 253 NFIITHENTTSDDILRLIDLVQSKVEDENGVELELEVK 290


>gi|239826337|ref|YP_002948961.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus sp.
           WCH70]
 gi|239806630|gb|ACS23695.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus sp.
           WCH70]
          Length = 310

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 102/290 (35%), Positives = 160/290 (55%), Gaps = 11/290 (3%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIRGVV 84
           PLK  T  + GG A+ +  P     +   + L     +P T++G GSN++VRD GIRG+V
Sbjct: 25  PLKYHTLVKIGGKADFLVWPTTYEQVMEVVRLKEKYQLPFTLLGNGSNVIVRDGGIRGIV 84

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           ++L +   + I+V    ++I  +    K+++  AL H + G  F  GIPGSIGGA  MNA
Sbjct: 85  MQLKH--LTEIKVEGE-KIIAQSGADIKAVSRFALEHSLTGLEFACGIPGSIGGAIMMNA 141

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK--DLIITHV--VLRGFPE 200
           GA   E    +  V  I + G   ++ ++ L+  YR+S I+K  D+++  V  + +G P+
Sbjct: 142 GAYGGEVKDVIDHVKVITQTGECKILKKDDLQLGYRTSIISKTHDIVLEAVFQLKKGDPQ 201

Query: 201 SQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISE 260
               I   + ++   RE+ QP++  + GS FK P G+ A +LI+ SG +G   GGA++S 
Sbjct: 202 K---IKEKMDDLTFQRESKQPLEYPSVGSVFKRPPGYFAGKLIQDSGLQGKGVGGAEVST 258

Query: 261 LHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQ 310
            H  F+IN +NAT  D     E VRK V  + G+ LE E+K +G+    Q
Sbjct: 259 KHAGFIINKNNATASDYIATIEMVRKTVKEKFGVDLELEVKIIGEDIKQQ 308


>gi|311029928|ref|ZP_07708018.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus sp. m3-13]
          Length = 302

 Score =  162 bits (411), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 100/303 (33%), Positives = 166/303 (54%), Gaps = 7/303 (2%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFL-TLLPSDIPI 64
           +  LL+E  ++  GK   N PL   T  + GG A+V+ +P+ +  L+  + T+    +  
Sbjct: 1   MEALLKELQEKEVGKVLPNEPLANHTTMKIGGPADVLVEPKSLEKLQETMETINKYKVKW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T +G GSN+LV D GI GVV++L N G  + E+    E+ VG   S   L     + G+ 
Sbjct: 61  TAIGRGSNLLVSDLGIEGVVIKLGN-GMDHFELEGD-EVHVGGGYSLIKLVTIISKKGLT 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA+  + S+ + + H +   G    +  ++L + YR+S +
Sbjct: 119 GLEFAGGIPGSVGGAVYMNAGAHGSDMSKVLKKAHILFEDGKMEWLTADELNFSYRTSLL 178

Query: 185 TKD---LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
            K+   + +  V++      + +++    N  + R+T QP      GS F+NP    A Q
Sbjct: 179 QKERPGICLEAVLIVEQGNREEVVAQLQKNKDYRRDT-QPFSYPCAGSIFRNPLPDYAGQ 237

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           LIEK+G +G + GGAK+S++H NF++N D A   D+  L E +++ +  +  + LE E++
Sbjct: 238 LIEKAGLKGHKIGGAKVSDMHANFIVNDDGAKAQDVLDLIEYIKETILEKYNVQLETEVE 297

Query: 302 RLG 304
            +G
Sbjct: 298 IIG 300


>gi|225175496|ref|ZP_03729490.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Dethiobacter
           alkaliphilus AHT 1]
 gi|225168825|gb|EEG77625.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Dethiobacter
           alkaliphilus AHT 1]
          Length = 298

 Score =  162 bits (411), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 104/301 (34%), Positives = 153/301 (50%), Gaps = 26/301 (8%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNIL 74
           ++ G  +   P+ + T F+ GG A++  +PQ   DL   L  L    IP+ ++G GSN+L
Sbjct: 11  EITGDVKTAEPMSKHTTFKIGGPADLFVEPQTTEDLIRSLEFLRGQSIPVFVMGNGSNLL 70

Query: 75  VRDAGIRGVVLRL------SNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHF 128
           V D+G RG V+RL      ++ G + ++         GA  S   LA  A   G+GG  F
Sbjct: 71  VSDSGYRGAVIRLAGEFLRTDYGPTTVDA--------GAAVSLPKLAREASARGLGGLEF 122

Query: 129 FYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL 188
             GIP +IGGA  MNAGA+ CE    + E   +D     H +  + L   YR S +    
Sbjct: 123 AAGIPATIGGALMMNAGAHGCEIGGVIAEAEILDTDLKVHTLRHKDLGLSYRRSNLAPGA 182

Query: 189 IITHVVLRGFP-ESQNIISAAIANVCHH----RETVQPIKEKTGGSTFKNPTGHSAWQLI 243
           ++  V L   P ES+ +++      CHH    R   QP +    GS FKNP   +A +LI
Sbjct: 183 VVCRVRLELEPGESEALLAK-----CHHNLQVRRERQP-RLPNAGSIFKNPPEDAAGRLI 236

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           + +G +G   GGA ISE+H NF++N  NAT  D+  L    +  V  Q G+ L+ E++ L
Sbjct: 237 DAAGLKGRRAGGAMISEVHANFIVNCGNATAEDVCTLINMAKTAVAEQFGMELKLEVRLL 296

Query: 304 G 304
           G
Sbjct: 297 G 297


>gi|226313547|ref|YP_002773441.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brevibacillus brevis
           NBRC 100599]
 gi|226096495|dbj|BAH44937.1| probable UDP-N-acetylenolpyruvoylglucosamine reductase
           [Brevibacillus brevis NBRC 100599]
          Length = 300

 Score =  162 bits (411), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 110/300 (36%), Positives = 157/300 (52%), Gaps = 10/300 (3%)

Query: 9   LLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIV 67
           LLRER  Q+   +QE  PL   T ++ GG A+++  P     L   L +L    +P  ++
Sbjct: 7   LLRER--QVEVTYQE--PLAAHTTWKVGGPADLLITPSSKSQLIMVLQILNEHHVPWMVM 62

Query: 68  GLGSNILVRDAGIRGVVLRLSNA-GFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGF 126
           G GSN+LV D G RG V++L+ A  ++ I V N  ++  GA  S   LA  A +H + G 
Sbjct: 63  GKGSNLLVTDKGYRGAVIKLNKALDYARI-VGN--QIYAGAGYSLIKLAALANKHRLSGL 119

Query: 127 HFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK 186
            F  GIPGS+GGA YMNAGAN  + S        I + G    +    L + YR S +  
Sbjct: 120 EFAGGIPGSVGGAVYMNAGANGSDISDIFHSAEVITQTGAIRSLRDVDLDFSYRHSSLQD 179

Query: 187 -DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEK 245
            + IIT  V          I          R   QP+     GS F+NP GH A +LIE 
Sbjct: 180 ANAIITEAVFELTMRDNESIKLQWNRYKEKRLQTQPLPFDCAGSVFRNPPGHFAAKLIED 239

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +G +G+ +GGA++S  H NF++N  NAT  D+  L  Q+++KV +QSGI L  E+  +G+
Sbjct: 240 AGLKGMRYGGAEVSSKHANFIMNTGNATALDVWTLMRQIQEKVHSQSGIYLVPEVVIVGE 299


>gi|116872853|ref|YP_849634.1| UDP-N-acetylenolpyruvylglucosamine reductase [Listeria welshimeri
           serovar 6b str. SLCC5334]
 gi|123466273|sp|A0AIM3|MURB_LISW6 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|116741731|emb|CAK20855.1| UDP-N-acetylenolpyruvylglucosamine reductase [Listeria welshimeri
           serovar 6b str. SLCC5334]
          Length = 297

 Score =  162 bits (411), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 101/284 (35%), Positives = 154/284 (54%), Gaps = 5/284 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTL-LPSDIPITIVGLGSNILVRDAGIRG 82
           N PL + T+ +TGGNA++   P+ I + +  ++    + IP+T++G GSN++++D GIRG
Sbjct: 16  NEPLSKYTYTKTGGNADIFVMPKSIEETQEIVSYCYQNTIPLTVLGNGSNLIIKDGGIRG 75

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           V++ L       IE R + ++I  +       A  AL   + G  F  GIPGSIGGA +M
Sbjct: 76  VIVHLDL--LQTIE-RKNTQIIAMSGAKLIDTAKFALGESLSGLEFACGIPGSIGGALHM 132

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLRGFPES 201
           NAGA   E S  +     +   G    + R +LK  YR S I  K+ I+         E 
Sbjct: 133 NAGAYGGEISDVLEAATVLTPYGELKKLKRSELKAAYRFSTIAEKNYIVLDATFSLELED 192

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
           +NII A +  +   RE+ QP++  + GS FK P GH A +LI+ SG +G   GGA++S  
Sbjct: 193 KNIIQAKMDELTAARESKQPLEYPSCGSVFKRPPGHFAGKLIQDSGLQGHIIGGAQVSLK 252

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           H  F++N  NAT  D   L   V++ V  +  + LE E+K +G+
Sbjct: 253 HAGFIVNIGNATATDYMNLIAHVQQTVREKFDVELETEVKIIGE 296


>gi|262276882|ref|ZP_06054675.1| UDP-N-acetylenolpyruvoylglucosamine reductase [alpha
           proteobacterium HIMB114]
 gi|262223985|gb|EEY74444.1| UDP-N-acetylenolpyruvoylglucosamine reductase [alpha
           proteobacterium HIMB114]
          Length = 287

 Score =  162 bits (411), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 105/284 (36%), Positives = 160/284 (56%), Gaps = 6/284 (2%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDAGIRGV 83
           N+ L + +WF  GG A   F P D+++L  ++    ++   +I G GSNIL RD G +  
Sbjct: 7   NYSLSKNSWFGLGGKANKFFTPDDVNELSNYIKKNTNEKYYSI-GSGSNILFRDKGCKET 65

Query: 84  VLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMN 143
           +++L  + F NI ++N+ ++  G+    K L+  AL + I  F F   IPG+IGG   MN
Sbjct: 66  IIKLGKS-FRNIYIKNN-KIFCGSAVLKKQLSKFALDNEIINFEFLSCIPGTIGGGVIMN 123

Query: 144 AGANNCETSQYVVEVHGIDRKGNQHV-IPREQLKYQYRSSEITKDLIITHVVLRGFPESQ 202
           AG    E    + EV G  +K  + V   ++++K+ YR +++  DLIIT VV +    S+
Sbjct: 124 AGCFQSEFKDIIDEVSGFSKKNLKFVRYKKKEIKFDYRKTDLPDDLIITEVVFQINYGSK 183

Query: 203 NIISAAIANVCHHRETVQPIKEKTGGSTFKNP-TGHSAWQLIEKSGCRGLEFGGAKISEL 261
             I   I      +E  QP K KTGGSTFKNP + + AW+LI+KSGC   +F   K S++
Sbjct: 184 EKIKNKIELFKKKKEAAQPSKIKTGGSTFKNPDSKNKAWELIKKSGCDRKKFSKVKFSKM 243

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           HCNF+ N  N++  D+E L      +V  +  I+LE EIK +G+
Sbjct: 244 HCNFIENDGNSSA-DIERLINFTIDEVKKKFNIILEPEIKIIGE 286


>gi|319891740|ref|YP_004148615.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           pseudintermedius HKU10-03]
 gi|317161436|gb|ADV04979.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           pseudintermedius HKU10-03]
          Length = 309

 Score =  162 bits (411), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 98/282 (34%), Positives = 148/282 (52%), Gaps = 5/282 (1%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTL-LPSDIPITIVGLGSNILVRDAGIRGVV 84
           PLK+ T+  TGGNA+    P+   D++  +      DIP+T +G GSNI++RD GIRG+V
Sbjct: 27  PLKRYTYTETGGNADFYISPERYEDVQKVVKYAYEHDIPVTYLGNGSNIIIRDGGIRGIV 86

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           L L +    N  V +   +I G+  +   ++  A    + G  F  GIPGSIGGA YMNA
Sbjct: 87  LSLLSL---NHIVTSDATIIAGSGAAIIDVSRKARDVSLTGLEFACGIPGSIGGAVYMNA 143

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFPESQN 203
           GA   E    +     ID +G    +   +L+  YR+S I +   ++        P  Q 
Sbjct: 144 GAYGGEVKDVIDYALVIDERGELLKLTHNELELDYRNSIIQQQHYVVLEAAFTLTPGKQE 203

Query: 204 IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHC 263
            I   + ++   RE+ QP++  + GS F+ P GH A QLI+ +  +G   GG ++S  H 
Sbjct: 204 DIQEKMDDLTERRESKQPLEYPSCGSVFRRPPGHFAGQLIQNADLQGHRIGGVEVSRKHA 263

Query: 264 NFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            FM+N D+ T  D E L   V+  V  + GI LE E++ +G+
Sbjct: 264 GFMVNVDHGTATDYENLIHHVQNVVKEKFGIELEREVRIIGE 305


>gi|301794431|emb|CBW36865.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae INV104]
          Length = 316

 Score =  162 bits (411), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 102/293 (34%), Positives = 151/293 (51%), Gaps = 17/293 (5%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDA 78
           +FQE  PL   ++ + GG A+ +  P++  +L   +      +IP  ++G  SNI+VRD 
Sbjct: 17  RFQE--PLHSYSYTKVGGEADYLVFPRNRFELARLVKFANQENIPWMVLGNASNIIVRDG 74

Query: 79  GIRGVVL---RLSNAGFS--NIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           GIRG V+   +L+N       IE      +I   R         ALRH + GF F  GIP
Sbjct: 75  GIRGFVILCDKLNNVSVDGYTIEAEAGANLIETTRI--------ALRHSLTGFEFACGIP 126

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITH 192
           GS+GGA +MNAGA   E +  +     + + G    +  + L + YR S I +   ++  
Sbjct: 127 GSVGGAVFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAKDLAFGYRHSAIQESGAVVLS 186

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
           V     P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G  
Sbjct: 187 VKFALAPGTHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGYR 246

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            GG ++SE H  FMIN  + T  D E L + V +KV   SGI LE E++ LG+
Sbjct: 247 IGGVEVSEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGITLEREVRILGE 299


>gi|229917749|ref|YP_002886395.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Exiguobacterium sp.
           AT1b]
 gi|229469178|gb|ACQ70950.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Exiguobacterium sp.
           AT1b]
          Length = 306

 Score =  162 bits (411), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 94/285 (32%), Positives = 155/285 (54%), Gaps = 5/285 (1%)

Query: 23  ENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIR 81
           ++ PL   T+ + GG A+    P    +++  L L   + +P  I+G GSN++VRD GIR
Sbjct: 18  QDEPLSAHTYTKLGGKADYFVAPHTYEEVQAVLQLAHQEAMPFMILGFGSNLIVRDGGIR 77

Query: 82  GVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAY 141
           G+VL L+     +I  R   +MI  A  +   ++  AL  G+ G  F  GIPG++GGA Y
Sbjct: 78  GIVLNLNE--LDSIR-REGNQMIAQAGAAIIDVSRQALAEGLSGLEFACGIPGTVGGAVY 134

Query: 142 MNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFPE 200
           MNAGA   ET   +     + + G    + +++L   YR+S ++K+ LI+        P+
Sbjct: 135 MNAGAYGGETKDVITSATVLTQDGQVLHLSKDELDLDYRTSRVSKEGLIVLEATFELEPK 194

Query: 201 SQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISE 260
           +  +I   + ++ + RE+ QP++  + GS FK P G+ A +LI+ SG +G   GGA++S 
Sbjct: 195 NYELIKEVMDDLTYKRESKQPLEYPSCGSVFKRPPGYFAGKLIQDSGLQGKRIGGAEVSL 254

Query: 261 LHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            H  F++N D AT  +   L   V+  V  +  + LE E+K +G+
Sbjct: 255 KHAGFIVNIDEATATEYISLIRHVQATVKEKFEVELEPEVKIIGE 299


>gi|331266111|ref|YP_004325741.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus oralis
           Uo5]
 gi|326682783|emb|CBZ00400.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus oralis
           Uo5]
          Length = 301

 Score =  162 bits (411), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 102/293 (34%), Positives = 152/293 (51%), Gaps = 17/293 (5%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDA 78
           +F+E  PLK  T+ + GG A+ +  P++ +++   +      +IP  ++G  SNI+VR+ 
Sbjct: 17  RFKE--PLKTYTYTKVGGRADYLVLPRNRYEMARVVQFANQENIPWMVLGNASNIIVREG 74

Query: 79  GIRGVVL---RLSNAGFS--NIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           GIRG V+   +L+N       IE      +I   R         ALRH + GF F  GIP
Sbjct: 75  GIRGFVILCDKLNNVSVDGYTIEAEAGANLIETTRI--------ALRHSLTGFEFACGIP 126

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITH 192
           GSIGGA +MNAGA   E +  +     + ++G    +  + L + YR S I     I+  
Sbjct: 127 GSIGGAVFMNAGAYGGEIAHILQSCQVLTKEGEIETLSVKDLAFGYRHSAIQDSGAIVLS 186

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
                 P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G  
Sbjct: 187 AKFALAPGNHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGYR 246

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            GG ++SE H  FMIN  + T  D E L E V +KV   SG+ LE E++ LG+
Sbjct: 247 IGGVEVSEKHAGFMINVADGTARDYEDLIESVIEKVKEHSGVTLEREVRILGE 299


>gi|148265983|ref|YP_001232689.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacter
           uraniireducens Rf4]
 gi|187609721|sp|A5G8J8|MURB_GEOUR RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|146399483|gb|ABQ28116.1| UDP-N-acetylmuramate dehydrogenase [Geobacter uraniireducens Rf4]
          Length = 300

 Score =  162 bits (411), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 100/289 (34%), Positives = 147/289 (50%), Gaps = 4/289 (1%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLT-LLPSDIPITIVGLGSNILV 75
           LRG+ + N P+ + T  + GG A+    P D  DL+  +  +L   +P  +VG G N+LV
Sbjct: 13  LRGELRFNEPMARHTALKVGGPADFFAIPADPSDLQSLMAVILEMGMPYLVVGGGYNLLV 72

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD G RGVV+ L    F ++E      +   A  + + L   A   G+ G  F  GIPG 
Sbjct: 73  RDGGFRGVVISLKQ--FCSMEKLPDNRLRAEAGSTNQQLVRFANGQGLTGLEFLSGIPGM 130

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           +GGA  +NAGA+     + V  +  + + G   V  RE L+Y YR  E+    I+   V 
Sbjct: 131 VGGALSVNAGAHGRSVLELVESLTTL-QGGKITVTFREDLRYGYRHLELKPGEIVLAAVF 189

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
                    I   I     HR   Q +     GS FKNP G  AW+LI+++G RG + GG
Sbjct: 190 SLAAGDAEEIEGRIQGYLEHRRNSQRVGYPNAGSFFKNPEGKQAWRLIDEAGLRGCQIGG 249

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           A++SE+H NF++N   A   D   L + ++ KV  +SGI LE E++ +G
Sbjct: 250 AQVSEVHTNFLVNRGGAMAADFLQLAQVIKSKVRERSGIDLEEEVRIVG 298


>gi|281491658|ref|YP_003353638.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactococcus lactis
           subsp. lactis KF147]
 gi|281375376|gb|ADA64889.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactococcus lactis
           subsp. lactis KF147]
          Length = 299

 Score =  162 bits (411), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 102/289 (35%), Positives = 155/289 (53%), Gaps = 9/289 (3%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDA 78
           KF E  PL + T+ + GG A+++  P  I  L   L    S D  +T++G  SN++VRD 
Sbjct: 16  KFNE--PLSKYTYTKVGGPADILAFPATIEALTELLVKAKSTDTAVTVLGNASNLIVRDG 73

Query: 79  GIRGVVLRLSNAGFSNIEVRNHC-EMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
           GIRG+V+ L      +++V  +  E   GA+   K +   A  + + GF F  GIPGSIG
Sbjct: 74  GIRGLVILLEK--LESVKVAGYTLEAQAGAKL--KEVTQVAQANSLTGFEFACGIPGSIG 129

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLR 196
           GA +MNAGA   E SQ +V    +D  GN  V+   ++++ YR S I  K+L++      
Sbjct: 130 GAVFMNAGAYGGEISQVLVSCKVMDTDGNISVLTASEMQFGYRHSVIRDKNLVVLSAKFE 189

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
                   I   +  +   RE+ QP++  + GS FK P GH A QLI+++  +G+  GG 
Sbjct: 190 LQAGDPTQIQNEMNRLNFLRESKQPLEYPSCGSVFKRPVGHFAGQLIQEANLQGVRIGGV 249

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           ++S+ H  FM+N  N    D E L  +V  KV   SG+ LE E++ +G+
Sbjct: 250 EVSKKHAGFMVNVANGNATDYEKLIARVIDKVKENSGVTLEPEVRIIGE 298


>gi|149011628|ref|ZP_01832824.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP19-BS75]
 gi|147764059|gb|EDK70991.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP19-BS75]
 gi|332074970|gb|EGI85442.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae GA41301]
          Length = 295

 Score =  162 bits (411), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 102/293 (34%), Positives = 151/293 (51%), Gaps = 17/293 (5%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDA 78
           +FQE  PL   ++ + GG A+ +  P++  +L   +      +IP  ++G  SNI+VRD 
Sbjct: 11  RFQE--PLHSYSYTKVGGEADYLVFPRNRFELARLVKFANQENIPWMVLGNASNIIVRDG 68

Query: 79  GIRGVVL---RLSNAGFS--NIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           GIRG V+   +L+N       IE      +I   R         ALRH + GF F  GIP
Sbjct: 69  GIRGFVILCDKLNNVSVDGYTIEAEAGANLIETTRI--------ALRHSLTGFEFACGIP 120

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITH 192
           GS+GGA +MNAGA   E +  +     + + G    +  + L + YR S I +   ++  
Sbjct: 121 GSVGGAVFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAKDLAFGYRHSAIQESGAVVLS 180

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
           V     P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G  
Sbjct: 181 VKFALAPGTHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGYR 240

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            GG ++SE H  FMIN  + T  D E L + V +KV   SGI LE E++ LG+
Sbjct: 241 IGGVEVSEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGITLEREVRILGE 293


>gi|282882198|ref|ZP_06290837.1| UDP-N-acetylmuramate dehydrogenase [Peptoniphilus lacrimalis 315-B]
 gi|300814226|ref|ZP_07094502.1| UDP-N-acetylmuramate dehydrogenase [Peptoniphilus sp. oral taxon
           836 str. F0141]
 gi|281297963|gb|EFA90420.1| UDP-N-acetylmuramate dehydrogenase [Peptoniphilus lacrimalis 315-B]
 gi|300511650|gb|EFK38874.1| UDP-N-acetylmuramate dehydrogenase [Peptoniphilus sp. oral taxon
           836 str. F0141]
          Length = 295

 Score =  162 bits (411), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 99/291 (34%), Positives = 161/291 (55%), Gaps = 10/291 (3%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRD 77
           G+F EN P+K  T F+ GG  E+  +P+D   L   L ++  ++    I+G  +N++V+D
Sbjct: 10  GEFLENEPMKNHTSFKVGGPCELFVRPKDEKSLIEILKIIRKNNYNFYILGNATNVIVKD 69

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G +G+++ + N    +++V +  ++  GA  S K L+ +A  + + G  F  GIPG++G
Sbjct: 70  QGYKGIIISIKNR-LKDVKV-DGLKITAGAGLSLKELSQTAYENSLSGLEFANGIPGTVG 127

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLII---THV 193
           GA  MNAGA + E    V  V  ID  GN      E++ + YR S++  ++LI+   T V
Sbjct: 128 GAMTMNAGAYDGEMKNVVESVRFIDNLGNIREYSNEEMDFSYRHSKVGDENLIVLSATFV 187

Query: 194 VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEF 253
           + +G  E    I          R+  QP+   + GSTFK P G+ A +LI+ SG RG   
Sbjct: 188 LEKGDKEK---IREKFQEFDRRRKEKQPLDLPSAGSTFKRPEGYFAGKLIDDSGLRGFRH 244

Query: 254 GGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            GA +S+ HC F++N DNA+  D+    E V+K V+++  + LE E+K +G
Sbjct: 245 NGAGVSQKHCGFVVNYDNASASDVLETIEIVQKVVYDKFSVKLEREVKIIG 295


>gi|282916080|ref|ZP_06323843.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus D139]
 gi|283769901|ref|ZP_06342793.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus H19]
 gi|282320028|gb|EFB50375.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus D139]
 gi|283460048|gb|EFC07138.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus H19]
          Length = 307

 Score =  162 bits (411), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 97/288 (33%), Positives = 159/288 (55%), Gaps = 5/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTL-LPSDIPITIVGLGSNILVRDA 78
           K + + PLK+ T+ +TGGNA+    P    +++  +     ++IP+T +G GSNI++R+ 
Sbjct: 18  KIKVDEPLKRYTYTKTGGNADFYITPTKNEEVQAVVKYAYQNEIPVTYLGNGSNIIIREG 77

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIRG+V+ L     ++IEV +   +I G+  +   ++  A  + + G  F  GIPGSIGG
Sbjct: 78  GIRGIVISL--LSLNHIEVSDDA-IIAGSGAAIIDVSRVARDYALTGLEFACGIPGSIGG 134

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRG 197
           A YMNAGA   E    +     ++ +G+   +  ++L+  YR+S I K+ L++       
Sbjct: 135 AVYMNAGAYGGEVKDCIDYALCVNEQGSLIKLTTKELELDYRNSIIQKEHLVVLEAAFTL 194

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P     I A + ++   RE+ QP++  + GS F+ P GH A +LI+ S  +G   GG +
Sbjct: 195 APGKMTEIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHFAGKLIQDSNLQGHRIGGVE 254

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S  H  FM+N DN T  D E L   V+K V  + GI L  E++ +G+
Sbjct: 255 VSTKHAGFMVNVDNGTATDYENLIHYVQKTVKEKFGIELNREVRIIGE 302


>gi|254520587|ref|ZP_05132643.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium sp.
           7_2_43FAA]
 gi|226914336|gb|EEH99537.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium sp.
           7_2_43FAA]
          Length = 306

 Score =  162 bits (411), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 99/286 (34%), Positives = 160/286 (55%), Gaps = 15/286 (5%)

Query: 27  LKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRGVVL 85
           +K    FR GG A+++  P++   +   + +    +IP  +VG GSN+LV+D GI GVV+
Sbjct: 26  MKNYVHFRVGGPADILLIPENKEQIIRTIEICNEKNIPFYVVGNGSNLLVKDGGIEGVVI 85

Query: 86  RLSNAGFSNIEVRNHCEMIVGARCSG--KSLANSALRHGIGGFHFFYGIPGSIGGAAYMN 143
           +L++    NI V      IV A C    K ++N+AL+  + GF F  GIPG++GGA +MN
Sbjct: 86  KLNDV--KNINVYGD---IVEAECGAMLKDVSNAALKSSLTGFEFACGIPGTVGGAVFMN 140

Query: 144 AGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPESQN 203
           AGA N E +  +     ID +G    + +++L+  YRSS + K     ++VL    + QN
Sbjct: 141 AGAYNGEIANVIDSAEVIDNEGKILSLSKDELELGYRSSIVMKK---NYIVLSAKFKLQN 197

Query: 204 ----IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKIS 259
                I   + ++   RE+ QP++  + GSTFK P G+ A +LI+ +G +G   GGA +S
Sbjct: 198 GDEKEIKEVVDDLTCKRESKQPLEYPSAGSTFKRPEGYFAGKLIQDAGLKGYSIGGAAVS 257

Query: 260 ELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           E H  F+IN + AT  D+  L   ++ +V  Q  + L  E++ +G+
Sbjct: 258 EKHSGFVINKNGATAKDILDLIAYIQSEVKRQFDVELHPEVRIIGE 303


>gi|160931230|ref|ZP_02078632.1| hypothetical protein CLOLEP_00067 [Clostridium leptum DSM 753]
 gi|156869785|gb|EDO63157.1| hypothetical protein CLOLEP_00067 [Clostridium leptum DSM 753]
          Length = 308

 Score =  162 bits (410), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 99/296 (33%), Positives = 155/296 (52%), Gaps = 7/296 (2%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVG 68
           LR+ G Q+    QEN P+   T F+ GG A+V     D   L+  L L   +  P+ ++G
Sbjct: 17  LRQTGAQV----QENEPMSLHTSFQIGGPADVFATVSDERSLRGVLKLCKEAGAPVYVIG 72

Query: 69  LGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHF 128
            GS++L+ D G+RGVV+         + + N   ++ G   +   L   AL + + G  F
Sbjct: 73  NGSDLLIPDQGLRGVVVGF-GGDLCRLRLENETTIVCGPGATLAKLCKFALENSLTGLEF 131

Query: 129 FYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KD 187
            +GIPGS GGAAYMNAGA   E    +++   +D  GN        L + YR S  T + 
Sbjct: 132 AWGIPGSAGGAAYMNAGAYGGEMKDVLIKCRHLDENGNPGEFAGSALDFSYRHSAYTDQK 191

Query: 188 LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSG 247
           L+IT +  +      ++I A + +    R+  QP++  + GS FK P G+ A QLIE+ G
Sbjct: 192 LVITGLTFQLEKGDYSVIKAQMEDYLGRRKARQPLEYPSAGSVFKRPKGYFAGQLIEECG 251

Query: 248 CRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
            +G   GGA++SE H  F++N   AT  D++ L + +++ V  +  + LE EIK +
Sbjct: 252 LKGKTVGGAQVSEKHAGFIVNTGGATCKDVQSLVKMIQETVRREKQVELECEIKLM 307


>gi|323438910|gb|EGA96645.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus O11]
 gi|323441858|gb|EGA99498.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus O46]
          Length = 307

 Score =  162 bits (410), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 97/288 (33%), Positives = 160/288 (55%), Gaps = 5/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTL-LPSDIPITIVGLGSNILVRDA 78
           K + + PLK+ T+ +TGGNA+    P    +++  +     ++IP+T +G GSNI++R+ 
Sbjct: 18  KIKVDEPLKRYTYTKTGGNADFYITPTKNEEVQAVVKYAYQNEIPVTYLGNGSNIIIREG 77

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIRG+V+ L +    +IEV +   +I G+  +   ++  A  + + G  F  GIPGSIGG
Sbjct: 78  GIRGIVISLLS--LDHIEVSDDA-IIAGSGAAIIDVSRVARDYALTGLEFACGIPGSIGG 134

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRG 197
           A YMNAGA   E    +     ++ +G+   +  ++L+  YR+S I K+ L++       
Sbjct: 135 AVYMNAGAYGGEVKDCIDYALCVNEQGSLIKLTTKELELDYRNSIIQKEHLVVLEAAFTL 194

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P     I A + ++   RE+ QP++  + GS F+ P GH A +LI+ S  +G   GG +
Sbjct: 195 APGKLTEIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHFAGKLIQDSNLQGHRIGGVE 254

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S  H  FM+N DN T  D E L   V+K V ++ GI L  E++ +G+
Sbjct: 255 VSTKHAGFMVNVDNGTATDYENLIHYVQKTVKDKFGIELNREVRIIGE 302


>gi|255994073|ref|ZP_05427208.1| UDP-N-acetylmuramate dehydrogenase [Eubacterium saphenum ATCC
           49989]
 gi|255993741|gb|EEU03830.1| UDP-N-acetylmuramate dehydrogenase [Eubacterium saphenum ATCC
           49989]
          Length = 289

 Score =  162 bits (410), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 99/284 (34%), Positives = 155/284 (54%), Gaps = 4/284 (1%)

Query: 23  ENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIR 81
           EN  + +   ++ GG+A  +   ++I +L+  L +     +   I+G GSN+LVRD G  
Sbjct: 5   ENADMSRYCTYKAGGSARYLISVENIEELREALKMAKEKKLDSFILGRGSNVLVRDGGYD 64

Query: 82  GVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAY 141
           G+++RLS   F+ IE   +  +  GA  +   ++  A   G+ G  F +GIPGSIGGA +
Sbjct: 65  GIIIRLSGE-FTLIESTQNV-ITAGAAATNVEVSVLARDEGLSGIEFLHGIPGSIGGAVF 122

Query: 142 MNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE-ITKDLIITHVVLRGFPE 200
           MNAGA   E   YV EV  +D   N    P + + + YR +E +    II  V LR  P 
Sbjct: 123 MNAGAYGSEICDYVDEVTFMDEDYNVVAKPSKDIDFGYRHTEFMDGGGIIISVKLRLTPS 182

Query: 201 SQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISE 260
           S + +++ +  + + R + QP+   + GS FK P G  A +LIE +G +G   GGA++S 
Sbjct: 183 SADAVASKMDTLLNKRTSKQPMNYPSCGSVFKRPLGGYAAKLIEDAGLKGASIGGAEVST 242

Query: 261 LHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            H  F+IN   AT  D+  L + V+K+V   SGI L+ E++ +G
Sbjct: 243 KHSGFIINKGEATANDITDLIKLVQKRVKKNSGIDLKTEVRIIG 286


>gi|188585619|ref|YP_001917164.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Natranaerobius
           thermophilus JW/NM-WN-LF]
 gi|179350306|gb|ACB84576.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Natranaerobius
           thermophilus JW/NM-WN-LF]
          Length = 300

 Score =  162 bits (410), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 100/279 (35%), Positives = 152/279 (54%), Gaps = 5/279 (1%)

Query: 27  LKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRGVVL 85
           L   T F+ GG AE+   P +I +++  L L+   ++P  ++G  SN+L+ D G+ G+V+
Sbjct: 25  LAPYTTFKIGGPAELFVTPSNIEEVQAVLNLVNQEELPYFVLGNASNVLIDDNGLSGIVI 84

Query: 86  RLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAG 145
            L    F +I+V    E+   +  S   L+  AL+HG+ G  F  GIPG++GG  YMNAG
Sbjct: 85  YLGET-FKDIQVEG-TEITAQSGVSLNKLSRMALKHGLTGLEFAEGIPGTLGGGLYMNAG 142

Query: 146 ANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLRGFPESQNI 204
           A   + S  V +V  I     Q+   RE + + YRSS    ++ II    L       + 
Sbjct: 143 AFGGQLSNVVKQVTAIVDHQIQNYT-RESMDFGYRSSTFQNQNAIILQATLALQKGDFDQ 201

Query: 205 ISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCN 264
           I + + ++   R   QP+   + GS FK P G+ A +LIE SG +G+E GGAK+SE HC 
Sbjct: 202 IKSYMEDLKSRRTEKQPLNYPSAGSVFKRPEGYYAGKLIEDSGLKGVEIGGAKVSEKHCG 261

Query: 265 FMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           F+IN   AT  D++ L   ++K V  + G+ LE E+K L
Sbjct: 262 FIINTGTATSRDVKELVSYIQKTVKEKFGVTLERELKYL 300


>gi|21282429|ref|NP_645517.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus MW2]
 gi|49485610|ref|YP_042831.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus MSSA476]
 gi|82750442|ref|YP_416183.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus RF122]
 gi|87161900|ref|YP_493425.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus USA300_FPR3757]
 gi|88194516|ref|YP_499311.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus NCTC 8325]
 gi|151220919|ref|YP_001331741.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus str. Newman]
 gi|161509005|ref|YP_001574664.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus USA300_TCH1516]
 gi|221140823|ref|ZP_03565316.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus str. JKD6009]
 gi|253731366|ref|ZP_04865531.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_TCH959]
 gi|253732814|ref|ZP_04866979.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus TCH130]
 gi|258452946|ref|ZP_05700940.1| UDP-N-acetylenolpyruvylglucosamine reductase [Staphylococcus aureus
           A5948]
 gi|262049522|ref|ZP_06022392.1| hypothetical protein SAD30_0944 [Staphylococcus aureus D30]
 gi|262052338|ref|ZP_06024541.1| hypothetical protein SA930_1064 [Staphylococcus aureus 930918-3]
 gi|282922035|ref|ZP_06329732.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A9765]
 gi|284023759|ref|ZP_06378157.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus 132]
 gi|294850524|ref|ZP_06791252.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A9754]
 gi|297208535|ref|ZP_06924964.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus ATCC 51811]
 gi|300912627|ref|ZP_07130070.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus TCH70]
 gi|304381643|ref|ZP_07364292.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus ATCC BAA-39]
 gi|47606433|sp|P61431|MURB_STAAU RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|47606434|sp|P61432|MURB_STAAW RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|56749208|sp|Q6GB92|MURB_STAAS RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|122540001|sp|Q2G069|MURB_STAA8 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|123486787|sp|Q2FIQ3|MURB_STAA3 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|123547697|sp|Q2YSJ1|MURB_STAAB RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|172048792|sp|A6QF47|MURB_STAAE RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|189028930|sp|A8Z012|MURB_STAAT RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|15419942|gb|AAK97215.1|AF300988_1 UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus]
 gi|21203866|dbj|BAB94565.1| MW0700 [Staphylococcus aureus subsp. aureus MW2]
 gi|28201238|dbj|BAC56587.1| UDP-N-acetylenolpyruvylglucosamine reductase [Staphylococcus
           aureus]
 gi|49244053|emb|CAG42479.1| putative UDP-N-acetylenolpyruvoylglucosamine reductase
           [Staphylococcus aureus subsp. aureus MSSA476]
 gi|82655973|emb|CAI80378.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus RF122]
 gi|87127874|gb|ABD22388.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus USA300_FPR3757]
 gi|87202074|gb|ABD29884.1| UDP-N-acetylenolpyruvoylglucosamine reductase, putative
           [Staphylococcus aureus subsp. aureus NCTC 8325]
 gi|150373719|dbj|BAF66979.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus str. Newman]
 gi|160367814|gb|ABX28785.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|253724891|gb|EES93620.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_TCH959]
 gi|253729179|gb|EES97908.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus TCH130]
 gi|257859457|gb|EEV82311.1| UDP-N-acetylenolpyruvylglucosamine reductase [Staphylococcus aureus
           A5948]
 gi|259159778|gb|EEW44819.1| hypothetical protein SA930_1064 [Staphylococcus aureus 930918-3]
 gi|259162358|gb|EEW46930.1| hypothetical protein SAD30_0944 [Staphylococcus aureus D30]
 gi|269940315|emb|CBI48692.1| putative UDP-N-acetylenolpyruvoylglucosaminereductase
           [Staphylococcus aureus subsp. aureus TW20]
 gi|282593693|gb|EFB98685.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A9765]
 gi|294822603|gb|EFG39044.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A9754]
 gi|296886790|gb|EFH25694.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus ATCC 51811]
 gi|298694070|gb|ADI97292.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus ED133]
 gi|300886873|gb|EFK82075.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus TCH70]
 gi|302750634|gb|ADL64811.1| putative UDP-N-acetylenolpyruvoylglucosamine reductase
           [Staphylococcus aureus subsp. aureus str. JKD6008]
 gi|304339746|gb|EFM05691.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus ATCC BAA-39]
 gi|315196412|gb|EFU26763.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus CGS01]
 gi|320139929|gb|EFW31790.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus MRSA131]
 gi|320141980|gb|EFW33808.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus MRSA177]
 gi|329313459|gb|AEB87872.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus T0131]
 gi|329723775|gb|EGG60303.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus 21189]
 gi|329729649|gb|EGG66050.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus 21193]
          Length = 307

 Score =  162 bits (410), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 97/288 (33%), Positives = 159/288 (55%), Gaps = 5/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTL-LPSDIPITIVGLGSNILVRDA 78
           K + + PLK+ T+ +TGGNA+    P    +++  +     ++IP+T +G GSNI++R+ 
Sbjct: 18  KIKVDEPLKRYTYTKTGGNADFYITPTKNEEVQAVVKYAYQNEIPVTYLGNGSNIIIREG 77

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIRG+V+ L +    +IEV +   +I G+  +   ++  A  + + G  F  GIPGSIGG
Sbjct: 78  GIRGIVISLLS--LDHIEVSDDA-IIAGSGAAIIDVSRVARDYALTGLEFACGIPGSIGG 134

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRG 197
           A YMNAGA   E    +     ++ +G+   +  ++L+  YR+S I K+ L++       
Sbjct: 135 AVYMNAGAYGGEVKDCIDYALCVNEQGSLIKLTTKELELDYRNSIIQKEHLVVLEAAFTL 194

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P     I A + ++   RE+ QP++  + GS F+ P GH A +LI+ S  +G   GG +
Sbjct: 195 APGKMTEIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHFAGKLIQDSNLQGHRIGGVE 254

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S  H  FM+N DN T  D E L   V+K V  + GI L  E++ +G+
Sbjct: 255 VSTKHAGFMVNVDNGTATDYENLIHYVQKTVKEKFGIELNREVRIIGE 302


>gi|253997367|ref|YP_003049431.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylotenera
           mobilis JLW8]
 gi|253984046|gb|ACT48904.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylotenera
           mobilis JLW8]
          Length = 296

 Score =  162 bits (410), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 100/293 (34%), Positives = 146/293 (49%), Gaps = 5/293 (1%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
           QL+GK   N P+ + T +R GG A+  + P+ + DL  FL       P   +GLGSN+LV
Sbjct: 3   QLKGKLLLNEPMARYTSWRVGGRADQFYIPESLEDLSAFLRSQDEAEPTYFIGLGSNLLV 62

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMI-VGARCSGKSLANSALRHGIGGFHFFYGIPG 134
           RD GIRG V+ + N   + +++         G  C+   LA    +    G  FF GIPG
Sbjct: 63  RDGGIRGTVVLMHNV-LTTLQMDGDAVYAEAGVTCA--KLAKFCAKEAKQGAEFFAGIPG 119

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHV 193
           ++GGA  MNAG    ET   V  V  I++ G  +          YR  ++   D      
Sbjct: 120 TLGGALAMNAGCYGSETWNVVQRVTTINKSGELNTRDAAAFIPSYRHIDMPVADEWFIAA 179

Query: 194 VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEF 253
            LR         +  I  +   R   QP+ + + GSTF+NP G  A +LIE SG +G   
Sbjct: 180 WLRLAQGDAQESAQKIKTLLAKRLASQPLNQPSAGSTFRNPPGDFAARLIEASGLKGYII 239

Query: 254 GGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           GGA++SE H NF++N   A   D+E L + +R+ V  + G+ L+ E+K LG+ 
Sbjct: 240 GGAQVSEKHANFIVNIGGANALDIELLIQHMRETVLEKQGVALQQEVKVLGEL 292


>gi|220933051|ref|YP_002509959.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Halothermothrix
           orenii H 168]
 gi|219994361|gb|ACL70964.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Halothermothrix
           orenii H 168]
          Length = 304

 Score =  162 bits (410), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 108/298 (36%), Positives = 165/298 (55%), Gaps = 12/298 (4%)

Query: 15  KQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSN 72
           K++ G + ++  PLKQ T F+ GG AE+   P +I  LK  + +L  +++P  ++G GSN
Sbjct: 12  KEINGLEVKKGIPLKQYTSFKIGGPAELFLVPSNITALKKAVKILFNNNLPYFVLGRGSN 71

Query: 73  ILVRDAGIRGVVLRLSNAGFSNIE---VRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
           I+V D G  GVV+ L       +E   V + C + + AR +G+         G+ G  F 
Sbjct: 72  IIVSDKGYNGVVIYLGKLDKITVEETRVTSECGVTL-ARLAGR-----VAEAGLTGLEFA 125

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDL 188
            GIPGS+GGA YMNAGA   E    V EV  +D+ G +  I   +LK+ YR S +  K  
Sbjct: 126 SGIPGSLGGALYMNAGAYGGEMKDVVKEVVVVDKTGKEISIKAPELKFSYRHSVLQEKHY 185

Query: 189 IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGC 248
           I    VL     ++  I   +  +   R+  QP++  + GS FK P G+ A +LIE +G 
Sbjct: 186 IAVKAVLELKKGNREKIKTRMKELNEKRKQKQPLEWPSAGSAFKRPEGYYAGKLIEDAGL 245

Query: 249 RGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           +GL  G A++S  H  F+IN   AT  D+  L  ++++KV++++G+LLE E K +GDF
Sbjct: 246 KGLRVGDAQVSTKHAGFIINLGEATASDVRKLMNKIQQKVYDKNGVLLEPEPKFIGDF 303


>gi|212639655|ref|YP_002316175.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Anoxybacillus
           flavithermus WK1]
 gi|254764132|sp|B7GGI1|MURB_ANOFW RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|212561135|gb|ACJ34190.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Anoxybacillus
           flavithermus WK1]
          Length = 302

 Score =  162 bits (410), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 100/290 (34%), Positives = 159/290 (54%), Gaps = 7/290 (2%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRD 77
           G  +EN  +   T  + GG A++  +P+ I  LK  + ++   ++P   +G GSN+LVRD
Sbjct: 14  GTVKENERMASHTTIKIGGPADLFVEPKHIDGLKKTMEIVRKYNVPWRAIGRGSNLLVRD 73

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            GI GVV++L   G  ++ + +  E+ VG   S   LA    + G+ G  F  GIPG++G
Sbjct: 74  GGIEGVVIKLGE-GLDDLYIHD-TEVTVGGGYSLIKLATVISKQGLSGLEFAGGIPGTVG 131

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD---LIITHVV 194
           GA YMNAGA+  + S+ V +   +   G    +  E++++ YR+S + K    + I   +
Sbjct: 132 GAVYMNAGAHGSDMSRIVKKAQILFEDGTIEWLTNEEMEFSYRTSVLQKKRKGICIAATL 191

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
                    I++A   N  + RET QP      GS F+NP    A QLIE++G +G   G
Sbjct: 192 EMKKGNHDEIVAAMQKNKDYRRET-QPWNYPCAGSIFRNPLPQYAGQLIEQAGLKGYTIG 250

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           GAKISE H NF++NA  AT  D+  L + V+K +++  G+ L+ E++ +G
Sbjct: 251 GAKISEQHANFIVNAGGATANDVLELIDYVKKTIYDLYGVSLQTEVEIVG 300


>gi|225859156|ref|YP_002740666.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae 70585]
 gi|254765584|sp|C1C7Z0|MURB_STRP7 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|225721661|gb|ACO17515.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae 70585]
          Length = 301

 Score =  162 bits (410), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 102/293 (34%), Positives = 151/293 (51%), Gaps = 17/293 (5%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDA 78
           +FQE  PL   ++ + GG A+ +  P++  +L   +      +IP  ++G  SNI+VRD 
Sbjct: 17  RFQE--PLHSYSYTKVGGEADYLVFPRNRFELARVVKFANQENIPWMVLGNASNIIVRDG 74

Query: 79  GIRGVVL---RLSNAGFS--NIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           GIRG V+   +L+N       IE      +I   R         ALRH + GF F  GIP
Sbjct: 75  GIRGFVILCDKLNNVSVDGYTIEAEAGANLIETTRI--------ALRHSLTGFEFACGIP 126

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITH 192
           GS+GGA +MNAGA   E +  +     + + G    +  + L + YR S I +   ++  
Sbjct: 127 GSVGGAVFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAKDLAFGYRHSAIQESGAVVLS 186

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
           V     P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G  
Sbjct: 187 VKFALAPGTHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGYR 246

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            GG ++SE H  FMIN  + T  D E L + V +KV   SGI LE E++ LG+
Sbjct: 247 IGGVEVSEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGITLEREVRILGE 299


>gi|307243305|ref|ZP_07525472.1| UDP-N-acetylmuramate dehydrogenase [Peptostreptococcus stomatis DSM
           17678]
 gi|306493323|gb|EFM65309.1| UDP-N-acetylmuramate dehydrogenase [Peptostreptococcus stomatis DSM
           17678]
          Length = 306

 Score =  162 bits (410), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 103/309 (33%), Positives = 169/309 (54%), Gaps = 16/309 (5%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS- 60
           IY  +S+++ E+   +      + P+ + T F+ GG A+++ +P+   ++     L+   
Sbjct: 6   IYNLLSQIIDEKSIYI------DEPMNRHTSFKVGGPADILVRPRTEEEISNIFKLVNKL 59

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVR-NHCEMIVGARCS--GKSLANS 117
           + P  + G GSNIL++D G RG+V+ +S+  FSN E+R    E+  GA  S  G+++ N 
Sbjct: 60  ETPFLVKGNGSNILIKDGGFRGLVIEISD-NFSNFEIRGTEVEIQSGALLSVIGRAVMNE 118

Query: 118 ALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKY 177
           +L     GF F  GIPG++GGA  MNAGA   E    V  V  +D +G       E++ +
Sbjct: 119 SLT----GFEFASGIPGTLGGALAMNAGAYGGEMKNIVKTVRLMDEEGQVVEFSNEEMNF 174

Query: 178 QYRSSEITKD-LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTG 236
            YR S ++ +  I    V+      +  I A + ++   R T QP++  + GSTFK PTG
Sbjct: 175 GYRHSRLSDERWIAISAVISLEKGDKAEIKAKMEDLALQRRTKQPLEYPSAGSTFKRPTG 234

Query: 237 HSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILL 296
           + A +LI+ S  +G+  GGA++S  H  F+IN + A+  D+  L E V+  V+   G+ L
Sbjct: 235 YFAGKLIQDSDLKGVSVGGAQVSSKHSGFVINYNKASAKDIVDLIEHVKITVYECQGVHL 294

Query: 297 EWEIKRLGD 305
           E E+K LG+
Sbjct: 295 EEEVKILGE 303


>gi|15673144|ref|NP_267318.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactococcus lactis
           subsp. lactis Il1403]
 gi|13878596|sp|Q9CGD5|MURB_LACLA RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|12724126|gb|AAK05260.1|AE006348_5 UDP-N-acetylenolpyruvoylglucosamine reductase [Lactococcus lactis
           subsp. lactis Il1403]
          Length = 299

 Score =  162 bits (410), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 102/289 (35%), Positives = 154/289 (53%), Gaps = 9/289 (3%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDA 78
           KF E  PL + T+ + GG A+++  P  I  L   L    S D  +T++G  SN++VRD 
Sbjct: 16  KFNE--PLSKYTYTKVGGPADILAFPATIEALTELLVKAKSTDTAVTVLGNASNLIVRDG 73

Query: 79  GIRGVVLRLSNAGFSNIEVRNHC-EMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
           GIRG+V+ L      +++V  +  E   GA+   K +   A  + + GF F  GIPGSIG
Sbjct: 74  GIRGLVILLEK--LESVKVAGYTIEAQAGAKL--KEVTQVAQANSLTGFEFACGIPGSIG 129

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLR 196
           GA +MNAGA   E SQ +V    +D  GN  V+   ++++ YR S I  K+L++      
Sbjct: 130 GAVFMNAGAYGGEISQVLVSCKVMDTDGNISVLTASEMQFGYRHSVIRDKNLVVLSAKFE 189

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
                   I   +  +   RE+ QP++  + GS FK P GH A QLI+++  +G+  GG 
Sbjct: 190 LQAGDPTQIQNEMNRLNFLRESKQPLEYPSCGSVFKRPVGHFAGQLIQEANLQGVRIGGV 249

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           ++S+ H  FM+N  N    D E L   V  KV   SG+ LE E++ +G+
Sbjct: 250 EVSKKHAGFMVNVANGNATDYEKLIAHVIDKVKENSGVTLEPEVRIIGE 298


>gi|13787122|pdb|1HSK|A Chain A, Crystal Structure Of S. Aureus Murb
          Length = 326

 Score =  162 bits (410), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 97/288 (33%), Positives = 158/288 (54%), Gaps = 5/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTL-LPSDIPITIVGLGSNILVRDA 78
           K + + PLK+ T+ +TGGNA+    P    +++  +     ++IP+T +G GSNI++R+ 
Sbjct: 30  KIKVDEPLKRYTYTKTGGNADFYITPTKNEEVQAVVKYAYQNEIPVTYLGNGSNIIIREG 89

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIRG+V+ L      +IEV +   +I G+  +   ++  A  + + G  F  GIPGSIGG
Sbjct: 90  GIRGIVISL--LSLDHIEVSDDA-IIAGSGAAIIDVSRVARDYALTGLEFACGIPGSIGG 146

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRG 197
           A YMNAGA   E    +     ++ +G+   +  ++L+  YR+S I K+ L++       
Sbjct: 147 AVYMNAGAYGGEVKDCIDYALCVNEQGSLIKLTTKELELDYRNSIIQKEHLVVLEAAFTL 206

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P     I A + ++   RE+ QP++  + GS F+ P GH A +LI+ S  +G   GG +
Sbjct: 207 APGKMTEIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHFAGKLIQDSNLQGHRIGGVE 266

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S  H  FM+N DN T  D E L   V+K V  + GI L  E++ +G+
Sbjct: 267 VSTKHAGFMVNVDNGTATDYENLIHYVQKTVKEKFGIELNREVRIIGE 314


>gi|304316241|ref|YP_003851386.1| UDP-N-acetylenolpyruvoylglucosamine reductase
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302777743|gb|ADL68302.1| UDP-N-acetylenolpyruvoylglucosamine reductase
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 301

 Score =  162 bits (410), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 108/297 (36%), Positives = 168/297 (56%), Gaps = 23/297 (7%)

Query: 22  QENFPLKQI----TWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVR 76
           +EN  + ++    T FR GG AEV+  PQ+  +L   L ++ ++ IP  I+G G+N++V 
Sbjct: 14  EENIYINELMSRHTSFRIGGPAEVLVIPQNREELINVLDIIRNENIPYFILGNGTNVIVS 73

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIV---GARCSGKSLANSALRHGIGGFHFFYGIP 133
           D GIRGVV++L+     ++E     E IV   GA  S  ++AN+AL + + GF F  GIP
Sbjct: 74  DRGIRGVVIKLTAIRKISVE----GEYIVSETGALLS--AIANTALDNELTGFEFASGIP 127

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIIT-- 191
           G++GGA  MNAGA   E    + +V  ID  GN + I    +K+ YRSS I  D +I   
Sbjct: 128 GTLGGAVTMNAGAYGTEIKDVIEKVEVIDENGNIYEIKNGNMKFAYRSSAIQLDNLIALK 187

Query: 192 ---HVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGC 248
              H+    + +    I A +  +   R+  QP++  + GS FK P G+ A +LI+ +G 
Sbjct: 188 AWIHLKKGNYKD----IRAKMDELNGLRKKKQPLEYPSAGSVFKRPEGYYAGKLIQDAGL 243

Query: 249 RGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +G   GGA++SE HC F+IN  +AT  D+  L   ++K V ++ G+ L  E+K +G+
Sbjct: 244 QGYTIGGAQVSEKHCGFIINKGDATAEDVINLIRFIQKTVKDRFGVDLHTEVKIIGE 300


>gi|227810116|ref|ZP_03989029.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acidaminococcus sp.
           D21]
 gi|226904696|gb|EEH90614.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acidaminococcus sp.
           D21]
          Length = 299

 Score =  162 bits (409), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 100/288 (34%), Positives = 150/288 (52%), Gaps = 6/288 (2%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLT-LLPSDIPITIVGLGSNILVRDAGIRGVV 84
           P+K  T F  GG A++    ++   L+  L      D+P  I+G GSN+LVRD GIRG+V
Sbjct: 12  PMKDHTTFAIGGPADLFVTVREAKALQALLKKARDCDVPYLILGKGSNMLVRDGGIRGLV 71

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           + L   G    ++    E+  G       ++  A  HG+GG  F  GIPGS+GGA  MNA
Sbjct: 72  VHLDERG---AQLVTGYELRAGGGVPLSQVSQLAAAHGLGGLTFAIGIPGSLGGAVLMNA 128

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK--DLIITHVVLRGFPESQ 202
           GA   E S  + EV  +D   +        L Y YR S        +I   V+  + ++ 
Sbjct: 129 GAYGGEMSDVIKEVTFLDENLDFQTAKATDLSYSYRHSYFMDHPGCVIVEAVMELWAQAS 188

Query: 203 NIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELH 262
             I A +A+    R+  QP++  + GSTFK P G+    LI ++G  GL  GGA++S+ H
Sbjct: 189 CEIEAEMADFTKRRKEKQPLEYPSAGSTFKRPPGYYTGPLIRQAGLAGLVMGGAQVSKKH 248

Query: 263 CNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQ 310
             F+IN + AT  D+  L + ++ KV +Q G+LLE E++  G+  D +
Sbjct: 249 TGFVINREEATARDVLRLIKTIQYKVRSQYGVLLEPEVRIFGEDTDEK 296


>gi|153956162|ref|YP_001396927.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium kluyveri
           DSM 555]
 gi|219856487|ref|YP_002473609.1| hypothetical protein CKR_3144 [Clostridium kluyveri NBRC 12016]
 gi|189028921|sp|A5N360|MURB_CLOK5 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|254764169|sp|B9DWV2|MURB_CLOK1 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|146349020|gb|EDK35556.1| MurB [Clostridium kluyveri DSM 555]
 gi|219570211|dbj|BAH08195.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 304

 Score =  162 bits (409), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 103/285 (36%), Positives = 160/285 (56%), Gaps = 11/285 (3%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIRGVV 84
           P+K+ T F+ GG  +++  P+  + +   + L   + IP  I+G GSN+LV+D GIRGV+
Sbjct: 25  PMKEHTSFKVGGPVDILLTPKHFNQVVDVVKLCKKENIPYYIMGNGSNLLVKDGGIRGVM 84

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           ++L     + I+V+ + ++I  +  S K ++ +AL + + GF F  GIPGS+GGA  MNA
Sbjct: 85  IKL--VKLNKIQVKGN-KIITESGVSLKDISTTALENCLTGFEFACGIPGSVGGAVTMNA 141

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD----LIITHVVLRGFPE 200
           GA N E S  +     I   G   V+ RE+++  YR S I K+    L +T  + +G  E
Sbjct: 142 GAYNGEISNVIESAKVICNSGEIIVLNREEMELGYRMSSILKNGYTILEVTFNLEKGNKE 201

Query: 201 SQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISE 260
           +   I   I ++   R   QP++  + GSTFK P GH A +LIE SG +G   G A++SE
Sbjct: 202 N---IMNRIEDLSRRRNEKQPLEYASAGSTFKRPQGHFAAKLIEDSGLKGESVGDAQVSE 258

Query: 261 LHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            H  F+IN  NAT  D+  L   V+ +V     I L  E++ +G+
Sbjct: 259 KHSGFIINKGNATAKDILTLISIVQDRVRQNFDIDLYTEVRIIGE 303


>gi|332200832|gb|EGJ14904.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae GA41317]
 gi|332203219|gb|EGJ17287.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae GA47901]
          Length = 295

 Score =  162 bits (409), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 102/293 (34%), Positives = 151/293 (51%), Gaps = 17/293 (5%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDA 78
           +FQE  PL   ++ + GG A+ +  P++  +L   +      +IP  ++G  SNI+VRD 
Sbjct: 11  RFQE--PLHSYSYTKVGGEADYLVFPRNRFELARVVKFANQENIPWMVLGNASNIIVRDG 68

Query: 79  GIRGVVL---RLSNAGFS--NIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           GIRG V+   +L+N       IE      +I   R         ALRH + GF F  GIP
Sbjct: 69  GIRGFVILCDKLNNVSVDGYTIEAEAGANLIETTRI--------ALRHSLTGFEFACGIP 120

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITH 192
           GS+GGA +MNAGA   E +  +     + + G    +  + L + YR S I +   ++  
Sbjct: 121 GSVGGAVFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAKDLAFGYRHSAIQESGAVVLS 180

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
           V     P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G  
Sbjct: 181 VKFALAPGTHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGYR 240

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            GG ++SE H  FMIN  + T  D E L + V +KV   SGI LE E++ LG+
Sbjct: 241 IGGVEVSEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGITLEREVRILGE 293


>gi|148997557|ref|ZP_01825162.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP11-BS70]
 gi|168575850|ref|ZP_02721765.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae MLV-016]
 gi|307068043|ref|YP_003877009.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus pneumoniae AP200]
 gi|147756612|gb|EDK63653.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP11-BS70]
 gi|183578214|gb|EDT98742.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae MLV-016]
 gi|306409580|gb|ADM85007.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus pneumoniae AP200]
          Length = 316

 Score =  162 bits (409), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 102/293 (34%), Positives = 151/293 (51%), Gaps = 17/293 (5%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDA 78
           +FQE  PL   ++ + GG A+ +  P++  +L   +      +IP  ++G  SNI+VRD 
Sbjct: 17  RFQE--PLHSYSYTKVGGEADYLVFPRNRFELARVVKFANQENIPWMVLGNASNIIVRDG 74

Query: 79  GIRGVVL---RLSNAGFS--NIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           GIRG V+   +L+N       IE      +I   R         ALRH + GF F  GIP
Sbjct: 75  GIRGFVILCDKLNNVSVDGYTIEAEAGANLIETTRI--------ALRHSLTGFEFACGIP 126

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITH 192
           GS+GGA +MNAGA   E +  +     + + G    +  + L + YR S I +   ++  
Sbjct: 127 GSVGGAVFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAKDLAFGYRHSAIQESGAVVLS 186

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
           V     P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G  
Sbjct: 187 VKFALAPGTHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGYR 246

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            GG ++SE H  FMIN  + T  D E L + V +KV   SGI LE E++ LG+
Sbjct: 247 IGGVEVSEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGITLEREVRILGE 299


>gi|270292480|ref|ZP_06198691.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sp. M143]
 gi|270278459|gb|EFA24305.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sp. M143]
          Length = 301

 Score =  162 bits (409), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 104/301 (34%), Positives = 156/301 (51%), Gaps = 20/301 (6%)

Query: 15  KQLRG---KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLG 70
           +QL G   +F+E  PLK  T+ + GG A+ +  P++ +++   +      +IP  ++G  
Sbjct: 9   EQLEGIDIRFKE--PLKTYTYTKVGGRADYLVLPRNRYEMARVVQFANQENIPWMVLGNA 66

Query: 71  SNILVRDAGIRGVVL---RLSNAGFS--NIEVRNHCEMIVGARCSGKSLANSALRHGIGG 125
           SNI+VR+ GIRG V+   +L+N       IE      +I   R         ALRH + G
Sbjct: 67  SNIIVREGGIRGFVILCDKLNNVSVDGYTIEAEAGANLIETTRI--------ALRHSLTG 118

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT 185
           F F  GIPGSIGGA +MNAGA   E +  +     + ++G    +  + L + YR S I 
Sbjct: 119 FEFACGIPGSIGGAVFMNAGAYGGEIAHILQSCQILTKEGEIETLSAKDLAFGYRHSAIQ 178

Query: 186 KD-LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIE 244
               ++        P +  II   +  + H RE  QP++  + GS FK P GH A QLI 
Sbjct: 179 DSGAVVLSAKFALAPGNHQIIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLIS 238

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           ++G +G   GG ++SE H  FMIN  + T  D E L + V +KV   SG+ LE E++ LG
Sbjct: 239 EAGLKGYRIGGVEVSEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGVTLEREVRILG 298

Query: 305 D 305
           +
Sbjct: 299 E 299


>gi|121535180|ref|ZP_01666996.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermosinus
           carboxydivorans Nor1]
 gi|121306289|gb|EAX47215.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermosinus
           carboxydivorans Nor1]
          Length = 308

 Score =  162 bits (409), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 102/290 (35%), Positives = 159/290 (54%), Gaps = 8/290 (2%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDA 78
           + + + P+ Q T F  GG A+  F P    ++   L L     +P+T++G GSN+LV D 
Sbjct: 22  RVRTDEPMSQHTTFHIGGPADFFFVPASTGEVAAALALAAKFGLPVTVLGNGSNVLVLDK 81

Query: 79  GIRGVVLRLS-NAGFSNIEVRNHCEMI-VGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           GIRG+V++   + G+    +R+   +I  GA  S   ++  A R G+ G  F  GIPGSI
Sbjct: 82  GIRGLVIKFDEHMGY----IRHTGALIYAGAGASLGDVSRYAARQGLTGMEFAVGIPGSI 137

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVL 195
           GGA +MNAGA   E    V  V  +   G      + ++ + YR S   ++  +I  V L
Sbjct: 138 GGAVFMNAGAYGGEMGNVVAAVTAVCPDGTLKRFTKAEIDFGYRHSVFQENKCVICEVEL 197

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
              P S   IS+ +A   + RE  QP++  + GSTFK P G+ A  LIE++G +GL  GG
Sbjct: 198 ALKPGSPAEISSKMAEYTNRREAKQPVEMPSAGSTFKRPPGYYAGTLIEQTGLKGLRIGG 257

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           A++SE H  F+INA  AT  D+  L  +V+++V  +  + L+ E++ +G+
Sbjct: 258 AQVSEKHAGFIINAGGATAQDVLALIREVQRRVQEKFDVRLQPEVRIIGE 307


>gi|46907648|ref|YP_014037.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes serotype 4b str. F2365]
 gi|47092710|ref|ZP_00230496.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes str. 4b H7858]
 gi|226224021|ref|YP_002758128.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes Clip81459]
 gi|254824520|ref|ZP_05229521.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes FSL J1-194]
 gi|254852536|ref|ZP_05241884.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes FSL R2-503]
 gi|254932605|ref|ZP_05265964.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes HPB2262]
 gi|255521341|ref|ZP_05388578.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes FSL J1-175]
 gi|300765773|ref|ZP_07075749.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes FSL N1-017]
 gi|67460880|sp|Q71ZQ0|MURB_LISMF RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|259509759|sp|C1L2X6|MURB_LISMC RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|46880916|gb|AAT04214.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes serotype 4b str. F2365]
 gi|47018898|gb|EAL09645.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes str. 4b H7858]
 gi|225876483|emb|CAS05192.1| Putative UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes serotype 4b str. CLIP 80459]
 gi|258605845|gb|EEW18453.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes FSL R2-503]
 gi|293584164|gb|EFF96196.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes HPB2262]
 gi|293593759|gb|EFG01520.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes FSL J1-194]
 gi|300513548|gb|EFK40619.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes FSL N1-017]
 gi|332311861|gb|EGJ24956.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes str. Scott A]
          Length = 298

 Score =  162 bits (409), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 102/284 (35%), Positives = 152/284 (53%), Gaps = 5/284 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRG 82
           N PL + T+ +TGG A+V   P+ I + +  +     + IP+TI+G GSN++++D GIRG
Sbjct: 16  NEPLSKYTYTKTGGAADVFVMPKTIEETQEVVAYCHQNKIPLTILGNGSNLIIKDGGIRG 75

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           V+L L       IE RN+ ++I  +       A  AL   + G  F  GIPGSIGGA +M
Sbjct: 76  VILHLDL--LQTIE-RNNTQIIAMSGAKLIDTAKFALDESLSGLEFACGIPGSIGGALHM 132

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLRGFPES 201
           NAGA   E S  +     + + G    + R +LK  YR S I  K+ I+         E 
Sbjct: 133 NAGAYGGEISDVLEAATVLTQTGELKKLKRSELKAAYRFSTIAEKNYIVLDATFSLALEE 192

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
           +N+I A +  +   RE  QP++  + GS FK P GH A +LI+ SG +G   GGA++S  
Sbjct: 193 KNLIQAKMDELTAAREAKQPLEYPSCGSVFKRPPGHFAGKLIQDSGLQGHIIGGAQVSLK 252

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           H  F++N   AT  D   L   V++ V  +  + LE E+K +G+
Sbjct: 253 HAGFIVNIGGATATDYMNLIAYVQQTVREKFDVELETEVKIIGE 296


>gi|290894089|ref|ZP_06557062.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes FSL J2-071]
 gi|290556344|gb|EFD89885.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes FSL J2-071]
          Length = 298

 Score =  162 bits (409), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 102/284 (35%), Positives = 152/284 (53%), Gaps = 5/284 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRG 82
           N PL + T+ +TGG A+V   P+ I + +  +     + IP+TI+G GSN++++D GIRG
Sbjct: 16  NEPLSKYTYTKTGGEADVFVMPKTIEEAQEVVAYCHQNKIPLTILGNGSNLIIKDGGIRG 75

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           V+L L       IE RN+ ++I  +       A  AL   + G  F  GIPGSIGGA +M
Sbjct: 76  VILHLDL--LQTIE-RNNTQIIAMSGAKLIDTAKFALDESLSGLEFACGIPGSIGGALHM 132

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLRGFPES 201
           NAGA   E S  +     + + G    + R +LK  YR S I  K+ I+         E 
Sbjct: 133 NAGAYGGEISDVLEAATVLTQTGELKKLKRSELKAAYRFSTIAEKNYIVLDATFSLALEE 192

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
           +++I A +  +   RE  QP++  + GS FK P GH A +LI+ SG +G   GGA++S  
Sbjct: 193 KSLIQAKMDELTAAREAKQPLEYPSCGSVFKRPPGHFAGKLIQDSGLQGHIIGGAQVSLK 252

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           H  F++N   AT  D   L   V+K V  +  + LE E+K +G+
Sbjct: 253 HAGFIVNIGGATATDYMNLIAYVQKTVREKFDVELETEVKIIGE 296


>gi|258423387|ref|ZP_05686278.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A9635]
 gi|257846448|gb|EEV70471.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A9635]
 gi|302332447|gb|ADL22640.1| putative UDP-N-acetylenolpyruvoylglucosamine reductase
           [Staphylococcus aureus subsp. aureus JKD6159]
          Length = 307

 Score =  162 bits (409), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 97/288 (33%), Positives = 159/288 (55%), Gaps = 5/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTL-LPSDIPITIVGLGSNILVRDA 78
           K + + PLK+ T+ +TGGNA+    P    +++  +     ++IP+T +G GSNI++R+ 
Sbjct: 18  KIKVDEPLKRYTYTKTGGNADFYITPTKNEEVQAVVKYAYQNEIPVTYLGNGSNIIIREG 77

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIRG+V+ L +    +IEV +   +I G+  +   ++  A  + + G  F  GIPGSIGG
Sbjct: 78  GIRGIVISLLS--LDHIEVSDDA-IIAGSGAAIIDVSRVARDYALTGLEFACGIPGSIGG 134

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRG 197
           A YMNAGA   E    +     ++ +G+   +  ++L+  YR+S I K+ L++       
Sbjct: 135 AVYMNAGAYGGEVKDCIDYALCVNEQGSLIKLTTKELELDYRNSIIQKEHLVVLEAAFTL 194

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P     I A + ++   RE+ QP++  + GS F+ P GH A +LI+ S  +G   GG +
Sbjct: 195 APGKLTEIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHFAGKLIQDSNLQGHRIGGVE 254

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S  H  FM+N DN T  D E L   V+K V  + GI L  E++ +G+
Sbjct: 255 VSTKHAGFMVNVDNGTATDYENLIHYVQKTVKEKFGIELNREVRIIGE 302


>gi|227500118|ref|ZP_03930189.1| UDP-N-acetylmuramate dehydrogenase [Anaerococcus tetradius ATCC
           35098]
 gi|227217833|gb|EEI83130.1| UDP-N-acetylmuramate dehydrogenase [Anaerococcus tetradius ATCC
           35098]
          Length = 300

 Score =  161 bits (408), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 100/284 (35%), Positives = 153/284 (53%), Gaps = 10/284 (3%)

Query: 28  KQITWFRTGGNAEVMFQPQDIHDLKYFLTL-LPSDIPITIVGLGSNILVRDAGIRGVVLR 86
           K  T F  GG A+++ +P +   LK  L +    +I  T++G GSN+L+ D GIRG V+ 
Sbjct: 22  KDYTTFGIGGKADILIKPNNEEQLKNILKINHRENIKTTVIGRGSNLLISDKGIRGCVIV 81

Query: 87  LSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL---RHGIGGFHFFYGIPGSIGGAAYMN 143
           LS + +  I++    E  +    +G SL  +AL     G+ G     GIPGSIGGA  MN
Sbjct: 82  LS-SNYDEIKL----EGDILTAYAGTSLNEAALFAIDKGLAGMEEISGIPGSIGGAVAMN 136

Query: 144 AGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLRGFPESQ 202
           AGA   E     V V   D  G ++    +Q+ + YR S+I  ++LI++    +    ++
Sbjct: 137 AGAYGGEIKDICVNVKAFDFSGKEYNFTNDQMNFSYRHSKIFEENLIVSQASFKLRAGNK 196

Query: 203 NIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELH 262
             I     +  H R + QP+  K+ GSTFK P G  A +LI++ G RG + G  ++SE H
Sbjct: 197 EEIRERYEDFTHRRVSKQPLDRKSAGSTFKRPQGSYASKLIDECGLRGYKKGDCQVSEKH 256

Query: 263 CNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           C F+IN D AT  D+    ++V   V  ++G +LE E+K +G+F
Sbjct: 257 CGFIINVDKATCKDMLSFIKEVSGIVNEKTGFILEREVKLIGEF 300


>gi|283470031|emb|CAQ49242.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus ST398]
          Length = 307

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 97/288 (33%), Positives = 158/288 (54%), Gaps = 5/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTL-LPSDIPITIVGLGSNILVRDA 78
           K + + PLK+ T+ +TGGNA+    P    +++  +     ++IP+T +G GSNI++R+ 
Sbjct: 18  KIKVDEPLKRYTYTKTGGNADFYITPTKNEEVQAVVKYAYQNEIPVTYLGNGSNIIIREG 77

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIRG+V+ L +    +IEV +   +I G+  +   ++  A  + + G  F  GIPGSIGG
Sbjct: 78  GIRGIVISLLS--LDHIEVSDDA-IIAGSGAAIIDVSRVARDYALTGLEFACGIPGSIGG 134

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRG 197
           A YMNAGA   E    +     ++ +G+      ++L+  YR+S I K+ L++       
Sbjct: 135 AVYMNAGAYGGEVKDCIDYALCVNEQGSLIKFTTKELELDYRNSIIQKEHLVVLEAAFTL 194

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P     I A + ++   RE+ QP++  + GS F+ P GH A +LI+ S  +G   GG +
Sbjct: 195 APGKMTEIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHFAGKLIQDSNLQGHRIGGVE 254

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S  H  FM+N DN T  D E L   V+K V  + GI L  E++ +G+
Sbjct: 255 VSTKHAGFMVNVDNGTATDYENLIHYVQKTVKEKFGIELNREVRIIGE 302


>gi|49482995|ref|YP_040219.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus MRSA252]
 gi|257424858|ref|ZP_05601285.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus 55/2053]
 gi|257427526|ref|ZP_05603925.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus 65-1322]
 gi|257430157|ref|ZP_05606541.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus 68-397]
 gi|257432858|ref|ZP_05609218.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus E1410]
 gi|257435762|ref|ZP_05611810.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus M876]
 gi|282903368|ref|ZP_06311259.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus C160]
 gi|282905148|ref|ZP_06313005.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus Btn1260]
 gi|282908124|ref|ZP_06315955.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus WW2703/97]
 gi|282910383|ref|ZP_06318187.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus WBG10049]
 gi|282913578|ref|ZP_06321367.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus M899]
 gi|282918531|ref|ZP_06326268.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus C427]
 gi|282923497|ref|ZP_06331177.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus C101]
 gi|283957570|ref|ZP_06375023.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus A017934/97]
 gi|293500623|ref|ZP_06666474.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus 58-424]
 gi|293509571|ref|ZP_06668282.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus M809]
 gi|293524157|ref|ZP_06670844.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus M1015]
 gi|295427315|ref|ZP_06819950.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus EMRSA16]
 gi|297590332|ref|ZP_06948971.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus MN8]
 gi|56749243|sp|Q6GIQ3|MURB_STAAR RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|49241124|emb|CAG39802.1| putative UDP-N-acetylenolpyruvoylglucosamine reductase
           [Staphylococcus aureus subsp. aureus MRSA252]
 gi|257272428|gb|EEV04551.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus 55/2053]
 gi|257275719|gb|EEV07192.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus 65-1322]
 gi|257279354|gb|EEV09955.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus 68-397]
 gi|257282273|gb|EEV12408.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus E1410]
 gi|257284953|gb|EEV15072.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus M876]
 gi|282314365|gb|EFB44755.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus C101]
 gi|282317665|gb|EFB48037.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus C427]
 gi|282322610|gb|EFB52932.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus M899]
 gi|282325775|gb|EFB56083.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus WBG10049]
 gi|282327789|gb|EFB58071.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus WW2703/97]
 gi|282331555|gb|EFB61067.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus Btn1260]
 gi|282596323|gb|EFC01284.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus C160]
 gi|283791021|gb|EFC29836.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus A017934/97]
 gi|290921120|gb|EFD98181.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus M1015]
 gi|291095628|gb|EFE25889.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus 58-424]
 gi|291467668|gb|EFF10183.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus M809]
 gi|295128703|gb|EFG58334.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus EMRSA16]
 gi|297576631|gb|EFH95346.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus MN8]
 gi|312438837|gb|ADQ77908.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus TCH60]
 gi|315194357|gb|EFU24749.1| putative UDP-N-acetylenolpyruvoylglucosamine reductase
           [Staphylococcus aureus subsp. aureus CGS00]
          Length = 307

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 97/288 (33%), Positives = 159/288 (55%), Gaps = 5/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTL-LPSDIPITIVGLGSNILVRDA 78
           K + + PLK+ T+ +TGGNA+    P    +++  +     ++IP+T +G GSNI++R+ 
Sbjct: 18  KIKVDEPLKRYTYTKTGGNADFYITPTKNVEVQAVVKYAYQNEIPVTYLGNGSNIIIREG 77

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIRG+V+ L +    +IEV +   +I G+  +   ++  A  + + G  F  GIPGSIGG
Sbjct: 78  GIRGIVISLLS--LDHIEVSDDA-IIAGSGAAIIDVSRVARDYALTGLEFACGIPGSIGG 134

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRG 197
           A YMNAGA   E    +     ++ +G+   +  ++L+  YR+S I K+ L++       
Sbjct: 135 AVYMNAGAYGGEVKDCIDYALCVNEQGSLVKLTTKELELDYRNSIIQKEHLVVLEAAFTL 194

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P     I A + ++   RE+ QP++  + GS F+ P GH A +LI+ S  +G   GG +
Sbjct: 195 APGKMTEIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHFAGKLIQDSNLQGHRIGGVE 254

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S  H  FM+N DN T  D E L   V+K V  + GI L  E++ +G+
Sbjct: 255 VSTKHAGFMVNVDNGTATDYENLIHYVQKTVKEKFGIELNREVRIIGE 302


>gi|308069879|ref|YP_003871484.1| UDP-N-acetylenolpyruvoylglucosamine reductase (UDP-N-acetylmuramate
           dehydrogenase) [Paenibacillus polymyxa E681]
 gi|305859158|gb|ADM70946.1| UDP-N-acetylenolpyruvoylglucosamine reductase (UDP-N-acetylmuramate
           dehydrogenase) [Paenibacillus polymyxa E681]
          Length = 301

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 102/289 (35%), Positives = 153/289 (52%), Gaps = 4/289 (1%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRD 77
           GK  E+ PL + T +R GG A+ +  P     L   L L     IP   +G GSN+LV D
Sbjct: 14  GKVLEHEPLFKYTTWRIGGPADALVIPDTKEQLARVLKLASEHGIPWMQLGRGSNMLVSD 73

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            GIRG+V++L   GF  +  ++  +++ G   S   L   A + G+ G  F  GIPGS+G
Sbjct: 74  KGIRGLVIKL-GPGFDYVHFKDE-QIVAGGGVSLVKLCVMASKQGLSGLEFAGGIPGSVG 131

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL-IITHVVLR 196
           GA YMNAGA+  + SQ       +   G   V   E + + YR S + +   ++T  V R
Sbjct: 132 GAVYMNAGAHGSDVSQIFQSAEIVLDTGELAVYDAENMHFSYRHSVLHEQRGMVTEAVFR 191

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
                +  ISAA+A     R   QP++    GS F+NP G  A +LIE +G +GL+ GGA
Sbjct: 192 MKRGDREEISAALAAFKDRRRLTQPLQLACAGSVFRNPPGDYAARLIESAGLKGLKAGGA 251

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           ++S  H NF++N   AT  D+  L + ++  + +Q+GI L  E+  +G+
Sbjct: 252 EVSVQHANFIVNTGQATAEDVLTLMKHIQSTISSQTGIKLVPEVFVVGE 300


>gi|317129297|ref|YP_004095579.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           cellulosilyticus DSM 2522]
 gi|315474245|gb|ADU30848.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           cellulosilyticus DSM 2522]
          Length = 301

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 100/302 (33%), Positives = 164/302 (54%), Gaps = 9/302 (2%)

Query: 8   RLLRERGKQLR-GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLT-LLPSDIPIT 65
           +LL+E+ + L+ GK   N PLK+ T ++ GG A +  +P  +  L+  +  +   +IP  
Sbjct: 2   QLLKEKLEALQVGKILINEPLKKHTTWKIGGPASIFIEPSSVEALQIAIEEIKKQEIPWF 61

Query: 66  IVGLGSNILVRDAGIRGVVLRLSN--AGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           ++G GSN+LV D GI GVV++L    A F   + R    + VGA  S   L+    + G 
Sbjct: 62  VIGRGSNLLVSDEGITGVVIKLGEDLAKFQQKDDR----IKVGAGYSLIKLSTMMSKKGY 117

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            G  F  GIPGS+GGA +MNAGA+  + S  +++ H +   G    +  +++ + YR+S 
Sbjct: 118 SGLEFASGIPGSVGGAVFMNAGAHGSDISNILIKAHVLFSDGTFKWLENKEMDFSYRTSR 177

Query: 184 ITKDLIITHVVLRGFPE-SQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
           +  D  I         E  +  I+A +     +R   QP      GS F+NP  H A +L
Sbjct: 178 LQSDEAICVEAEFQLKEGDKKEITAEMQKNKDYRRDTQPWNYPCCGSVFRNPLPHHAGKL 237

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IE++G +G   GGA+ISE+H NF++N  +AT  D+  L +  +  ++N+ G+ +E E++ 
Sbjct: 238 IEEAGLKGYSIGGAQISEMHANFIVNKGDATANDVLELIQFAKNTIYNKFGVKMETEVEL 297

Query: 303 LG 304
           +G
Sbjct: 298 VG 299


>gi|16803460|ref|NP_464945.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes EGD-e]
 gi|224501638|ref|ZP_03669945.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes FSL R2-561]
 gi|254829821|ref|ZP_05234476.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes 10403S]
 gi|284801806|ref|YP_003413671.1| hypothetical protein LM5578_1561 [Listeria monocytogenes 08-5578]
 gi|284994948|ref|YP_003416716.1| hypothetical protein LM5923_1513 [Listeria monocytogenes 08-5923]
 gi|29336839|sp|Q8Y776|MURB_LISMO RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|16410849|emb|CAC99498.1| lmo1420 [Listeria monocytogenes EGD-e]
 gi|284057368|gb|ADB68309.1| hypothetical protein LM5578_1561 [Listeria monocytogenes 08-5578]
 gi|284060415|gb|ADB71354.1| hypothetical protein LM5923_1513 [Listeria monocytogenes 08-5923]
          Length = 298

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 101/284 (35%), Positives = 152/284 (53%), Gaps = 5/284 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRG 82
           N PL + T+ +TGG A+V   P+ I + +  +     + IP+TI+G GSN++++D GIRG
Sbjct: 16  NEPLSKYTYTKTGGAADVFVMPKTIEEAQEVVAYCHQNKIPLTILGNGSNLIIKDGGIRG 75

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           V+L L       IE RN+ +++  +       A  AL   + G  F  GIPGSIGGA +M
Sbjct: 76  VILHLDL--LQTIE-RNNTQIVAMSGAKLIDTAKFALNESLSGLEFACGIPGSIGGALHM 132

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLRGFPES 201
           NAGA   E S  +     + + G    + R +LK  YR S I  K+ I+         E 
Sbjct: 133 NAGAYGGEISDVLEAATVLTQTGELKKLKRSELKAAYRFSTIAEKNYIVLDATFSLALEE 192

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
           +N+I A +  +   RE  QP++  + GS FK P GH A +LI+ SG +G   GGA++S  
Sbjct: 193 KNLIQAKMDELTAAREAKQPLEYPSCGSVFKRPPGHFAGKLIQDSGLQGHIIGGAQVSLK 252

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           H  F++N   AT  D   L   V++ V  +  + LE E+K +G+
Sbjct: 253 HAGFIVNIGGATATDYMNLIAYVQQTVREKFDVELETEVKIIGE 296


>gi|289551402|ref|YP_003472306.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           lugdunensis HKU09-01]
 gi|315658909|ref|ZP_07911776.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus lugdunensis
           M23590]
 gi|289180933|gb|ADC88178.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           lugdunensis HKU09-01]
 gi|315496033|gb|EFU84361.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus lugdunensis
           M23590]
          Length = 307

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 95/287 (33%), Positives = 155/287 (54%), Gaps = 5/287 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIRG 82
           N PLK  T+ +TGGNA+    P    +++  +      DIP+T +G GSNI++R+ GIRG
Sbjct: 22  NEPLKHYTYTKTGGNADFYLSPTKNEEVQAIVRYARQHDIPVTYLGNGSNIIIREGGIRG 81

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           +V+ L     ++I V +   +I G+  +   ++ +A  H + G  F  GIPGSIGGA YM
Sbjct: 82  IVISL--LSLNHIAVSDDA-IIAGSGAAIIDVSKAARDHALTGLEFACGIPGSIGGAVYM 138

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFPES 201
           NAGA   E    +     ++ +G+      ++L+  YR+S + +  L++        P  
Sbjct: 139 NAGAYGGEVKDCIDYALCVNEQGDLLKFTNQELELDYRNSIVQQQHLVVLEAAFTLAPGQ 198

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
            + I A + ++   RE+ QP++  + GS F+ P GH A +LI+ S  +G   GG ++S+ 
Sbjct: 199 LDDIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHFAGKLIQDSNLQGHRIGGVEVSKK 258

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFD 308
           H  FM+N DN T  D E L   V++ V  +  + L  E++ +GD  D
Sbjct: 259 HAGFMVNVDNGTATDYENLIHHVQQVVKEKFDVELHREVRIIGDPPD 305


>gi|210618611|ref|ZP_03291968.1| hypothetical protein CLONEX_04201 [Clostridium nexile DSM 1787]
 gi|210148918|gb|EEA79927.1| hypothetical protein CLONEX_04201 [Clostridium nexile DSM 1787]
          Length = 289

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 101/269 (37%), Positives = 148/269 (55%), Gaps = 12/269 (4%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIRGVV 84
           P+K+ T FR GGNA+    P+   +++  + L   + +P  I+G GSN+LV D G  GV+
Sbjct: 23  PMKKHTTFRVGGNADYFVVPKTEKEVERIVGLCKEEGMPYYILGNGSNLLVGDKGYHGVI 82

Query: 85  LRLSNAGFSNIEVR-NHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMN 143
           +++     + I V  N   +  GA  S   + N AL  G+ GF F  GIPG++GGA +MN
Sbjct: 83  IQICKE-MNEISVEDNFLNVQAGALLS--RVGNVALEAGLAGFEFASGIPGTMGGAVFMN 139

Query: 144 AGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPE--- 200
           AGA   E    + EV  +D      V+ +E+L+  YR+S + K     +VVL    E   
Sbjct: 140 AGAYGGEMKDILTEVTVLDENNEVRVLKKEELELGYRTSIVAKK---GYVVLSAKVELKK 196

Query: 201 -SQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKIS 259
             Q  I   +  +   R T QP++  + GSTFK P G+ A +LI  +G RG + GGA++S
Sbjct: 197 GDQTKIRERMNELKVQRTTKQPLEYPSAGSTFKRPEGYFAGKLIADAGLRGFQVGGAQVS 256

Query: 260 ELHCNFMINADNATGYDLEYLGEQVRKKV 288
           E HC F+IN DNAT  D+  L  QV ++V
Sbjct: 257 EKHCGFVINKDNATAADIIELMRQVIERV 285


>gi|52080125|ref|YP_078916.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           licheniformis ATCC 14580]
 gi|52785499|ref|YP_091328.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           licheniformis ATCC 14580]
 gi|319646100|ref|ZP_08000330.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus sp.
           BT1B_CT2]
 gi|81385636|sp|Q65JX9|MURB_BACLD RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|52003336|gb|AAU23278.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           licheniformis ATCC 14580]
 gi|52348001|gb|AAU40635.1| MurB [Bacillus licheniformis ATCC 14580]
 gi|317391850|gb|EFV72647.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus sp.
           BT1B_CT2]
          Length = 303

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 99/303 (32%), Positives = 168/303 (55%), Gaps = 5/303 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           + ++++E  +   GK  EN PL   T  + GG A+V+  P+DI  +K  + ++    +  
Sbjct: 1   MDKVIQELKELEVGKVLENEPLSNHTTIKIGGPADVLVIPKDIQAVKDTMKVVKKHGVKW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T +G GSN+LV D GIRGVV++L   G  ++E+    ++ VG   S   LA    + G+ 
Sbjct: 61  TAIGRGSNLLVLDEGIRGVVIKLGQ-GLDHMEIDGE-QVTVGGGYSVVRLATGISKKGLS 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA+  + S+ +V+   +   G    +  E++ + YR+S +
Sbjct: 119 GLEFAAGIPGSVGGAVYMNAGAHGSDISKVLVKALILFEDGTIEWLTNEEMAFSYRTSIL 178

Query: 185 --TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
              +  I    VL+   + ++ I A +     +R+  QP+     GS F+NP    A +L
Sbjct: 179 QNKRPGICLEAVLQLEQKERDQIVAQMQKNKDYRKETQPVSNPCAGSIFRNPLPEHAGRL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           +E++G +G + GGAK+SE+H NF++NA  AT  D+  L   ++K +  +  I +  E++ 
Sbjct: 239 VEEAGLKGHQIGGAKVSEMHGNFIVNAGGATAKDVLDLIAFIQKTIKEKYDIDMHTEVEI 298

Query: 303 LGD 305
           +G+
Sbjct: 299 IGE 301


>gi|15923728|ref|NP_371262.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus Mu50]
 gi|15926415|ref|NP_373948.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus N315]
 gi|148267198|ref|YP_001246141.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus JH9]
 gi|150393247|ref|YP_001315922.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus JH1]
 gi|156979066|ref|YP_001441325.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus Mu3]
 gi|253315829|ref|ZP_04839042.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus str. CF-Marseille]
 gi|255005529|ref|ZP_05144130.2| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus Mu50-omega]
 gi|257794941|ref|ZP_05643920.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A9781]
 gi|258418257|ref|ZP_05682522.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A9763]
 gi|258421554|ref|ZP_05684479.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A9719]
 gi|258430749|ref|ZP_05688461.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus A9299]
 gi|258441759|ref|ZP_05691031.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus A8115]
 gi|258445800|ref|ZP_05693977.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A6300]
 gi|258449611|ref|ZP_05697713.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A6224]
 gi|258454011|ref|ZP_05701983.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus A5937]
 gi|269202358|ref|YP_003281627.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus ED98]
 gi|282894507|ref|ZP_06302736.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A8117]
 gi|282926604|ref|ZP_06334234.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A10102]
 gi|295406460|ref|ZP_06816266.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A8819]
 gi|297245186|ref|ZP_06929060.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A8796]
 gi|54037852|sp|P65463|MURB_STAAN RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|54041502|sp|P65462|MURB_STAAM RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|166222851|sp|A7WZM9|MURB_STAA1 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|189028928|sp|A6TZL7|MURB_STAA2 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|189028929|sp|A5IQU2|MURB_STAA9 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|13700629|dbj|BAB41926.1| SA0693 [Staphylococcus aureus subsp. aureus N315]
 gi|14246507|dbj|BAB56900.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus Mu50]
 gi|147740267|gb|ABQ48565.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus JH9]
 gi|149945699|gb|ABR51635.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus JH1]
 gi|156721201|dbj|BAF77618.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu3]
 gi|257788913|gb|EEV27253.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A9781]
 gi|257839050|gb|EEV63529.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A9763]
 gi|257842480|gb|EEV66904.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A9719]
 gi|257849421|gb|EEV73391.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus A9299]
 gi|257852228|gb|EEV76155.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus A8115]
 gi|257855376|gb|EEV78314.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A6300]
 gi|257857119|gb|EEV80018.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A6224]
 gi|257863876|gb|EEV86632.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus A5937]
 gi|262074648|gb|ACY10621.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus ED98]
 gi|282591497|gb|EFB96569.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A10102]
 gi|282763220|gb|EFC03351.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A8117]
 gi|285816440|gb|ADC36927.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus 04-02981]
 gi|294968605|gb|EFG44628.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A8819]
 gi|297177857|gb|EFH37106.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A8796]
 gi|312829230|emb|CBX34072.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus ECT-R 2]
 gi|315129421|gb|EFT85414.1| hypothetical protein CGSSa03_00430 [Staphylococcus aureus subsp.
           aureus CGS03]
 gi|329724631|gb|EGG61138.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus 21172]
          Length = 307

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 159/288 (55%), Gaps = 5/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTL-LPSDIPITIVGLGSNILVRDA 78
           K + + PLK+ T+ +TGGNA+    P    +++  +     ++IP+T +G GSNI++R+ 
Sbjct: 18  KIKVDEPLKRYTYTKTGGNADFYITPTKNEEVQAVVKYAYQNEIPVTYLGNGSNIIIREG 77

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIRG+V+ L +    +I+V +   +I G+  +   ++  A  + + G  F  GIPGSIGG
Sbjct: 78  GIRGIVISLLS--LDHIDVSDDA-IIAGSGAAIIDVSRVARDYALTGLEFACGIPGSIGG 134

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRG 197
           A YMNAGA   E    +     ++ +G+   +  ++L+  YR+S I K+ L++       
Sbjct: 135 AVYMNAGAYGGEVKDCIDYALCVNEQGSLIKLTTKELELDYRNSIIQKEHLVVLEAAFTL 194

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P     I A + ++   RE+ QP++  + GS F+ P GH A +LI+ S  +G   GG +
Sbjct: 195 APGKMTEIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHFAGKLIQDSNLQGHRIGGVE 254

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S  H  FM+N DN T  D E L   V+K V  + GI L  E++ +G+
Sbjct: 255 VSTKHAGFMVNVDNGTATDYENLIHYVQKTVKEKFGIELNREVRIIGE 302


>gi|258593034|emb|CBE69345.1| UDP-N-acetylenolpyruvoylglucosamine reductase (MurB-like) [NC10
           bacterium 'Dutch sediment']
          Length = 308

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 102/299 (34%), Positives = 162/299 (54%), Gaps = 6/299 (2%)

Query: 10  LRERGKQL-RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIV 67
           L+ER + L +G+     PL   T+FR GG AEVM  P  + D+K  L +   + IP+ I+
Sbjct: 9   LQERLQGLIKGRVLTEEPLASHTYFRIGGPAEVMVYPAGLEDVKALLKVAREETIPVLIL 68

Query: 68  GLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARC-SGKSLANSALRHGIGGF 126
           G GSN+LV D G++G+V+ LS   F  +EV    +M  GA   + + LA SA R  + G 
Sbjct: 69  GSGSNMLVLDGGVKGLVMNLSQT-FLELEVSGE-QMRCGAGVRTSRLLALSATRS-LTGL 125

Query: 127 HFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK 186
               G+PG++GGA   NAG +    + ++  +  +D  G +  + R ++   YR   +  
Sbjct: 126 EGLTGVPGTVGGAIKGNAGTSLGAIADHLDWIRLVDCSGEERYLARAEIDAGYRRCILPT 185

Query: 187 DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKS 246
             +I  V           I   I+ +   R   QP++ ++ G  FKNP G  A +L+E++
Sbjct: 186 GSVIVEVCFTLRRAEAEEIRRTISTLLVRRNLTQPVEVRSAGCIFKNPPGDFAGRLVEQA 245

Query: 247 GCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           G +GL  GGA+ISE H NF++N   AT  ++ +L E+ R +V  ++G+ LE EI+ +G 
Sbjct: 246 GLKGLRRGGAQISEKHGNFIVNLGGATAAEVLWLIERARAEVMVKTGVALELEIQVVGS 304


>gi|172079610|ref|ZP_02709519.2| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae CDC1873-00]
 gi|183603503|ref|ZP_02717436.2| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae CDC3059-06]
 gi|183603515|ref|ZP_02715436.2| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae CDC0288-04]
 gi|225854837|ref|YP_002736349.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae JJA]
 gi|225857025|ref|YP_002738536.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae P1031]
 gi|303254546|ref|ZP_07340650.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae BS455]
 gi|303258986|ref|ZP_07344965.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP-BS293]
 gi|303261670|ref|ZP_07347617.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP14-BS292]
 gi|303264339|ref|ZP_07350259.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae BS397]
 gi|303265862|ref|ZP_07351759.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae BS457]
 gi|303268195|ref|ZP_07353994.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae BS458]
 gi|307127041|ref|YP_003879072.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae 670-6B]
 gi|254765613|sp|C1CEX8|MURB_STRZJ RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|254765614|sp|C1CL98|MURB_STRZP RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|172042222|gb|EDT50268.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae CDC1873-00]
 gi|183574363|gb|EDT94891.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae CDC0288-04]
 gi|183576750|gb|EDT97278.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae CDC3059-06]
 gi|225723565|gb|ACO19418.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae JJA]
 gi|225724321|gb|ACO20173.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae P1031]
 gi|301802131|emb|CBW34867.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae INV200]
 gi|302598514|gb|EFL65556.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae BS455]
 gi|302637250|gb|EFL67738.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP14-BS292]
 gi|302639929|gb|EFL70385.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP-BS293]
 gi|302642274|gb|EFL72622.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae BS458]
 gi|302644597|gb|EFL74847.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae BS457]
 gi|302646151|gb|EFL76378.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae BS397]
 gi|306484103|gb|ADM90972.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae 670-6B]
          Length = 301

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 151/293 (51%), Gaps = 17/293 (5%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDA 78
           +F+E  PL   ++ + GG A+ +  P++  +L   +      +IP  ++G  SNI+VRD 
Sbjct: 17  RFKE--PLHSYSYTKVGGEADYLVFPRNRFELARLVKFANQENIPWMVLGNASNIIVRDG 74

Query: 79  GIRGVVL---RLSNAGFS--NIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           GIRG V+   +L+N       IE      +I   R         ALRH + GF F  GIP
Sbjct: 75  GIRGFVILCDKLNNVSVDGYTIEAEAGANLIETTRI--------ALRHSLTGFEFACGIP 126

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITH 192
           GS+GGA +MNAGA   E +  +     + + G    +  + L + YR S I +   ++  
Sbjct: 127 GSVGGAVFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAKDLAFGYRHSAIQESGAVVLS 186

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
           V     P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G  
Sbjct: 187 VKFALAPGTHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGYR 246

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            GG ++SE H  FMIN  + T  D E L + V +KV   SGI LE E++ LG+
Sbjct: 247 IGGVEVSEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGITLEREVRILGE 299


>gi|296275147|ref|ZP_06857654.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus MR1]
          Length = 307

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 158/288 (54%), Gaps = 5/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTL-LPSDIPITIVGLGSNILVRDA 78
           K + + PLK+ T+ +TGGNA+    P    +++  +     ++IP+T +G GSNI++R+ 
Sbjct: 18  KIKVDEPLKRYTYTKTGGNADFYITPTKNEEVQAVVKYAYQNEIPVTYLGNGSNIIIREG 77

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIRG+V+ L      +I+V +   +I G+  +   ++  A  + + G  F  GIPGSIGG
Sbjct: 78  GIRGIVISL--LSLDHIDVSDDA-IIAGSGAAIIDVSRVARDYALTGLEFACGIPGSIGG 134

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRG 197
           A YMNAGA   E    +     ++ +G+   +  ++L+  YR+S I K+ L++       
Sbjct: 135 AVYMNAGAYGGEVKDCIDYALCVNEQGSLIKLTTKELELDYRNSIIQKEHLVVLEAAFTL 194

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P     I A + ++   RE+ QP++  + GS F+ P GH A +LI+ S  +G   GG +
Sbjct: 195 APGKMTEIQAKMDDLTERRESKQPLEYPSCGSVFQRPLGHFAGKLIQDSNLQGHRIGGVE 254

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S  H  FM+N DN T  D E L   V+K V  + GI L  E++ +G+
Sbjct: 255 VSTKHAGFMVNVDNGTATDYENLIHYVQKTVKEKFGIELNREVRIIGE 302


>gi|293365703|ref|ZP_06612412.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus oralis ATCC
           35037]
 gi|307703647|ref|ZP_07640589.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus oralis
           ATCC 35037]
 gi|322375492|ref|ZP_08050005.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sp. C300]
 gi|291316071|gb|EFE56515.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus oralis ATCC
           35037]
 gi|307623054|gb|EFO02049.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus oralis
           ATCC 35037]
 gi|321279755|gb|EFX56795.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sp. C300]
          Length = 301

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 100/293 (34%), Positives = 152/293 (51%), Gaps = 17/293 (5%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDA 78
           +F+E  PLK  T+ + GG A+ +  P++ +++   +      +IP  ++G  SNI+VR+ 
Sbjct: 17  RFKE--PLKTYTYTKVGGRADYLVLPRNRYEMARVVQFANQENIPWMVLGNASNIIVREG 74

Query: 79  GIRGVVL---RLSNAGFS--NIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           GIRG V+   +L+N       IE      +I   R         ALRH + GF F  GIP
Sbjct: 75  GIRGFVILCDKLNNVSVDGYTIEAEAGANLIETTRI--------ALRHSLTGFEFACGIP 126

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITH 192
           GSIGGA +MNAGA   E +  +     + ++G    +  + L + YR S I     ++  
Sbjct: 127 GSIGGAVFMNAGAYGGEIAHILQSCQILTKEGEIETLSAKDLAFGYRHSAIQDSGAVVLS 186

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
                 P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G  
Sbjct: 187 AKFALAPGNHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGYR 246

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            GG ++SE H  FMIN  + T  D E L + V +KV   SG+ LE E++ LG+
Sbjct: 247 IGGVEVSEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGVTLEREVRILGE 299


>gi|149007340|ref|ZP_01830998.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP18-BS74]
 gi|149019344|ref|ZP_01834706.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP23-BS72]
 gi|147761144|gb|EDK68112.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP18-BS74]
 gi|147931214|gb|EDK82193.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP23-BS72]
 gi|332074712|gb|EGI85186.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae GA17545]
 gi|332201841|gb|EGJ15911.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae GA47368]
          Length = 295

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 151/293 (51%), Gaps = 17/293 (5%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDA 78
           +F+E  PL   ++ + GG A+ +  P++  +L   +      +IP  ++G  SNI+VRD 
Sbjct: 11  RFKE--PLHSYSYTKVGGEADYLVFPRNRFELARLVKFANQENIPWMVLGNASNIIVRDG 68

Query: 79  GIRGVVL---RLSNAGFS--NIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           GIRG V+   +L+N       IE      +I   R         ALRH + GF F  GIP
Sbjct: 69  GIRGFVILCDKLNNVSVDGYTIEAEAGANLIETTRI--------ALRHSLTGFEFACGIP 120

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITH 192
           GS+GGA +MNAGA   E +  +     + + G    +  + L + YR S I +   ++  
Sbjct: 121 GSVGGAVFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAKDLAFGYRHSAIQESGAVVLS 180

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
           V     P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G  
Sbjct: 181 VKFALAPGTHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGYR 240

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            GG ++SE H  FMIN  + T  D E L + V +KV   SGI LE E++ LG+
Sbjct: 241 IGGVEVSEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGITLEREVRILGE 293


>gi|224475879|ref|YP_002633485.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           carnosus subsp. carnosus TM300]
 gi|254765572|sp|B9DJN5|MURB_STACT RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|222420486|emb|CAL27300.1| putative UDP-N-acetylenolpyruvoylglucosamine reductase
           [Staphylococcus carnosus subsp. carnosus TM300]
          Length = 308

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 95/284 (33%), Positives = 159/284 (55%), Gaps = 9/284 (3%)

Query: 26  PLKQITWFRTGGNAEVMFQP---QDIHDLKYFLTLLPSDIPITIVGLGSNILVRDAGIRG 82
           PLK+ T+ +TGGNA+    P   + +  + +   +  ++IP+T +G GSNI++R+ GIRG
Sbjct: 24  PLKRYTYTQTGGNADFYLSPTTNEQVQAINHLARM--NNIPVTYLGNGSNIIIREGGIRG 81

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           +VL L +  +  I+V ++  +I G+  +   ++  A  + + G  F  GIPGSIGGA +M
Sbjct: 82  IVLSLLSMDY--IKVEDNV-IIAGSGAAIIDVSRKARDYSLTGLEFACGIPGSIGGAVFM 138

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFPES 201
           NAGA   E    +     ++ +G    + R++L+  YRSS + K  L++        P +
Sbjct: 139 NAGAYGGEVRDCIEHAVCVNERGEIVTLTRDELELGYRSSIVQKQHLVVLEASFNLAPGN 198

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
           Q  I + + ++ + RET QP++  + GS F+ P GH A +LI+ S  +G   GG ++S+ 
Sbjct: 199 QEEIQSVMDDLTNRRETKQPLEYPSCGSVFQRPPGHFAGKLIQDSELQGHRIGGVEVSKK 258

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           H  FM+N DN T  D E L   V+  V  +  + L  E++ +GD
Sbjct: 259 HAGFMVNVDNGTATDYEDLIHHVQNVVKEKFDVELHPEVRIIGD 302


>gi|47095371|ref|ZP_00232981.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes str. 1/2a F6854]
 gi|254827708|ref|ZP_05232395.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes FSL N3-165]
 gi|254898414|ref|ZP_05258338.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes J0161]
 gi|254912095|ref|ZP_05262107.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes J2818]
 gi|254936422|ref|ZP_05268119.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes F6900]
 gi|47016192|gb|EAL07115.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes str. 1/2a F6854]
 gi|258600087|gb|EEW13412.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes FSL N3-165]
 gi|258609014|gb|EEW21622.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes F6900]
 gi|293590063|gb|EFF98397.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes J2818]
          Length = 298

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 101/284 (35%), Positives = 151/284 (53%), Gaps = 5/284 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRG 82
           N PL + T+ +TGG A+V   P+ I + +  +     + IP+TI+G GSN++++D GIRG
Sbjct: 16  NEPLSKYTYTKTGGAADVFVMPKTIEEAQEVVAYCHQNKIPLTILGNGSNLIIKDGGIRG 75

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           V+L L       IE RN+ +++  +       A  AL   + G  F  GIPGSIGGA +M
Sbjct: 76  VILHLDL--LQTIE-RNNTQIVAMSGAKLIDTAKFALNESLSGLEFACGIPGSIGGALHM 132

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLRGFPES 201
           NAGA   E S  +     + + G    + R +LK  YR S I  K  I+         E 
Sbjct: 133 NAGAYGGEISDVLEAATVLTQTGELKKLKRSELKAAYRFSTIAEKSYIVLDATFSLALEE 192

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
           +N+I A +  +   RE  QP++  + GS FK P GH A +LI+ SG +G   GGA++S  
Sbjct: 193 KNLIQAKMDELTAAREAKQPLEYPSCGSVFKRPPGHFAGKLIQDSGLQGHIIGGAQVSLK 252

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           H  F++N   AT  D   L   V++ V  +  + LE E+K +G+
Sbjct: 253 HAGFIVNIGGATATDYMNLIAYVQQTVREKFDVELETEVKIIGE 296


>gi|326406709|gb|ADZ63780.1| UDP-N-acetylmuramate dehydrogenase [Lactococcus lactis subsp.
           lactis CV56]
          Length = 299

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 102/289 (35%), Positives = 154/289 (53%), Gaps = 9/289 (3%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDA 78
           KF E  PL + T+ + GG A+++  P  I  L   L    S D  +T++G  SN++VRD 
Sbjct: 16  KFNE--PLSKYTYTKVGGPADILAFPATIEALTELLVKAKSTDTAVTVLGNASNLIVRDG 73

Query: 79  GIRGVVLRLSNAGFSNIEVRNHC-EMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
           GIRG+V+ L      +++V  +  E   GA+   K +   A  + + GF F  GIPGSIG
Sbjct: 74  GIRGLVILLEK--LESVKVAGYTIEAQAGAKL--KEVTQVAQANSLIGFEFACGIPGSIG 129

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLR 196
           GA +MNAGA   E SQ +V    +D  GN  V+   ++++ YR S I  K+L++      
Sbjct: 130 GAVFMNAGAYGGEISQVLVSCKVMDTDGNISVLTASEMQFGYRHSVIRDKNLVVLSAKFE 189

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
                   I   +  +   RE+ QP++  + GS FK P GH A QLI+++  +G+  GG 
Sbjct: 190 LQAGDPTQIQNEMNRLNFLRESKQPLEYPSCGSVFKRPVGHFAGQLIQEANLQGVRIGGV 249

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           ++S+ H  FM+N  N    D E L   V  KV   SG+ LE E++ +G+
Sbjct: 250 EVSKKHAGFMVNVANGNATDYEKLIAHVIDKVKENSGVTLEPEVRIIGE 298


>gi|172056590|ref|YP_001813050.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Exiguobacterium
           sibiricum 255-15]
 gi|254764183|sp|B1YJK3|MURB_EXIS2 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|171989111|gb|ACB60033.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Exiguobacterium
           sibiricum 255-15]
          Length = 304

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 101/287 (35%), Positives = 157/287 (54%), Gaps = 11/287 (3%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTL-LPSDIPITIVGLGSNILVRDAGIRG 82
           N PLK  T+ + GG A++   P    +  + +      D+P+T++G GSN++VRD GIRG
Sbjct: 22  NEPLKNHTYTKMGGLADLFLIPSTYEETAFAVRYAYEHDLPLTMLGNGSNLVVRDGGIRG 81

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           +VL       ++I V  H E+I  +  +    +  A  H + G  F  GIPG+IGGA  M
Sbjct: 82  IVLSFEK--LTDISVEGH-ELIAQSGAAIIQASRIAYDHALSGLEFACGIPGTIGGALIM 138

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRG-FPES 201
           NAGA   E    +     + RKG    I  E+L+  YR+S  +K     +++L G F  +
Sbjct: 139 NAGAYGGEVKDCLHSATVLTRKGELLNISHEELELGYRTSCFSKK---EYIILEGRFSLT 195

Query: 202 QN---IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           +    +I   + ++ H RET QP++  + GS FK P G+ A +LI+ SG +G   GGA++
Sbjct: 196 EGDPALIKEMMDDLTHKRETKQPLEYPSCGSVFKRPEGYFAGKLIQDSGLQGARIGGAEV 255

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           S+ H  F++N  +AT  D   L   V++ V  + GILLE E+K +G+
Sbjct: 256 SQKHAGFIVNIKDATATDYISLIRHVQETVQEKFGILLEPEVKIIGE 302


>gi|314936963|ref|ZP_07844310.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus hominis subsp.
           hominis C80]
 gi|313655582|gb|EFS19327.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus hominis subsp.
           hominis C80]
          Length = 308

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 95/285 (33%), Positives = 155/285 (54%), Gaps = 5/285 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIRG 82
           N PLK+ T+ +TGGNA+    P +   ++  +       +P+T +G GSNI++R+ GIRG
Sbjct: 23  NEPLKRYTYTKTGGNADFYLSPIENEQVQTIVRYAQEHQLPVTYLGNGSNIIIREGGIRG 82

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           +V+ L     ++I V +   +I G+  +   ++ +A  H + G  F  GIPGS+GGA YM
Sbjct: 83  IVISL--LSLNHINVSDDA-IIAGSGAAIIDVSRAARDHVLTGLEFACGIPGSVGGAVYM 139

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFPES 201
           NAGA   E    +     ++  G+   + +EQL   YR+S + K  L++        P +
Sbjct: 140 NAGAYGGEIKDCIDYALCVNEHGDLIQLTKEQLHLDYRNSVVQKQHLVVLEAAFTLEPGN 199

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
            N I A + ++   RE+ QP++  + GS F+ P GH A +LI+ S  +G   GG ++S  
Sbjct: 200 LNEIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHFAGKLIQDSNLQGHRIGGVEVSTK 259

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           H  FM+N DN T  D E L   V+K V  +  + L  E++ +G++
Sbjct: 260 HAGFMVNVDNGTATDYENLIHHVQKVVKEKFDVELHREVRIIGEY 304


>gi|294501019|ref|YP_003564719.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus megaterium
           QM B1551]
 gi|295706368|ref|YP_003599443.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus megaterium
           DSM 319]
 gi|294350956|gb|ADE71285.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus megaterium
           QM B1551]
 gi|294804027|gb|ADF41093.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus megaterium
           DSM 319]
          Length = 301

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 103/302 (34%), Positives = 158/302 (52%), Gaps = 5/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPI 64
           +  L++E  +   GK +EN PL + T  + GG A+V+ +P  +  LK  + ++    +  
Sbjct: 1   MEALVKELVEANIGKVRENEPLAKHTTMKIGGPADVLVEPDSVDHLKVTMDIIKKHGVKW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
             +G GSN+LV D GI GVV++L  AG  ++ V      + G   S K LA    + G+ 
Sbjct: 61  RAIGRGSNLLVSDKGIEGVVIKLG-AGLDDLTVDGETVTVGGGYPSIK-LATVITKQGLS 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA+  + S  V +   +   G    +  E+L++ YR S +
Sbjct: 119 GLEFSSGIPGSVGGAVYMNAGAHGSDMSHVVEKALILFEDGTLEWLTNEELQFSYRHSIL 178

Query: 185 TKDL--IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
            KD   +    VLR    +++ I A +     +R   QP      GS F+NP  + A  L
Sbjct: 179 QKDRPGVCVEAVLRLKKGTKDDIVAVMQKNKDYRRETQPWNFPCAGSIFRNPLPNYAGDL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IEKS  +G   GGA+ISE H NF++N  +AT  D+  L   V+K +  +  I +  E++ 
Sbjct: 239 IEKSNLKGFSVGGAQISEQHANFIVNTGDATASDVLNLIAHVKKTIKEKFDIDIHTEVEI 298

Query: 303 LG 304
           +G
Sbjct: 299 IG 300


>gi|325831253|ref|ZP_08164545.1| UDP-N-acetylmuramate dehydrogenase [Eggerthella sp. HGA1]
 gi|325486854|gb|EGC89301.1| UDP-N-acetylmuramate dehydrogenase [Eggerthella sp. HGA1]
          Length = 305

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 93/288 (32%), Positives = 154/288 (53%), Gaps = 4/288 (1%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRD 77
           G  + +  + ++T FR GG A+V+ +P+   + +  L       + + ++GLGS++LV D
Sbjct: 17  GAARFDASMAELTTFRIGGPADVLVEPRTADEARVVLAACRRLGVAVRVMGLGSDVLVAD 76

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G+R VV+R++ +  S +EV     M V A  S   +A  A   G+ G+ F  GIPG++G
Sbjct: 77  EGLRCVVVRIAES-LSQVEVDGE-RMHVEAGASNADVARRACEEGLAGYEFACGIPGTVG 134

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLR 196
           GAA MNAGA   E       V  +  +G    +  E+ ++ YR S + +   ++    LR
Sbjct: 135 GAAVMNAGAYGGEFKDVAESVRCLTPEGELVDVDAERAQWSYRHSMMGEAGFVVLGATLR 194

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
             P+    I   + ++   R   QP++  + GSTFK P G    QL++++G RG   GGA
Sbjct: 195 LAPDDPRAIRERMDDLARRRAEKQPLELPSAGSTFKRPAGFFVGQLVQEAGLRGYRVGGA 254

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           ++SE H  F++NA  AT  D+  L   V+++V   +G+ LE E++  G
Sbjct: 255 QVSEKHTGFVVNAGGATAADVRRLIADVQERVRASAGVDLEPEVRMWG 302


>gi|302391533|ref|YP_003827353.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acetohalobium
           arabaticum DSM 5501]
 gi|302203610|gb|ADL12288.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acetohalobium
           arabaticum DSM 5501]
          Length = 301

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 95/294 (32%), Positives = 158/294 (53%), Gaps = 5/294 (1%)

Query: 11  RERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGL 69
           +E   +++GK      LK  T F+ GG AEV+  PQDI DL+  +  L  + +  T++G 
Sbjct: 7   QELKSKVKGKISFEESLKNHTSFQVGGPAEVLIIPQDIDDLQQLMVYLNRTGVEHTVIGN 66

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
           G+N+LV D GI GVV++L   G   +E++    +  G   S   +A  A + G+ G  F 
Sbjct: 67  GTNLLVSDQGISGVVIKLV-GGIDGVEIQKQ-RITAGGGASLPVVAKQAAKVGLSGLEFA 124

Query: 130 YGIPGSIGGAAYMNAGANNCE-TSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KD 187
            G+P ++GGA  MNAG  +    S+ + +V  +   G   +    + ++ YR S     D
Sbjct: 125 SGLPATVGGATVMNAGLKSLNHISKVIDKVRVVSSTGELQIFDSSECEFGYRQSRFQLAD 184

Query: 188 LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSG 247
            +I  V +   P+ +  I + +  +   R+  QP+K    G  FKNP+  SA +LI+++G
Sbjct: 185 SVIVGVEMILKPKPKEKIQSKMEELIAKRKKSQPLKMPNAGCIFKNPSSASAGRLIDEAG 244

Query: 248 CRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
            +G++ GGA +S  H NF++N DNAT  D+  L ++V+  V  + G+ L  E++
Sbjct: 245 GKGMQIGGAVVSSKHANFIVNKDNATAQDIMDLIDEVKTLVKEEYGLELVCEVQ 298


>gi|169832740|ref|YP_001694824.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae Hungary19A-6]
 gi|183603272|ref|ZP_02713753.2| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP195]
 gi|237651179|ref|ZP_04525431.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae CCRI 1974]
 gi|237821261|ref|ZP_04597106.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae CCRI 1974M2]
 gi|254765585|sp|B1ICI9|MURB_STRPI RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|168995242|gb|ACA35854.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae Hungary19A-6]
 gi|183571950|gb|EDT92478.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP195]
          Length = 301

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 151/293 (51%), Gaps = 17/293 (5%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDA 78
           +F+E  PL   ++ + GG A+ +  P++  +L   +      +IP  ++G  SNI+VRD 
Sbjct: 17  RFKE--PLHSYSYTKVGGEADYLVFPRNRFELARVVKFANQENIPWMVLGNASNIIVRDG 74

Query: 79  GIRGVVL---RLSNAGFS--NIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           GIRG V+   +L+N       IE      +I   R         ALRH + GF F  GIP
Sbjct: 75  GIRGFVILCDKLNNVSVDGYTIEAEAGANLIETTRI--------ALRHSLTGFEFACGIP 126

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITH 192
           GS+GGA +MNAGA   E +  +     + + G    +  + L + YR S I +   ++  
Sbjct: 127 GSVGGAVFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAKDLAFGYRHSAIQESGAVVLS 186

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
           V     P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G  
Sbjct: 187 VKFALAPGTHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGYR 246

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            GG ++SE H  FMIN  + T  D E L + V +KV   SGI LE E++ LG+
Sbjct: 247 IGGVEVSEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGITLEREVRILGE 299


>gi|322376236|ref|ZP_08050729.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sp. M334]
 gi|321282043|gb|EFX59050.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sp. M334]
          Length = 301

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 150/293 (51%), Gaps = 17/293 (5%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDA 78
           +F+E  PL   ++ + GG A+ +  P++  +L   +      +IP  ++G  SNI+VRD 
Sbjct: 17  RFKE--PLHSYSYTKVGGEADYLVFPRNRFELARVVKFANQENIPWMVLGNASNIIVRDG 74

Query: 79  GIRGVVL---RLSNAGFS--NIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           GIRG V+   +L+N       IE      +I   R         ALRH + GF F  GIP
Sbjct: 75  GIRGFVILCDKLNNVSVDGYTIEAEAGANLIETTRI--------ALRHSLTGFEFACGIP 126

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITH 192
           GS+GGA +MNAGA   E +  +     + + G    +  + L + YR S I +   ++  
Sbjct: 127 GSVGGAVFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAQGLAFGYRHSAIQESGAVVLS 186

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
                 P S  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G  
Sbjct: 187 AKFALAPGSHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGYR 246

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            GG ++SE H  FMIN  + T  D E L E V +KV   SG+ LE E++ LG+
Sbjct: 247 IGGVEVSEKHAGFMINVADGTAKDYEDLIESVIEKVKEHSGVTLEREVRILGE 299


>gi|315613416|ref|ZP_07888325.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis ATCC
           49296]
 gi|315314651|gb|EFU62694.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis ATCC
           49296]
          Length = 301

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 100/293 (34%), Positives = 152/293 (51%), Gaps = 17/293 (5%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDA 78
           +F+E  PLK  T+ + GG A+ +  P++ +++   +      +IP  ++G  SNI+VR+ 
Sbjct: 17  RFKE--PLKTYTYTKVGGRADYLVLPRNRYEMARVVQFANQENIPWMVLGNASNIIVREG 74

Query: 79  GIRGVVL---RLSNAGFS--NIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           GIRG V+   +L+N       IE      +I   R         ALRH + GF F  GIP
Sbjct: 75  GIRGFVILCDKLNNVSVDGYTIEAEAGANLIETTRI--------ALRHSLTGFEFACGIP 126

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITH 192
           GSIGGA +MNAGA   E +  +     + ++G    +  + L + YR S I     ++  
Sbjct: 127 GSIGGAVFMNAGAYGGEIAHILQSCQILTKEGEIETLSVKDLAFGYRHSAIQDSGAVVLS 186

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
                 P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G  
Sbjct: 187 AKFALAPGNHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGYR 246

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            GG ++SE H  FMIN  + T  D E L + V +KV   SG+ LE E++ LG+
Sbjct: 247 IGGVEVSEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGVTLEREVRILGE 299


>gi|309800697|ref|ZP_07694837.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           infantis SK1302]
 gi|308115682|gb|EFO53218.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           infantis SK1302]
          Length = 301

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 101/303 (33%), Positives = 156/303 (51%), Gaps = 17/303 (5%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVG 68
           L+E  + +  +F E  PLK  T+ + GG A+ +  P++ +++   +     + IP  ++G
Sbjct: 7   LKETLEGIDIRFDE--PLKTYTYTKVGGKADYLVFPRNRYEMARVVKFANQETIPWMVLG 64

Query: 69  LGSNILVRDAGIRGVVL---RLSNAGFS--NIEVRNHCEMIVGARCSGKSLANSALRHGI 123
             SNI+VR+ G+RG V+   +L+N       IE      +I   R         ALRH +
Sbjct: 65  NASNIIVREGGVRGFVIMCDKLNNVSVDGYTIEAEAGANLIETTRI--------ALRHSL 116

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            GF F  GIPGS+GGA +MNAGA   E +  +     + ++G    +  + L + YR S 
Sbjct: 117 TGFEFACGIPGSVGGAVFMNAGAYGGEIAHVLQSCQILTKEGEIETLSAKDLTFGYRHSA 176

Query: 184 ITKD-LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
           I     ++        P +  +I   +  + H RE  QP++  + GS FK P GH A QL
Sbjct: 177 IQASGAVVLSAKFALAPGNHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQL 236

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           I ++G +G   GG ++SE H  FMIN  + T  D E L E V +KV   SG+ LE E++ 
Sbjct: 237 IAEAGLKGYRIGGVEVSEKHAGFMINVADGTARDYEDLIESVIEKVKEHSGVTLEREVRI 296

Query: 303 LGD 305
           LG+
Sbjct: 297 LGE 299


>gi|317121708|ref|YP_004101711.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermaerobacter
           marianensis DSM 12885]
 gi|315591688|gb|ADU50984.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermaerobacter
           marianensis DSM 12885]
          Length = 322

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 107/307 (34%), Positives = 156/307 (50%), Gaps = 14/307 (4%)

Query: 9   LLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIV 67
           + RE    ++G  +   PL + T FR GG A+V+ +P D  DL   L       +P+T++
Sbjct: 1   MARELQGVVKGLVKVAEPLARYTTFRIGGPADVLVEPADEEDLARALAWAQERGVPVTLL 60

Query: 68  GLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCE-----MIVGARCSGKSLANSALRHG 122
           G GSN+LV D G+ G+VLR+   G   I      +     ++VGA      L + A R G
Sbjct: 61  GGGSNVLVPDEGLPGLVLRI---GLDGIRWERPGDGGRRGVVVGAGTVLARLVHEAARRG 117

Query: 123 IGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS 182
             G     GIPG++GGA  MNAG  +    Q V  V  ++  G   V PREQ  + YRSS
Sbjct: 118 CRGLEPCAGIPGTVGGALVMNAGTRDGSIGQVVDWVRVVEPGGQLAVWPREQCGFAYRSS 177

Query: 183 EITKD---LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
            +  +   ++   +VL   P     I   I     +R+  QP++    GS FKNP G ++
Sbjct: 178 RMQAEGIPVVAARLVLD--PGDPQAILQEIRRHTAYRQRTQPLRYPNCGSVFKNPPGDAS 235

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LIE  G +GL  G A+ISE H NF+IN   AT  D+  L     + V ++ G++LE E
Sbjct: 236 GRLIEACGLKGLRRGRAQISEQHANFIINLGGATAEDVLDLMTTAWRCVRDRFGVILEPE 295

Query: 300 IKRLGDF 306
           ++ LG  
Sbjct: 296 VRLLGAL 302


>gi|70727152|ref|YP_254068.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           haemolyticus JCSC1435]
 gi|90109790|sp|Q4L4G3|MURB_STAHJ RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|68447878|dbj|BAE05462.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus haemolyticus
           JCSC1435]
          Length = 307

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 95/284 (33%), Positives = 154/284 (54%), Gaps = 5/284 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIRG 82
           N PLK+ T+  TGGNA+    P    D++  +      DIP+T +G GSNI++R+ GIRG
Sbjct: 23  NEPLKRYTYTETGGNADFYLSPTKNEDVQAIVRYAKEKDIPVTYLGNGSNIIIREGGIRG 82

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           +V+ L     ++I V +   +I G+  +   ++ +A  H + G  F  GIPGS+GGA YM
Sbjct: 83  IVISL--LSLNHINVSDDA-IIAGSGSAIIDVSRAARDHVLTGLEFACGIPGSVGGAVYM 139

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFPES 201
           NAGA   E    +     ++ +G+      ++L+  YR+S + K  L++        P  
Sbjct: 140 NAGAYGGEIKDCIDYALCVNEEGDLIQFTNKELELDYRNSIVQKQHLVVLEAAFTLEPGK 199

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
            + I A + ++   RE+ QP++  + GS F+ P GH A +LI+ S  +G   GG ++S+ 
Sbjct: 200 LDEIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHFAGKLIQDSDLQGYRVGGVEVSKK 259

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           H  FM+N DN T  D E L   V+K V  +  + L  E++ +G+
Sbjct: 260 HAGFMVNVDNGTATDYEDLIHHVQKVVKEKFDVELHREVRIIGE 303


>gi|320528961|ref|ZP_08030053.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Selenomonas
           artemidis F0399]
 gi|320138591|gb|EFW30481.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Selenomonas
           artemidis F0399]
          Length = 303

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 101/284 (35%), Positives = 157/284 (55%), Gaps = 4/284 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIRG 82
           N P++  T F  GG A+++F P  I +++  +    S   PIT++G GSNILVRD GIRG
Sbjct: 21  NAPMRFHTTFCIGGPADMLFYPASIDEVQKIIQAAKSYGEPITLMGNGSNILVRDGGIRG 80

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           +V+R  N   S+I V +  ++ VGA    K  A  A R G+ G  F  GIPGSIGGA +M
Sbjct: 81  LVVRF-NHTMSSI-VASGSDITVGAGALLKDAAAFAQRQGLTGMEFAAGIPGSIGGAIFM 138

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLRGFPES 201
           NAGA + E    V +V  +   G        +L + YR S    ++  I  V L   P +
Sbjct: 139 NAGAYDGEMKSIVTQVKTVSAAGEIRSYAAHELDFDYRHSIFHEREEAICEVRLHLTPGN 198

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
              I   + ++   R++ QP++  + GSTFK P G+ A  LI+++G +G   GGA++S  
Sbjct: 199 PADILEKMTDLNGRRKSRQPLEYPSAGSTFKRPPGYFAGTLIDEAGLKGFTVGGAQVSRK 258

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           H  F++N   AT  D++ L   V+++V+ +  + L  E++ +G+
Sbjct: 259 HAGFIVNIGGATANDVQRLIAAVQERVYARHAVRLVPELRIIGE 302


>gi|15901244|ref|NP_345848.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae TIGR4]
 gi|15903290|ref|NP_358840.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae R6]
 gi|116515736|ref|YP_816689.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae D39]
 gi|148985657|ref|ZP_01818811.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP3-BS71]
 gi|168487700|ref|ZP_02712208.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae CDC1087-00]
 gi|221232130|ref|YP_002511283.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae ATCC 700669]
 gi|225860830|ref|YP_002742339.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae Taiwan19F-14]
 gi|298229499|ref|ZP_06963180.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae str. Canada MDR_19F]
 gi|298254199|ref|ZP_06977785.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae str. Canada MDR_19A]
 gi|298502659|ref|YP_003724599.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae TCH8431/19A]
 gi|54037854|sp|P65467|MURB_STRR6 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|54041504|sp|P65466|MURB_STRPN RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|122278425|sp|Q04JV9|MURB_STRP2 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|254765601|sp|B8ZKN7|MURB_STRPJ RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|254765615|sp|C1CQW7|MURB_STRZT RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|14972877|gb|AAK75488.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae TIGR4]
 gi|15458885|gb|AAL00051.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae R6]
 gi|116076312|gb|ABJ54032.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae D39]
 gi|147922138|gb|EDK73260.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP3-BS71]
 gi|183569538|gb|EDT90066.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae CDC1087-00]
 gi|220674591|emb|CAR69154.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae ATCC 700669]
 gi|225727765|gb|ACO23616.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae Taiwan19F-14]
 gi|298238254|gb|ADI69385.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae TCH8431/19A]
 gi|301800257|emb|CBW32876.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae OXC141]
          Length = 316

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 151/293 (51%), Gaps = 17/293 (5%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDA 78
           +F+E  PL   ++ + GG A+ +  P++  +L   +      +IP  ++G  SNI+VRD 
Sbjct: 17  RFKE--PLHSYSYTKVGGEADYLVFPRNRFELARVVKFANQENIPWMVLGNASNIIVRDG 74

Query: 79  GIRGVVL---RLSNAGFS--NIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           GIRG V+   +L+N       IE      +I   R         ALRH + GF F  GIP
Sbjct: 75  GIRGFVILCDKLNNVSVDGYTIEAEAGANLIETTRI--------ALRHSLTGFEFACGIP 126

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITH 192
           GS+GGA +MNAGA   E +  +     + + G    +  + L + YR S I +   ++  
Sbjct: 127 GSVGGAVFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAKDLAFGYRHSAIQESGAVVLS 186

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
           V     P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G  
Sbjct: 187 VKFALAPGTHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGYR 246

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            GG ++SE H  FMIN  + T  D E L + V +KV   SGI LE E++ LG+
Sbjct: 247 IGGVEVSEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGITLEREVRILGE 299


>gi|158334962|ref|YP_001516134.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acaryochloris marina
           MBIC11017]
 gi|187609687|sp|B0CCD5|MURB_ACAM1 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|158305203|gb|ABW26820.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acaryochloris marina
           MBIC11017]
          Length = 308

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 97/290 (33%), Positives = 152/290 (52%), Gaps = 4/290 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKY-FLTLLPSDIPITIVGLGSNILVRDA 78
           + Q    L  +T FR GG AE    P ++ +L+  +       +PIT +G GSN+L+ D 
Sbjct: 16  EIQPYVSLADMTTFRVGGAAEWFIAPHNLKELQASYAWANEQALPITFLGAGSNLLISDQ 75

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           G+ G+V+          +    C++   A  S   LA  A + G  G  +  GIPG++GG
Sbjct: 76  GLPGLVISTRYLRQRTFDPET-CQVTAYAGESLPKLAWQAAKRGWSGLEWAVGIPGTVGG 134

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS--EITKDLIITHVVLR 196
           A  MNAGA+   T+  + EVH +D+ G   V+  E + +QYRSS  + +   ++  V   
Sbjct: 135 ALVMNAGAHGGCTADVLTEVHALDKDGTVQVLKPEHMAFQYRSSILQQSPKPVLLGVFQL 194

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
              +S   + A   +   HR + QP    + GS F+NP   +A  LIE+SG +G   GGA
Sbjct: 195 HANQSAEQVKATTQSHLDHRLSTQPYDWPSCGSVFRNPLPRTAGWLIEQSGLKGYSLGGA 254

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           ++++ H NF++N+ NAT  D+  L   V++KV     +LL+ E+K LG F
Sbjct: 255 QVAQKHANFILNSGNATATDIFNLIHYVQQKVEENWSLLLKPEVKMLGKF 304


>gi|111658584|ref|ZP_01409241.1| hypothetical protein SpneT_02000259 [Streptococcus pneumoniae
           TIGR4]
 gi|327389576|gb|EGE87921.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae GA04375]
          Length = 310

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 151/293 (51%), Gaps = 17/293 (5%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDA 78
           +F+E  PL   ++ + GG A+ +  P++  +L   +      +IP  ++G  SNI+VRD 
Sbjct: 11  RFKE--PLHSYSYTKVGGEADYLVFPRNRFELARVVKFANQENIPWMVLGNASNIIVRDG 68

Query: 79  GIRGVVL---RLSNAGFS--NIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           GIRG V+   +L+N       IE      +I   R         ALRH + GF F  GIP
Sbjct: 69  GIRGFVILCDKLNNVSVDGYTIEAEAGANLIETTRI--------ALRHSLTGFEFACGIP 120

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITH 192
           GS+GGA +MNAGA   E +  +     + + G    +  + L + YR S I +   ++  
Sbjct: 121 GSVGGAVFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAKDLAFGYRHSAIQESGAVVLS 180

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
           V     P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G  
Sbjct: 181 VKFALAPGTHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGYR 240

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            GG ++SE H  FMIN  + T  D E L + V +KV   SGI LE E++ LG+
Sbjct: 241 IGGVEVSEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGITLEREVRILGE 293


>gi|332360937|gb|EGJ38742.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK355]
          Length = 301

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 102/290 (35%), Positives = 151/290 (52%), Gaps = 17/290 (5%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRG 82
           N PL Q T+ + GG A+ +  P++ ++L   +      DIP  ++G  SNI+VRD GIRG
Sbjct: 19  NEPLSQYTYTKVGGAADFLVFPRNRYELARIVNFANQEDIPWMVLGNASNIIVRDGGIRG 78

Query: 83  VVL---RLSNAGFSN--IEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            V+   +L+N G     IE      +I           + AL++ + GF F  GIPGS+G
Sbjct: 79  FVIMFDKLNNVGVDGYMIEAEAGANLI--------QTTHIALQNSLTGFEFACGIPGSVG 130

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI--TKDLIITHVVL 195
           GA +MNAGA   E +  +V    +  +G    +    +K+ YR S +  T D++I+    
Sbjct: 131 GAVFMNAGAYGGEIAHVLVSCKVLTPQGQVKTLDVRDMKFGYRHSLVQETGDIVISAKFA 190

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
              P     I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G   GG
Sbjct: 191 LS-PGVHRTIRQEMERLTHLRELKQPLEYPSCGSVFKRPLGHFAGQLISEAGLKGHRIGG 249

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            ++SE H  FMIN D  T  D E L   V ++V   SGI LE E++ +G+
Sbjct: 250 VEVSEKHAGFMINVDKGTAQDYENLIAHVIERVRENSGITLEREVRIIGE 299


>gi|253682099|ref|ZP_04862896.1| UDP-N-acetylmuramate dehydrogenase [Clostridium botulinum D str.
           1873]
 gi|253561811|gb|EES91263.1| UDP-N-acetylmuramate dehydrogenase [Clostridium botulinum D str.
           1873]
          Length = 307

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 97/290 (33%), Positives = 157/290 (54%), Gaps = 5/290 (1%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVR 76
           + + + N  +K  T FR GG A+V   P     ++  + L    +IP  I+G GSN+LV+
Sbjct: 17  KEEIKNNVLMKSYTSFRVGGPADVFVTPNSYEKIRDVIKLCKHYNIPYFILGNGSNLLVK 76

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GIRGVV+  +     ++E     ++I  +      +AN+AL++ + G  F +GIPGS+
Sbjct: 77  DGGIRGVVINFTKLNKISVE---ETKVIAESGAILSMVANTALKNNLTGLEFAHGIPGSV 133

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVL 195
           GGA  MNAGA N E  Q +     ID  G    I ++ ++  YR+S I K+  I+     
Sbjct: 134 GGAVAMNAGAYNGEICQVIESATIIDNHGEIREISKKDMELSYRNSLILKNGYIVLKATF 193

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           +      + I A + ++   R+  QP++  + GSTFK P G+ A +LIE S  +G+  G 
Sbjct: 194 KLQKGEHDSIKARMDDLMRRRKEKQPLEYPSAGSTFKRPEGYFAAKLIEDSELKGVHVGD 253

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           A++S  H  F+IN  NA+  D+  L E V+K V ++  + L  E++ +G+
Sbjct: 254 AEVSVKHSGFIINKGNASAKDILDLIELVKKTVNDKFKVTLNTEVRIVGE 303


>gi|148993051|ref|ZP_01822645.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP9-BS68]
 gi|149002775|ref|ZP_01827701.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP14-BS69]
 gi|147759069|gb|EDK66063.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP14-BS69]
 gi|147928252|gb|EDK79269.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP9-BS68]
 gi|332073697|gb|EGI84176.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae GA17570]
          Length = 295

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 151/293 (51%), Gaps = 17/293 (5%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDA 78
           +F+E  PL   ++ + GG A+ +  P++  +L   +      +IP  ++G  SNI+VRD 
Sbjct: 11  RFKE--PLHSYSYTKVGGEADYLVFPRNRFELARVVKFANQENIPWMVLGNASNIIVRDG 68

Query: 79  GIRGVVL---RLSNAGFS--NIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           GIRG V+   +L+N       IE      +I   R         ALRH + GF F  GIP
Sbjct: 69  GIRGFVILCDKLNNVSVDGYTIEAEAGANLIETTRI--------ALRHSLTGFEFACGIP 120

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITH 192
           GS+GGA +MNAGA   E +  +     + + G    +  + L + YR S I +   ++  
Sbjct: 121 GSVGGAVFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAKDLAFGYRHSAIQESGAVVLS 180

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
           V     P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G  
Sbjct: 181 VKFALAPGTHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGYR 240

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            GG ++SE H  FMIN  + T  D E L + V +KV   SGI LE E++ LG+
Sbjct: 241 IGGVEVSEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGITLEREVRILGE 293


>gi|257791190|ref|YP_003181796.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Eggerthella lenta
           DSM 2243]
 gi|317488077|ref|ZP_07946655.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Eggerthella sp.
           1_3_56FAA]
 gi|257475087|gb|ACV55407.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Eggerthella lenta
           DSM 2243]
 gi|316912828|gb|EFV34359.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Eggerthella sp.
           1_3_56FAA]
          Length = 305

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 92/283 (32%), Positives = 153/283 (54%), Gaps = 4/283 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIRG 82
           +  + ++T FR GG A+V+ +P+   + +  L       + + ++GLGS++LV D G+R 
Sbjct: 22  DASMAELTTFRIGGPADVLVEPRTAGEARVVLEACRRLGVAVRVMGLGSDVLVADEGLRC 81

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           VV+R++ +  S +EV     M V A  S   +A  A   G+ G+ F  GIPG++GGAA M
Sbjct: 82  VVVRIAES-LSQVEVDGE-RMHVEAGASNADVARRACEEGLAGYEFACGIPGTVGGAAIM 139

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFPES 201
           NAGA   E       V  +  +G    +  E+ ++ YR S + +   ++    LR  P+ 
Sbjct: 140 NAGAYGGEFKDVAESVRCLTPEGELVDVDAERAQWSYRHSMMGEAGFVVLGATLRLAPDD 199

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
              I   + ++   R   QP++  + GSTFK P G    QL++++G RG   GGA++SE 
Sbjct: 200 PRAIRERMDDLARRRAEKQPLELPSAGSTFKRPAGFFVGQLVQEAGLRGYRVGGAQVSEK 259

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           H  F++NA +AT  D+  L   V+++V   +G+ LE E++  G
Sbjct: 260 HTGFVVNAGDATAADVRRLIADVQERVRASAGVDLEPEVRMWG 302


>gi|167771350|ref|ZP_02443403.1| hypothetical protein ANACOL_02716 [Anaerotruncus colihominis DSM
           17241]
 gi|167665990|gb|EDS10120.1| hypothetical protein ANACOL_02716 [Anaerotruncus colihominis DSM
           17241]
          Length = 303

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 97/282 (34%), Positives = 145/282 (51%), Gaps = 4/282 (1%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIRGVV 84
           P+   T F+ GG A+++ +P+D       +       +P+  +G GS++L+ D G+RG V
Sbjct: 23  PMAAHTSFKIGGPADLLLKPRDAETAARVIARARELSVPLLFIGKGSDLLICDEGVRGAV 82

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           L    A  +   +R+   +   A  S  +L   AL  G+ G  F YGIPGS+GGA YMNA
Sbjct: 83  LSFDEAS-ARPSLRDETVIDCPAGASLTALCCFALEQGLTGLEFAYGIPGSVGGAVYMNA 141

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK--DLIITHVVLRGFPESQ 202
           GA   E    V  V  +D +G    +    L+  YR S  T   D +IT          +
Sbjct: 142 GAYGGEIRDVVGSVRFLDGQGKLRALEECALELSYRHSYFTDHPDCLITSASFHLRRGDR 201

Query: 203 NIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELH 262
           + I A + ++   R T QP++  + GSTFK P G  A  LI+  G +G   GGA +SE H
Sbjct: 202 DAIRARMDDLMERRRTKQPLEYPSAGSTFKRPKGAYASALIDGCGLKGRRVGGAMVSEKH 261

Query: 263 CNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
             F+IN DNA+  D+  L  +++ +V  Q+G  LE E+K +G
Sbjct: 262 AGFVINYDNASCTDVLTLIGEIQTQVREQTGFSLECEVKYIG 303


>gi|313887567|ref|ZP_07821250.1| UDP-N-acetylmuramate dehydrogenase [Peptoniphilus harei
           ACS-146-V-Sch2b]
 gi|312846445|gb|EFR33823.1| UDP-N-acetylmuramate dehydrogenase [Peptoniphilus harei
           ACS-146-V-Sch2b]
          Length = 297

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 97/289 (33%), Positives = 156/289 (53%), Gaps = 3/289 (1%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFL-TLLPSDIPITIVGLGSNILVRD 77
           G F  + P+K  T F  GG A+++ +P+D   L   L ++  ++    I+G  +NI+VRD
Sbjct: 10  GDFFYDEPMKNHTSFCVGGPAKLLIKPRDEEALVEILKSIRKNNYKYYILGNCTNIIVRD 69

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G  G++++L N   ++++  +  E+  G   S K ++  A+ + + G  F +GIPGS+G
Sbjct: 70  KGFDGIIIKLKNK-LNDVKKVSDKEIYAGTGASMKKISEFAMENSLTGLEFAHGIPGSLG 128

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLR 196
           GA  MNAGA + E    V  V  +D   +   +P +++ + YR S +  +DLI+      
Sbjct: 129 GAIVMNAGAYDGEIKNVVKSVRLLDENLDVIEVPGDEMNFSYRHSLVQERDLIVLGATFS 188

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
                +N I     +    R   QP+   + GSTFK PTG+ A +LI+ SG RG    GA
Sbjct: 189 LEDGDKNKIREKYEDFDQRRADKQPLNMPSAGSTFKRPTGYFAGKLIDDSGLRGFTHKGA 248

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            ISE HC F++N + AT  D+    E V+K V ++  + LE E+K +GD
Sbjct: 249 GISEKHCGFVVNKNKATAQDVLETIEIVQKVVHDKFDVTLEREVKIIGD 297


>gi|307709080|ref|ZP_07645539.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus mitis
           SK564]
 gi|307620026|gb|EFN99143.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus mitis
           SK564]
          Length = 295

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 150/293 (51%), Gaps = 17/293 (5%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDA 78
           +F+E  PL   ++ + GG A+ +  P++  +L   +      +IP  ++G  SNI+VRD 
Sbjct: 11  RFKE--PLHSYSYTKVGGEADYLVFPRNRFELARVVKFANQENIPWMVLGNASNIIVRDG 68

Query: 79  GIRGVVL---RLSNAGFS--NIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           GIRG V+   +L+N       IE      +I   R         ALRH + GF F  GIP
Sbjct: 69  GIRGFVILCDKLNNVSVDGYTIEAEAGANLIETTRI--------ALRHSLTGFEFACGIP 120

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITH 192
           GS+GGA +MNAGA   E +  +     + + G    +  + L + YR S I +   ++  
Sbjct: 121 GSVGGAVFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAKDLAFGYRHSAIQESGAVVLS 180

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
                 P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G  
Sbjct: 181 AKFALAPGTHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGYR 240

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            GG ++SE H  FMIN  + T  D E L E V +KV   SGI LE E++ LG+
Sbjct: 241 IGGVEVSEKHAGFMINVADGTAKDYEDLIESVIEKVKEHSGITLEREVRILGE 293


>gi|313608807|gb|EFR84608.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes FSL F2-208]
          Length = 298

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 102/284 (35%), Positives = 151/284 (53%), Gaps = 5/284 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRG 82
           N PL + T+ +TGG A+V   P+ I + +  +     + I +TI+G GSN++++D GIRG
Sbjct: 16  NEPLSKYTYTKTGGEADVFVMPKTIEEAQEVVAYCHQNKISLTILGNGSNLIIKDGGIRG 75

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           V+L L       IE RN+ ++I  +       A  AL   + G  F  GIPGSIGGA +M
Sbjct: 76  VILHLDL--LQTIE-RNNTQIIAMSGAKLIDTAKFALDESLSGLEFACGIPGSIGGALHM 132

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLRGFPES 201
           NAGA   E S  +     + + G    + R +LK  YR S I  K+ I+         E 
Sbjct: 133 NAGAYGGEISDVLEAATVLTQTGELKKLKRSELKAAYRFSTIAEKNYIVLDATFSLALEE 192

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
           +N+I A +  +   RE  QP++  + GS FK P GH A +LI+ SG +G   GGA++S  
Sbjct: 193 KNLIQAKMDELTAAREAKQPLEYPSCGSVFKRPPGHFAGKLIQDSGLQGHIIGGAQVSLK 252

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           H  F++N   AT  D   L   V+K V  +  + LE E+K +G+
Sbjct: 253 HAGFIVNIGGATATDYMNLIAYVQKTVREKFDVELETEVKIIGE 296


>gi|289434704|ref|YP_003464576.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria seeligeri
           serovar 1/2b str. SLCC3954]
 gi|289170948|emb|CBH27490.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria seeligeri
           serovar 1/2b str. SLCC3954]
          Length = 298

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 100/284 (35%), Positives = 153/284 (53%), Gaps = 5/284 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRG 82
           N PL   T+ +TGGNA++   P+ I + +  ++    ++IP+TI+G GSN++++D GIRG
Sbjct: 16  NEPLSNYTYTKTGGNADIFVMPKTIEETQAIVSYCHQNNIPLTILGNGSNLIIKDGGIRG 75

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           V++ L  A   +I+ RN+ ++I  +       A  AL   + G  F  GIPGSIGGA +M
Sbjct: 76  VIVHL--ALLQSIK-RNNTQVIAMSGAKLIDTAKFALDESLSGLEFACGIPGSIGGALHM 132

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLRGFPES 201
           NAGA   E S  +     + + G    + R +LK  YR S I  K  I+         + 
Sbjct: 133 NAGAYGGEISDVLEAATVLTQAGELKKLKRSELKAAYRFSTIAEKKYIVLDATFALQLDD 192

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
           +N I   +  +   RE  QP++  + GS FK P GH A +LI+ SG +G   GGA++S  
Sbjct: 193 KNTIQVKMDELTAAREAKQPLEYPSCGSVFKRPPGHFAGKLIQDSGLQGHIIGGAQVSLK 252

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           H  F++N   AT  D   L   V+K V  +  + LE E+K +G+
Sbjct: 253 HAGFIVNIGGATATDYMNLIAHVQKTVREKFDVELETEVKIIGE 296


>gi|315923982|ref|ZP_07920210.1| UDP-N-acetylmuramate dehydrogenase [Pseudoramibacter alactolyticus
           ATCC 23263]
 gi|315622822|gb|EFV02775.1| UDP-N-acetylmuramate dehydrogenase [Pseudoramibacter alactolyticus
           ATCC 23263]
          Length = 306

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 103/284 (36%), Positives = 152/284 (53%), Gaps = 11/284 (3%)

Query: 27  LKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIRGVVL 85
           +K  T FR GG A+ + +P+ I      +    ++ IP  ++G GSN+LVRD G RGV++
Sbjct: 25  MKDHTSFRVGGPADFLVRPETIEQFIDVMCFCRTEKIPSYLIGNGSNLLVRDGGFRGVII 84

Query: 86  RLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAG 145
           +    G   I V +   + V A    + +A  AL HG+ G  F  GIPGS+GGA  MNAG
Sbjct: 85  Q--TRGMDQI-VTSGDRVTVYAGALLRRVAAEALAHGLSGMEFAAGIPGSMGGAIVMNAG 141

Query: 146 ANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLR---GFPES 201
           A   E    V  +  +   GN   I      + YR S +   D I+   VL+   G PE+
Sbjct: 142 AYGGEMKDIVESITVLTETGNLRTIAGADCDFGYRHSVVQDYDWIVVSTVLKLAAGDPEA 201

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
              I+A + +    R   QP+   + GSTF+ P GH A +LI+ +G +G   GGA++SE 
Sbjct: 202 ---IAARMKDFNRRRRDKQPLNFPSAGSTFRRPEGHFAGKLIQDAGMKGYRVGGAQVSEK 258

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           H  F+INADNAT  D+  L  QV+  V ++ G+ L+ E+  +G+
Sbjct: 259 HSGFVINADNATAADILALIGQVQAAVRDRFGVELKTEVITIGE 302


>gi|89096355|ref|ZP_01169248.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus sp. NRRL
           B-14911]
 gi|89089209|gb|EAR68317.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus sp. NRRL
           B-14911]
          Length = 312

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 106/288 (36%), Positives = 152/288 (52%), Gaps = 7/288 (2%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAG 79
           F+ N PLK+  + + GG A++  +     D  Y L       +P+T++G GSN+++RD G
Sbjct: 21  FRLNEPLKEHAYTKLGGPADLYAEAACPEDAAYILKQAKRQGVPVTLIGNGSNMIIRDGG 80

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMI-VGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           IRG+VL LS    + I V     +   G+R    SL   AL H + G  F  GIPG+ GG
Sbjct: 81  IRGLVLSLSK--MNKISVTGETVIAEAGSRIIDVSL--KALEHSLSGMEFACGIPGTTGG 136

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLRG 197
           A YMNAGA   + S  + +   +  +G+   + RE+L   YR S +  K  II       
Sbjct: 137 ALYMNAGAYGGQISDVLQKTLVLTEEGSILELGREKLVLSYRKSIMAEKKFIILKAEFNL 196

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
             + +  ISA I      R++ QP++  + GS FK P GH A +LI+ SG +G   GGA+
Sbjct: 197 SFDCKEDISARIKENTEARKSKQPLEFPSCGSVFKRPPGHYAGKLIQDSGLQGKNIGGAE 256

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S  H  F+IN DN T  D   L E VRK V  + G+ LE E+  LG+
Sbjct: 257 VSRKHAGFIINKDNCTAKDYLALIEYVRKTVKEKHGVDLETEVITLGE 304


>gi|289167588|ref|YP_003445857.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus mitis
           B6]
 gi|288907155|emb|CBJ21989.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus mitis
           B6]
          Length = 301

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 100/293 (34%), Positives = 150/293 (51%), Gaps = 17/293 (5%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDA 78
           +F+E  PL   ++ + GG A+ +  P++  +L   +      +IP  ++G  SNI+VRD 
Sbjct: 17  RFKE--PLHSYSYTKVGGEADYLVFPRNRFELARVVKFANQENIPWMVLGNASNIIVRDG 74

Query: 79  GIRGVVL---RLSNAGFS--NIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           GIRG V+   +L+N       IE      +I   R         ALRH + GF F  GIP
Sbjct: 75  GIRGFVILCDKLNNVSVDGYTIEAEAGANLIETTRI--------ALRHSLTGFEFACGIP 126

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITH 192
           GS+GGA +MNAGA   E +  +     + + G    +  + L + YR S I +   ++  
Sbjct: 127 GSVGGAVFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAKDLAFGYRHSAIQESGAVVLS 186

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
                 P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G  
Sbjct: 187 AKFALAPGTHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGYR 246

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            GG ++SE H  FMIN  + T  D E L E V +KV   SG+ LE E++ LG+
Sbjct: 247 IGGVEVSEKHAGFMINVADGTAKDYEDLIESVIEKVKEHSGVTLEREVRILGE 299


>gi|219670072|ref|YP_002460507.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Desulfitobacterium
           hafniense DCB-2]
 gi|219540332|gb|ACL22071.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Desulfitobacterium
           hafniense DCB-2]
          Length = 293

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 92/286 (32%), Positives = 152/286 (53%), Gaps = 4/286 (1%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLK-YFLTLLPSDIPITIVGLGSNILV 75
           +RG+ +  +PL+++  +R GG AE +  P+   +L+  +L      IP  + G GSN+L 
Sbjct: 6   MRGRIEHRYPLQKLNTWRIGGLAETVCWPESEEELREIWLKCQEQGIPFRLFGRGSNVLF 65

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
            D G+ GV +  +    S   V +   + VGA  S   L+  A   G+ G  F  GIPG+
Sbjct: 66  PDEGLPGVTVISTGLAQS---VWDSERVTVGAGYSLARLSQEAADRGLTGLEFARGIPGT 122

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           +GGA  MNAGA+       + EV  +  +G    + +E +++ YR   +    I+   V 
Sbjct: 123 VGGAVVMNAGAHGGSIQDILEEVKILAPEGEVQRLAKEDIQFGYRECSLRDQAIVLEGVF 182

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
              P   ++I A ++     R+  QP++    GS F+NP G SA +LIE++G +G   GG
Sbjct: 183 HLKPGDPDVIQATMSENLARRKAAQPLELPNAGSVFRNPPGGSAGRLIEEAGWKGKRLGG 242

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           A++S  H NF++N  NAT  D+  L  +++K V +Q G+ L+ E++
Sbjct: 243 AQVSSKHANFIVNQGNATARDVLALIREIQKDVHHQFGVELKTEVR 288


>gi|302873285|ref|YP_003841918.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           cellulovorans 743B]
 gi|307688548|ref|ZP_07630994.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           cellulovorans 743B]
 gi|302576142|gb|ADL50154.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           cellulovorans 743B]
          Length = 305

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 99/287 (34%), Positives = 159/287 (55%), Gaps = 11/287 (3%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIRG 82
           N  +K  T F+ GG+ +++  P +I ++   + L  +D IP  ++G GSN+L++D GIRG
Sbjct: 23  NEYMKNHTSFKVGGSVDILVTPTNIEEIIEVIKLCKADRIPFFVMGNGSNLLIKDGGIRG 82

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           VV++L     +++EV N  E+ V +    K L+ +AL   + G  F  GIPG++GGA  M
Sbjct: 83  VVIKLEK--LNHVEV-NGNEIKVESGVLMKDLSKAALEARLTGLEFICGIPGTVGGAIAM 139

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK----DLIITHVVLRGF 198
           NAGA N E    +     +D  G    +   +L+  YR+S + K     L  T ++  G 
Sbjct: 140 NAGAYNGEIKDVIDSAVVLDEDGKILTLTNRELELGYRTSSVLKRHYIALSATFILKNG- 198

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
             + + I A I ++   RE  QP++  + GSTFK PTG+ A +LI+ SG +G   G A++
Sbjct: 199 --NYDEIKAIIDDLTRRREEKQPLEYASAGSTFKRPTGYFAGKLIQDSGLKGYSVGDAQV 256

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H  F+IN   AT  D+  +   V+K V  +  + LE E++ +G+
Sbjct: 257 SEKHSGFVINKGTATAKDVLAVIAHVQKVVKEKFSVELETEVRIMGE 303


>gi|238923104|ref|YP_002936617.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Eubacterium rectale
           ATCC 33656]
 gi|259509758|sp|C4ZEG7|MURB_EUBR3 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|238874776|gb|ACR74483.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Eubacterium rectale
           ATCC 33656]
          Length = 314

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 97/297 (32%), Positives = 158/297 (53%), Gaps = 15/297 (5%)

Query: 23  ENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIR 81
           ++ P+K+ T FR GG A+   +P D+  +   + +  + D+P+T++G GSN+LV D GIR
Sbjct: 20  QDEPMKKHTTFRIGGPADYYAEP-DMSRISKLIEMAKACDMPVTVIGNGSNLLVGDKGIR 78

Query: 82  GVVLRLSNAGFSNIEV----------RNHCEMIVGARCSGKSLANSALRH-GIGGFHFFY 130
           G+V+ +   G S IEV          +++C +I     +  +   +      + G  F  
Sbjct: 79  GLVIGIGK-GLSEIEVTEAVAQDFTAQDNCHIITAGAGAILAAVAAKAAEASLSGLEFAS 137

Query: 131 GIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLI 189
           GIPGS+GGA  MNAGA   E    +++   +   G    + R++L   YR S +  K  I
Sbjct: 138 GIPGSVGGAVVMNAGAYGGEIKDVLIDATVLTADGELKTVTRDELDLSYRHSIVPEKGYI 197

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
           +     R  P+ ++ I + +A +   R   QP++  + GSTFK P G+ A +LI  +G R
Sbjct: 198 VLSARFRLTPKPKDEIKSYMAELRAKRVEKQPLEYPSAGSTFKRPEGYFAGKLIMDAGLR 257

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           G   G A++SE HC F++N   A   D+  L + V++ V  Q G+ LE E+K +G+F
Sbjct: 258 GYSVGDAQVSEKHCGFVVNKGEAAAADVLTLIKDVQETVLKQFGVKLEPEVKMIGEF 314


>gi|198282523|ref|YP_002218844.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218666607|ref|YP_002424713.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198247044|gb|ACH82637.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218518820|gb|ACK79406.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 295

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 96/290 (33%), Positives = 151/290 (52%), Gaps = 2/290 (0%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDA 78
           G+ +   P+ + T +R GG A+  + P  + DL+ FL    +  PIT +GLGSN+LVRD 
Sbjct: 7   GRLRLGEPMHRHTSWRVGGPADRFYLPGTLEDLQAFLQHFAT-APITWLGLGSNVLVRDG 65

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           G+RG V+ L+N     I +     +  GA      +A+ A + G+ G  F  GIPG++GG
Sbjct: 66  GLRGTVICLANT-LDAITLDASGLIHAGAGAGAVKIAHFAAKAGLAGAEFLAGIPGTLGG 124

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGF 198
              MNAGAN+ +T   V     +   G    + R + +  YR  +           LR  
Sbjct: 125 CLTMNAGANDGDTWSLVEWAEVLHPDGRVQRLSRSEFQVGYREVQGQGAACFIAAGLRLS 184

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           PE  +I+   +      R   QP++  + GS F+NP G  A +LIE +  +GL +G A++
Sbjct: 185 PEDSDIVLQRLRAWQERRAATQPLEWPSCGSVFRNPPGDHAARLIEAAELKGLRYGDAEV 244

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFD 308
           S  H NF+IN   A   ++E L   V+++V N+ GI L+ E++ +G+  D
Sbjct: 245 STQHANFIINRGAARAEEIEALVANVQQEVLNRFGIELQPEMRVIGEVAD 294


>gi|154707354|ref|YP_001425280.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Coxiella burnetii
           Dugway 5J108-111]
 gi|189028922|sp|A9KER1|MURB_COXBN RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|154356640|gb|ABS78102.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Coxiella burnetii
           Dugway 5J108-111]
          Length = 316

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 109/317 (34%), Positives = 160/317 (50%), Gaps = 28/317 (8%)

Query: 11  RERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLG 70
           +E   +LRG+   + PL + T +R GG AE  ++P D+ DL+ FLT LPSD P+T +GLG
Sbjct: 3   KENFTRLRGELFCDHPLARYTSWRVGGKAERFYRPADLFDLQDFLTQLPSDEPLTWLGLG 62

Query: 71  SNILVRDAGIRGVVL----RLSNAGFSNIEV----------------RNHCEMIVGARCS 110
           SN+L+RD GI+G V+    RL      N ++                +       G  C+
Sbjct: 63  SNVLIRDGGIKGTVILTLNRLKELSVVNSQLVFREKSGTEDFFSGNGKTIIRAEAGVTCA 122

Query: 111 GKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVI 170
              LA   +  G+    FF GIPG++GGA  MNAGA   ET + V+ V  ++ +G     
Sbjct: 123 --KLAKFCVSQGLEDGAFFAGIPGTVGGALAMNAGAFGGETWRTVIGVETMNHQGEILKR 180

Query: 171 PREQLKYQYRSSEITKD--LIITHVVLR-GFPESQNIISAAIANVCHHRETVQPIKEKTG 227
             ++ K  YR  E  ++   I  +     G P+       AI  +   R   QPI + + 
Sbjct: 181 TPDEFKIHYRQVEGLENQFFIAGYFCFNHGDPDKA---KTAINALLKKRNLSQPIGKYSC 237

Query: 228 GSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKK 287
           GS F+NP G  A +LIE +G +G   G A++SE H NF++N  NA+  D+E L   V + 
Sbjct: 238 GSVFRNPPGDYAARLIESAGLKGKSIGNAEVSEKHANFILNKGNASAADIEALIHYVAQH 297

Query: 288 VFNQSGILLEWEIKRLG 304
           V    GI L  E+  +G
Sbjct: 298 VSQNHGIQLVKEVHIIG 314


>gi|297569449|ref|YP_003690793.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296925364|gb|ADH86174.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 326

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 105/293 (35%), Positives = 144/293 (49%), Gaps = 7/293 (2%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRD 77
           G      PL  +T FR GG A +M +P  + +L   L +L     P  ++G GSN+LV D
Sbjct: 32  GALSRREPLAPLTTFRVGGPAAIMARPAGLPELAALLAILQRRGCPWRVLGRGSNLLVAD 91

Query: 78  AGIRGVVL----RLSNAGFSNIEVRNHCEMI-VGARCSGKSLANSALRHGIGGFHFFYGI 132
            G  GVV+    RL          R    ++ V A CS  SL N     G+GG  F  GI
Sbjct: 92  RGYAGVVIALGRRLGKVELLPAGPREPLSLLRVEAGCSLASLLNWTAAQGLGGLEFLVGI 151

Query: 133 PGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE-ITKDLIIT 191
           PGS+GGAA MNAGA     S+ VV +  +   G   V P E+L + YR  + +  + ++ 
Sbjct: 152 PGSVGGAAMMNAGAFGQCLSERVVALELVSAAGLSRVEPGERLCFSYRRLQGVAPEEVVG 211

Query: 192 HVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGL 251
            V+L         I     +    R   QP    + GS FKNP G  A +LIE +G +GL
Sbjct: 212 AVILALASREPEDIKKTARHYLARRRAGQPRGVASAGSFFKNPPGDYAGRLIEAAGLKGL 271

Query: 252 EFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
             G A++S  H NF++N   A   ++  L EQV+  V  QSG+ LE E+  LG
Sbjct: 272 RVGQAQVSPRHANFLVNLGGARAAEVLALAEQVQAAVRRQSGVELEPEVHFLG 324


>gi|324990788|gb|EGC22723.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK353]
 gi|325687982|gb|EGD30002.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK72]
 gi|327459738|gb|EGF06078.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK1057]
 gi|332361377|gb|EGJ39181.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK1056]
          Length = 301

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 99/287 (34%), Positives = 151/287 (52%), Gaps = 11/287 (3%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRG 82
           N PL Q T+ + GG A+ +  P++ ++L   +      DIP  ++G  SNI+VRD GIRG
Sbjct: 19  NEPLSQYTYTKVGGAADFLVFPRNRYELARIVNFANQEDIPWMVLGNASNIIVRDGGIRG 78

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANS--ALRHGIGGFHFFYGIPGSIGGAA 140
            V+       +N+ V  +   ++ A      +  +  AL++ + GF F  GIPGS+GGA 
Sbjct: 79  FVIMFDK--LNNVAVDGY---MIEAEAGANLIQTTHIALQNSLTGFEFACGIPGSVGGAV 133

Query: 141 YMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI--TKDLIITHVVLRGF 198
           +MNAGA   E +  +V    +  +G    +    +K+ YR S +  T D++I+       
Sbjct: 134 FMNAGAYGGEIAHVLVSCKVLTPQGQVKTLDVRDMKFGYRHSLVQETGDIVISAKFALS- 192

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P     I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G   GG ++
Sbjct: 193 PGVHRTIRQEMERLTHLRELKQPLEYPSCGSVFKRPLGHFAGQLISEAGLKGHRIGGVEV 252

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H  FMIN D  T  D E L   V ++V   SGI LE E++ +G+
Sbjct: 253 SEKHAGFMINVDKGTAQDYENLIAHVIERVRENSGITLEREVRIIGE 299


>gi|307824833|ref|ZP_07655056.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacter
           tundripaludum SV96]
 gi|307734191|gb|EFO05045.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacter
           tundripaludum SV96]
          Length = 304

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 101/289 (34%), Positives = 145/289 (50%), Gaps = 3/289 (1%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRD 77
           +G+  +   L + T +R GG  + ++ P D  DL  F+  LP   P+  +GLGSN+LVRD
Sbjct: 16  KGRLLKREKLAKYTSWRVGGPVDQLYIPADRQDLIAFIKTLPESEPVFWMGLGSNLLVRD 75

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            GIRG V+  +      + +     + V A      +A      G+ G  F  GIPG++G
Sbjct: 76  GGIRGTVIN-TKGRLKEMSLTADGSVYVEAGVPCAHVARFCGERGLTGAEFLAGIPGTMG 134

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRG 197
           GA  MNAGA   ET   V  V  +   GN      E  K  YRS +   +      +L  
Sbjct: 135 GALKMNAGAFGGETWAIVKSVEMLGAVGNVTYRKSEDFKVSYRSVKGFDNEWFLSCLLT- 193

Query: 198 FPESQNIISA-AIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
             +   ++S   I  +   R   QP  + + GS FKNP G  A +LIE++G +G   GGA
Sbjct: 194 LQQGDTVVSQQKIKGLLEKRGATQPTNQPSCGSVFKNPEGDYAARLIEQTGLKGYAIGGA 253

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            +SE H NF++N  NAT  D+E L   V+ KV  Q GI+L+ E+  +GD
Sbjct: 254 CVSEKHANFIVNTGNATAADIEALIHYVQDKVEQQQGIVLQTEVCMVGD 302


>gi|313637866|gb|EFS03196.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria seeligeri
           FSL S4-171]
          Length = 298

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 99/284 (34%), Positives = 152/284 (53%), Gaps = 5/284 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTL-LPSDIPITIVGLGSNILVRDAGIRG 82
           N PL   T+ +TGGNA++   P+ I + +  ++    ++IP+TI+G GSN++++D GIRG
Sbjct: 16  NEPLSNYTYTKTGGNADIFVMPKTIEETQAIVSYCYQNNIPLTILGNGSNLIIKDGGIRG 75

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           V++ L      +I+ RN+ ++I  +       A  AL   + G  F  GIPGSIGGA +M
Sbjct: 76  VIVHLDL--LQSIK-RNNTQVIAMSGAKLIDTAKFALDESLSGLEFACGIPGSIGGALHM 132

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLRGFPES 201
           NAGA   E S  +     + + G    + R +LK  YR S I  K  I+         + 
Sbjct: 133 NAGAYGGEISDVLEAATVLTQAGELKKLKRSELKAAYRFSTIAEKKYIVLEATFALQLDD 192

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
           +N I   +  +   RE  QP++  + GS FK P GH A +LI+ SG +G   GGA++S  
Sbjct: 193 KNTIQVKMDELTAAREAKQPLEYPSCGSVFKRPPGHFAGKLIQDSGLQGHIIGGAQVSSK 252

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           H  F++N   AT  D   L   V+K V  +  + LE E+K +G+
Sbjct: 253 HAGFIVNIGGATATDYMNLIAHVQKTVREKFDVELETEVKIIGE 296


>gi|209525718|ref|ZP_03274255.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Arthrospira maxima
           CS-328]
 gi|209493887|gb|EDZ94205.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Arthrospira maxima
           CS-328]
          Length = 322

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 100/284 (35%), Positives = 156/284 (54%), Gaps = 8/284 (2%)

Query: 27  LKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRGVVL 85
           L  +T FR GG A+    PQ +  L   L      ++PIT++G GSN+LV D G+RG+V+
Sbjct: 36  LASLTSFRVGGPADWYTAPQRLDQLLACLEWANAEELPITLLGGGSNLLVSDRGLRGLVI 95

Query: 86  RLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAG 145
                  ++ + +   ++ VG+  S   LA  A R G  G  +  GIPG++GGA  MNAG
Sbjct: 96  GTRYLRHTHFD-QETGQLTVGSGASLPRLAWKAARMGWRGLEWAVGIPGTVGGAIVMNAG 154

Query: 146 ANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLR---GFPES 201
           A+   T+  +V  H ++R G   V+P E+L Y+YR+S +   D ++T    +   G+   
Sbjct: 155 AHISCTADILVNTHILERSGTLQVLPPEKLGYRYRTSNLQGSDRLVTQATFQLQPGYDPE 214

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
           Q  + A        R   QP    + GS F+NP  H A  LIE++G +G + GGA+++E 
Sbjct: 215 Q--VMAETTEHFQQRRLSQPYHLPSCGSVFRNPGPHKAGWLIEQTGLKGYKIGGAQVAER 272

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           H NF++N  +AT  D+  L   V+++V +Q   LLE E++ LG+
Sbjct: 273 HANFILNCGSATASDIFQLIHHVQERVQHQWSCLLEPEVRILGE 316


>gi|323351692|ref|ZP_08087346.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis VMC66]
 gi|322122178|gb|EFX93904.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis VMC66]
 gi|324993030|gb|EGC24950.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK405]
 gi|324995661|gb|EGC27573.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK678]
 gi|327461298|gb|EGF07629.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK1]
 gi|327489157|gb|EGF20950.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK1058]
          Length = 301

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 99/287 (34%), Positives = 151/287 (52%), Gaps = 11/287 (3%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRG 82
           N PL Q T+ + GG A+ +  P++ ++L   +      DIP  ++G  SNI+VRD GIRG
Sbjct: 19  NEPLSQYTYTKVGGAADFLVFPRNRYELARIVNFANQEDIPWMVLGNASNIIVRDGGIRG 78

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANS--ALRHGIGGFHFFYGIPGSIGGAA 140
            V+       +N+ V  +   ++ A      +  +  AL++ + GF F  GIPGS+GGA 
Sbjct: 79  FVIMFDK--LNNVAVDGY---MIEAEAGANLIQTTHIALQNSLTGFEFACGIPGSVGGAV 133

Query: 141 YMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI--TKDLIITHVVLRGF 198
           +MNAGA   E +  +V    +  +G    +    +K+ YR S +  T D++I+       
Sbjct: 134 FMNAGAYGGEIAHVLVSCKVLTPQGQVKTLDVRDMKFGYRHSLVQETGDIVISAKFALS- 192

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P     I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G   GG ++
Sbjct: 193 PGVHRTIRQEMERLTHLRELKQPLEYPSCGSVFKRPLGHFAGQLISEAGLKGHRIGGVEV 252

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H  FMIN D  T  D E L   V ++V   SGI LE E++ +G+
Sbjct: 253 SEKHAGFMINVDKGTAQDYENLIAHVIERVRENSGITLEREVRIIGE 299


>gi|332366598|gb|EGJ44342.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK1059]
          Length = 301

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 99/287 (34%), Positives = 151/287 (52%), Gaps = 11/287 (3%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRG 82
           N PL Q T+ + GG A+ +  P++ ++L   +      DIP  ++G  SNI+VRD GIRG
Sbjct: 19  NEPLSQYTYTKVGGAADFLVFPRNRYELARIVNFANQEDIPWMVLGNASNIIVRDGGIRG 78

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANS--ALRHGIGGFHFFYGIPGSIGGAA 140
            V+       +N+ V  +   ++ A      +  +  AL++ + GF F  GIPGS+GGA 
Sbjct: 79  FVIMFDK--LNNVAVDGY---MIEAEAGANLIQTTHIALQNSLTGFEFACGIPGSVGGAV 133

Query: 141 YMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI--TKDLIITHVVLRGF 198
           +MNAGA   E +  +V    +  +G    +    +K+ YR S +  T D++I+       
Sbjct: 134 FMNAGAYGGEIAHVLVSCKVLTPQGQLKTLDVRDMKFGYRHSLVQETGDIVISAKFALS- 192

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P     I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G   GG ++
Sbjct: 193 PGVHRTIRQEMERLTHLRELKQPLEYPSCGSVFKRPLGHFAGQLISEAGLKGHRIGGVEV 252

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H  FMIN D  T  D E L   V ++V   SGI LE E++ +G+
Sbjct: 253 SEKHAGFMINVDKGTAQDYENLIAHVIERVRENSGITLEREVRIIGE 299


>gi|260439216|ref|ZP_05793032.1| UDP-N-acetylmuramate dehydrogenase [Butyrivibrio crossotus DSM
           2876]
 gi|292808231|gb|EFF67436.1| UDP-N-acetylmuramate dehydrogenase [Butyrivibrio crossotus DSM
           2876]
          Length = 305

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 102/278 (36%), Positives = 146/278 (52%), Gaps = 4/278 (1%)

Query: 31  TWFRTGGNAEVMFQPQDIHDLK-YFLTLLPSDIPITIVGLGSNILVRDAGIRGVVLRLSN 89
           T F+ GG A+    P    D+K Y L      IP  ++G GSN+LV D G  G+++ L  
Sbjct: 26  TTFKVGGPAKYFVVPYRAEDIKKYILAAEEYKIPYYVIGNGSNLLVSDKGYDGMIIMLGR 85

Query: 90  AGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNC 149
               NI V N   +   A  S   L N+A RH + G  F  GIPG++GGA YMNAGA   
Sbjct: 86  -DLGNITV-NGDRITAEAGTSLARLFNTARRHSLSGLEFAAGIPGTLGGACYMNAGAYGG 143

Query: 150 ETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE-ITKDLIITHVVLRGFPESQNIISAA 208
           E    + +V  IDR+GN H   + +++  YR+S  I K  II    ++        ++  
Sbjct: 144 EMKDVLTKVITIDRQGNTHEYKQGEMELSYRNSIFIRKQEIILSAEMKLCKGDVEKMTHK 203

Query: 209 IANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMIN 268
           +  +   R+  QP++  + GSTFK P G  A +LIE+ G +G    GA++SE H  F+IN
Sbjct: 204 VNELLEKRKEKQPLEYPSAGSTFKRPEGDFAGRLIEECGLKGKGVNGAEVSEKHAGFIIN 263

Query: 269 ADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
            +NAT  D+      V   V  ++GI LE E++ LGDF
Sbjct: 264 RNNATARDIYDTINLVTDTVLEKTGIKLEPEVRLLGDF 301


>gi|332360328|gb|EGJ38140.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK49]
          Length = 301

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 99/287 (34%), Positives = 151/287 (52%), Gaps = 11/287 (3%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRG 82
           N PL Q T+ + GG A+ +  P++ ++L   +      DIP  ++G  SNI+VRD GIRG
Sbjct: 19  NEPLSQYTYTKVGGAADFLVFPRNRYELARIVNFANQEDIPWMVLGNASNIIVRDGGIRG 78

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANS--ALRHGIGGFHFFYGIPGSIGGAA 140
            V+       +N+ V  +   ++ A      +  +  AL++ + GF F  GIPGS+GGA 
Sbjct: 79  FVIMFDK--LNNVAVDGY---MIEAEAGANLIQTTHIALQNSLTGFEFACGIPGSVGGAV 133

Query: 141 YMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI--TKDLIITHVVLRGF 198
           +MNAGA   E +  +V    +  +G    +    +K+ YR S +  T D++I+       
Sbjct: 134 FMNAGAYGGEIAHVLVSCKVLTPQGEVKTLDVRDMKFGYRHSLVQETGDIVISAKFALS- 192

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P     I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G   GG ++
Sbjct: 193 PGVHRTIRQEMERLTHLRELKQPLEYPSCGSVFKRPLGHFAGQLISEAGLKGHRIGGVEV 252

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H  FMIN D  T  D E L   V ++V   SGI LE E++ +G+
Sbjct: 253 SEKHAGFMINVDKGTAQDYENLIAHVIERVRENSGITLEREVRIIGE 299


>gi|325689820|gb|EGD31824.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK115]
 gi|325696659|gb|EGD38548.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK160]
          Length = 301

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 98/287 (34%), Positives = 152/287 (52%), Gaps = 11/287 (3%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRG 82
           N PL Q T+ + GG A+ +  P++ ++L   +      +IP  ++G  SNI+VRD GIRG
Sbjct: 19  NEPLSQYTYTKVGGAADFLVFPRNRYELARIVNFANQENIPWMVLGNASNIIVRDGGIRG 78

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANS--ALRHGIGGFHFFYGIPGSIGGAA 140
            V+       +N+ V  +   ++ A      +  +  AL++ + GF F  GIPGS+GGA 
Sbjct: 79  FVIMFDK--LNNVAVDGY---MIEAEAGANLIQTTHIALQNSLTGFEFACGIPGSVGGAV 133

Query: 141 YMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI--TKDLIITHVVLRGF 198
           +MNAGA   E +  +V    +  +G    +    +K+ YR S +  T D++I+       
Sbjct: 134 FMNAGAYGGEIAHVLVSCKVLTPQGQVKTLDVRDMKFGYRHSLVQETGDIVISAKFALS- 192

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P     I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G   GG ++
Sbjct: 193 PGVHRTIRQEMERLTHLRELKQPLEYPSCGSVFKRPLGHFAGQLISEAGLKGHRIGGVEV 252

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE+H  FMIN D  T  D E L   V ++V   SGI LE E++ +G+
Sbjct: 253 SEMHAGFMINVDKGTAQDYENLIAHVIERVRENSGITLEREVRIIGE 299


>gi|301063254|ref|ZP_07203803.1| UDP-N-acetylmuramate dehydrogenase [delta proteobacterium NaphS2]
 gi|300442682|gb|EFK06898.1| UDP-N-acetylmuramate dehydrogenase [delta proteobacterium NaphS2]
          Length = 304

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 156/293 (53%), Gaps = 4/293 (1%)

Query: 15  KQLRGK-FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSN 72
           ++L GK  + N+P+ Q T ++ GG  EV+++ +D+  LK  +  L  + IP  ++G GSN
Sbjct: 10  EKLAGKGIRFNYPMHQRTTYQVGGPVEVLWEARDLLTLKEVIRYLSGESIPYHVLGKGSN 69

Query: 73  ILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMI-VGARCSGKSLANSALRHGIGGFHFFYG 131
           +LV D GI GV++ L  +  + I       +I  G       L     + G+ G  F  G
Sbjct: 70  LLVTDDGIDGVMILLKGS-LATINKGPEDSLIWAGGGLHLTDLMKWCRQKGMSGLEFMAG 128

Query: 132 IPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIIT 191
           IPG++GGA  MNAGA      + V  +  +   G + ++ R  LK+ YR   + K+  I 
Sbjct: 129 IPGTVGGAVVMNAGAFGHAIGEKVRNIQCVVPGGKEVLVNRSDLKFSYRRLHVQKNSAII 188

Query: 192 HVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGL 251
           +  L     + + +S  + +    R+  QP+   + GS FKNP G  A +LIEK+G +G 
Sbjct: 189 NACLELSRSTPDKVSLKMGDFLKTRKETQPLDAPSAGSVFKNPPGDHAGRLIEKAGLKGR 248

Query: 252 EFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           + G A +SE H N+++N  NAT  D+  L E VR +V   SGI LE EIK +G
Sbjct: 249 KIGDAMVSEKHANYILNKGNATAKDILSLMELVRFEVKRTSGIDLEPEIKIVG 301


>gi|125624149|ref|YP_001032632.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactococcus lactis
           subsp. cremoris MG1363]
 gi|187609725|sp|A2RKV4|MURB_LACLM RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|124492957|emb|CAL97920.1| MurB protein [Lactococcus lactis subsp. cremoris MG1363]
 gi|300070925|gb|ADJ60325.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactococcus lactis
           subsp. cremoris NZ9000]
          Length = 299

 Score =  159 bits (403), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 101/289 (34%), Positives = 154/289 (53%), Gaps = 9/289 (3%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYF-LTLLPSDIPITIVGLGSNILVRDA 78
           KF E  PL   T+ + GG A+++  P  I  L         +D P+T++G  SN++VRD 
Sbjct: 16  KFNE--PLSNYTYTKVGGPADILAFPATIEALTELSAKAKATDTPVTVLGNASNLIVRDG 73

Query: 79  GIRGVVLRLSNAGFSNIEVRNHC-EMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
           GIRG+V+ L      +++V  +  E   GA+   K +   A  + + GF F  GIPGSIG
Sbjct: 74  GIRGLVILLEK--LDSVKVAGYTIEAQAGAKL--KEVTQVAQANSLTGFEFACGIPGSIG 129

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLR 196
           GA +MNAGA   E SQ +V    +D +GN  V+   ++++ YR S I  K+LI+      
Sbjct: 130 GAVFMNAGAYGGEISQVLVSCKVMDAEGNVSVLSASEMQFGYRHSVIRDKNLIVLSAKFE 189

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
                   I   +  +   RE+ QP++  + GS FK P GH A QLI+++  +G   GG 
Sbjct: 190 LQAGDPTQIQNEMDRLNFLRESKQPLEYPSCGSVFKRPVGHFAGQLIQEAKLQGQRIGGV 249

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           ++S+ H  FM+N  +    D E L   V +KV   SG+ LE E++ +G+
Sbjct: 250 EVSKKHAGFMVNVADGNATDYEKLIALVIEKVKENSGVTLEPEVRIIGE 298


>gi|331268618|ref|YP_004395110.1| UDP-N-acetylmuramate dehydrogenase [Clostridium botulinum
           BKT015925]
 gi|329125168|gb|AEB75113.1| UDP-N-acetylmuramate dehydrogenase [Clostridium botulinum
           BKT015925]
          Length = 307

 Score =  159 bits (403), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 158/293 (53%), Gaps = 11/293 (3%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVR 76
           + + + N  +K  T FR GG A+V   P     ++  + +    ++P  I+G GSN+LVR
Sbjct: 17  KEEIKNNVLMKSYTSFRVGGPADVFVTPNSYEKIRDVIKICKQYNVPYFILGNGSNLLVR 76

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GIRGVV+  +      +E     ++I  +      +AN+AL++ + G  F +GIPGS+
Sbjct: 77  DGGIRGVVINFTKLNKILVE---ETKVIAESGAVLSMVANAALKNDLTGLEFAHGIPGSV 133

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD----LIITH 192
           GGA  MNAGA N E  Q +     ID  G    I +E++   YR+S I K+    L  T 
Sbjct: 134 GGAVAMNAGAYNGEICQVIESATIIDSDGEIREICKEEMDLSYRNSLILKNGYIVLKATF 193

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
            + RG  +S   I A + ++   R+  QP++  + GSTFK P G+ A +LIE S  +G  
Sbjct: 194 KLQRGEHDS---IKARMDDLMRRRKEKQPLEYPSAGSTFKRPEGYFAAKLIEDSELKGAH 250

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            G A++S  H  F+IN  NA+  D+  L E V+K V ++  + L  E++ +G+
Sbjct: 251 VGDAEVSVKHSGFIINKGNASAKDILDLIELVKKTVNDKFQVALNTEVRIVGE 303


>gi|314933046|ref|ZP_07840412.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus caprae C87]
 gi|313654365|gb|EFS18121.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus caprae C87]
          Length = 310

 Score =  159 bits (403), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 93/282 (32%), Positives = 156/282 (55%), Gaps = 5/282 (1%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTL-LPSDIPITIVGLGSNILVRDAGIRGVV 84
           PLK+ T+  TGG A+    P    +++  ++    ++IP+T +G GSNI++R+ GIRG+V
Sbjct: 28  PLKRYTYTETGGEADFYLSPTKNEEVQAIVSYAYNNNIPVTYLGNGSNIIIREGGIRGIV 87

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           L L      +I+V +   +I G+  +   ++  A  H + G  F  GIPGSIGGA +MNA
Sbjct: 88  LSL--LSLDHIDVSDDA-IIAGSGAAIIDVSRVARDHVLTGLEFACGIPGSIGGAVFMNA 144

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFPESQN 203
           GA   E    +     ++ KG+   +  E+L+  YR+S + K  L++        P + +
Sbjct: 145 GAYGGEVKDCIDYALCVNEKGDLIKLTTEELELDYRNSIVQKKHLVVLEAAFTLMPGNLD 204

Query: 204 IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHC 263
            I A + ++   RE+ QP++  + GS F+ P GH A +LI+ S  +G   GG ++S+ H 
Sbjct: 205 EIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHFAGKLIQDSDLQGHRIGGVEVSKKHA 264

Query: 264 NFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            FM+N DN T  D E L   V++ V ++  + L  E++ +G+
Sbjct: 265 GFMVNVDNGTATDYEDLIHHVQRTVKDKFDVELNTEVRIIGE 306


>gi|327473935|gb|EGF19348.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK408]
          Length = 301

 Score =  159 bits (403), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 99/287 (34%), Positives = 151/287 (52%), Gaps = 11/287 (3%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRG 82
           N PL Q T+ + GG A+ +  P++ ++L   +      DIP  ++G  SNI+VRD GIRG
Sbjct: 19  NEPLSQYTYTKVGGAADFLVFPRNRYELARVVNFANQEDIPWMVLGNASNIIVRDGGIRG 78

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANS--ALRHGIGGFHFFYGIPGSIGGAA 140
            V+       +N+ V  +   ++ A      +  +  AL++ + GF F  GIPGS+GGA 
Sbjct: 79  FVIMFDK--LNNVTVDGY---MIEAEAGANLIQTTHIALQNSLTGFEFACGIPGSVGGAV 133

Query: 141 YMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI--TKDLIITHVVLRGF 198
           +MNAGA   E +  +V    +  +G    +    +K+ YR S +  T D++I+       
Sbjct: 134 FMNAGAYGGEIAHVLVSCKVLTPQGQVKTLDVRDMKFGYRHSLVQETGDIVISAKFALS- 192

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P     I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G   GG ++
Sbjct: 193 PGVHRTIRQEMERLTHLRELKQPLEYPSCGSVFKRPLGHFAGQLISEAGLKGHRIGGVEV 252

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H  FMIN D  T  D E L   V ++V   SGI LE E++ +G+
Sbjct: 253 SEKHAGFMINVDKGTAQDYENLIAHVIERVRENSGITLEREVRIIGE 299


>gi|220918998|ref|YP_002494302.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|254764128|sp|B8J8F0|MURB_ANAD2 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|219956852|gb|ACL67236.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 329

 Score =  159 bits (403), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 102/301 (33%), Positives = 146/301 (48%), Gaps = 4/301 (1%)

Query: 12  ERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLG 70
           E  +++RG+   + PL   T  R GG A+++ +P D   L   L  +    +P++++G G
Sbjct: 6   EIARRVRGEHLRDAPLAPRTAVRVGGPADLLCRPADGDALSALLRAVRELGVPLSVLGGG 65

Query: 71  SNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFY 130
           +N LV DAG+RGVVLRL    F   E  +   +++ A      L   A  HG+ G  F  
Sbjct: 66  ANTLVADAGVRGVVLRLPQE-FPG-ESTDGDTLVLSAGAPISRLPARAHAHGLVGMEFLG 123

Query: 131 GIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLII 190
           GIPG++GGAA MNAG    E    V  +      G   V P   L Y YR+  +    +I
Sbjct: 124 GIPGTLGGAAAMNAGTRLGEMKDVVTRLELATPDGTGFV-PASALGYAYRTCRLPPGAVI 182

Query: 191 THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRG 250
             V +R  P       A +      R   QP+   T GSTF NP G  A +L+E  G +G
Sbjct: 183 ARVEVRLHPGDVAASEALMREDRERRRATQPLYRPTFGSTFTNPPGEYAGRLVEAVGLKG 242

Query: 251 LEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQ 310
              G A  S +H NF+ N   AT  D+  L    R +V  + GI LE E++ LG+F +  
Sbjct: 243 HRVGNAIWSPVHANFVTNLGGATARDVLALVRLARARVQERFGIALETEVRLLGEFLEED 302

Query: 311 I 311
           +
Sbjct: 303 L 303


>gi|194398159|ref|YP_002038036.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae G54]
 gi|254765583|sp|B5E5P6|MURB_STRP4 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|194357826|gb|ACF56274.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae G54]
          Length = 316

 Score =  159 bits (403), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 149/293 (50%), Gaps = 17/293 (5%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDA 78
           +FQE  P    ++ + GG A+ +  P++  +L   +      +IP  ++G  SNI+VRD 
Sbjct: 17  RFQE--PXHSYSYTKVGGEADYLVFPRNRFELARVVKFANQENIPWMVLGNASNIIVRDG 74

Query: 79  GIRGVVL---RLSNAGFS--NIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           GIRG V+   +L+N       IE      +I   R         ALRH + GF F  GIP
Sbjct: 75  GIRGFVILCDKLNNVSVDGYTIEAEAGANLIETTRI--------ALRHSLTGFEFACGIP 126

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITH 192
           GS+GGA +MNAGA   E +  +     + + G    +  + L + YR S I +   ++  
Sbjct: 127 GSVGGAVFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAKDLAFGYRHSAIQESGAVVLS 186

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
           V     P +  +I   +  + H RE  QP++  + GS FK P GH A QLI + G +G  
Sbjct: 187 VKFALAPGTHQVIKQEMDRLTHLRELKQPLEYPSCGSXFKRPVGHFAXQLISEXGLKGYR 246

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            GG ++SE H  FMIN  + T  D E L + V +KV   SGI LE E++ LG+
Sbjct: 247 IGGVEVSEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGITLEREVRILGE 299


>gi|297617273|ref|YP_003702432.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Syntrophothermus
           lipocalidus DSM 12680]
 gi|297145110|gb|ADI01867.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Syntrophothermus
           lipocalidus DSM 12680]
          Length = 299

 Score =  159 bits (402), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 97/284 (34%), Positives = 150/284 (52%), Gaps = 8/284 (2%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIRGVV 84
           P+K  T FR GG A+ M  P  +  +   ++   + D+P  ++G G+NILVRD GIRGVV
Sbjct: 19  PMKNHTSFRIGGPADCMVFPSSVEQVNQVISWCRNRDVPFLVIGSGTNILVRDKGIRGVV 78

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           ++L+    S + V     +   A      ++  A   G+ G  F  GIPGS+GGA YMNA
Sbjct: 79  IKLAER-LSGLAVEGQS-IYAEAGVLLSHVSQLAAEKGLSGLEFAEGIPGSVGGAVYMNA 136

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD---LIITHVVLRGFPES 201
           GA + E    + EV  +D +GN  V+   +  + YR S   ++   ++   ++L+  P  
Sbjct: 137 GAYDGEMKNVIYEVTALDSEGNLAVLTSGECDFDYRKSIFQRNGYVILAARMLLK--PGD 194

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
              I+A +      R   QP++  + GS F+ P G+    LIE+ G +G   GGA+IS  
Sbjct: 195 TREITAKMNEFAERRRQKQPLEFPSAGSVFRRPEGYFVGPLIEELGLKGYHIGGAEISTK 254

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           H  F+IN   AT  D+  L E V+ +V   +G+ LE EI+ +G+
Sbjct: 255 HAGFIINTGGATAEDVLALIELVQARVRESTGLNLEPEIRIVGE 298


>gi|322391763|ref|ZP_08065228.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus peroris ATCC
           700780]
 gi|321145243|gb|EFX40639.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus peroris ATCC
           700780]
          Length = 301

 Score =  159 bits (402), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 101/303 (33%), Positives = 156/303 (51%), Gaps = 17/303 (5%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVG 68
           L+E  + +  +F E  PLK  T+ + GG A+ +  P++ +++   +      +IP  ++G
Sbjct: 7   LKETLEGIDIRFDE--PLKTYTYTKVGGKADYLVFPRNRYEMARVVKFANQENIPWMVLG 64

Query: 69  LGSNILVRDAGIRGVVL---RLSNAGFS--NIEVRNHCEMIVGARCSGKSLANSALRHGI 123
             SNI+VR+ G+RG V+   +L+N       IE      +I   R         ALRH +
Sbjct: 65  NASNIIVREGGVRGFVIMCDKLNNVTVDGYTIEAEAGANLIETTRI--------ALRHSL 116

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            GF F  GIPGS+GGA +MNAGA   E +  +     + ++G    +  + L + YR S 
Sbjct: 117 TGFEFACGIPGSVGGAVFMNAGAYGGEIAHILQSCKVLTKEGAIETLSAKDLAFGYRHSL 176

Query: 184 ITKD-LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
           +     I+        P +  +I   +  + H RE  QP++  + GS FK P GH A QL
Sbjct: 177 VQDSGAIVLSAKFALAPGNHQVIKQEMERLTHLRELKQPLEYPSCGSVFKRPVGHFAGQL 236

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           I ++G +G   GG ++SE H  FMIN  + T  D E L E V +KV   SG+ LE E++ 
Sbjct: 237 ISEAGLKGYRIGGVEVSEKHAGFMINVADGTARDYEDLIESVIEKVKEHSGVTLEREVRI 296

Query: 303 LGD 305
           LG+
Sbjct: 297 LGE 299


>gi|27467438|ref|NP_764075.1| putative UDP-N-acetylenolpyruvoylglucosamine reductase
           [Staphylococcus epidermidis ATCC 12228]
 gi|251810172|ref|ZP_04824645.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           epidermidis BCM-HMP0060]
 gi|282875681|ref|ZP_06284552.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus epidermidis
           SK135]
 gi|293368200|ref|ZP_06614829.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|27314981|gb|AAO04117.1|AE016745_216 putative UDP-N-acetylenolpyruvoylglucosamine reductase
           [Staphylococcus epidermidis ATCC 12228]
 gi|251806224|gb|EES58881.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           epidermidis BCM-HMP0060]
 gi|281295708|gb|EFA88231.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus epidermidis
           SK135]
 gi|291317623|gb|EFE58040.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|329723273|gb|EGG59803.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus epidermidis
           VCU144]
 gi|329736870|gb|EGG73135.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus epidermidis
           VCU028]
 gi|329738005|gb|EGG74229.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus epidermidis
           VCU045]
          Length = 310

 Score =  159 bits (402), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 95/282 (33%), Positives = 151/282 (53%), Gaps = 5/282 (1%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRGVV 84
           PLK+ T+  TGG A+    P    +++  +     + IP+T +G GSNI++R+ GIRG+V
Sbjct: 28  PLKRYTYTETGGEADFYLSPTKNEEVQAIVKFAHENSIPVTYLGNGSNIIIREGGIRGIV 87

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           L L     ++IE  +   +I G+  +   ++N A  H + G  F  GIPGSIGGA +MNA
Sbjct: 88  LSL--LSLNHIETSDDA-IIAGSGAAIIDVSNVARDHVLTGLEFACGIPGSIGGAVFMNA 144

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLRGFPESQN 203
           GA   E    +     ++ KG+   +   +L+  YR+S +  K L++        P   +
Sbjct: 145 GAYGGEVKDCIDYALCVNEKGDLLKLTTAELELDYRNSVVQQKHLVVLEAAFTLEPGKLD 204

Query: 204 IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHC 263
            I A + ++   RE+ QP++  + GS F+ P GH A +LI+ S  +G   GG ++S  H 
Sbjct: 205 EIQAKMDDLTERRESKQPLEFPSCGSVFQRPPGHFAGKLIQDSNLQGYRIGGVEVSTKHA 264

Query: 264 NFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            FM+N DN T  D E L   V+K V  +  + L  E++ +GD
Sbjct: 265 GFMVNVDNGTATDYEALIHHVQKIVKEKFDVELNTEVRIIGD 306


>gi|212213337|ref|YP_002304273.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Coxiella burnetii
           CbuG_Q212]
 gi|254764174|sp|B6J2Q1|MURB_COXB2 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|212011747|gb|ACJ19128.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Coxiella burnetii
           CbuG_Q212]
          Length = 316

 Score =  159 bits (402), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 109/317 (34%), Positives = 160/317 (50%), Gaps = 28/317 (8%)

Query: 11  RERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLG 70
           +E   +LRG+   + PL + T +R GG AE  ++P D+ DL+ FLT LPSD P+T +GLG
Sbjct: 3   KENFTRLRGELFCDHPLARYTSWRVGGKAERFYRPADLFDLQDFLTQLPSDEPLTWLGLG 62

Query: 71  SNILVRDAGIRGVVL----RLSNAGFSNIEV----------------RNHCEMIVGARCS 110
           SN+L+RD GI+G V+    RL      N ++                +       G  C+
Sbjct: 63  SNVLIRDGGIKGTVILTLNRLKELSVVNSQLVFREKSGTEDFFSGNGKTIIRAEAGVTCA 122

Query: 111 GKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVI 170
              LA   +  G+    FF GIPG++GGA  MNAGA   ET + V+ V  ++ +G     
Sbjct: 123 --KLAKFCVSQGLEDGAFFAGIPGTVGGALAMNAGAFGGETWRTVIGVETMNHQGEILKR 180

Query: 171 PREQLKYQYRSSEITKD--LIITHVVLR-GFPESQNIISAAIANVCHHRETVQPIKEKTG 227
             ++ K  YR  E  ++   I  +     G P+       AI  +   R   QPI + + 
Sbjct: 181 TPDEFKIHYRQVEGLENQFFIAGYFCFNHGDPDKA---KTAINALLKKRNLSQPIGKYSC 237

Query: 228 GSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKK 287
           GS F+NP G  A +LIE +G +G   G A++SE H NF++N  NA+  D+E L   V + 
Sbjct: 238 GSVFRNPPGDYAARLIESAGLKGKSIGNAEVSEKHANFILNKGNASAADIEALIHYVAQH 297

Query: 288 VFNQSGILLEWEIKRLG 304
           V    GI L  E+  +G
Sbjct: 298 VSQIHGIQLVKEVNIIG 314


>gi|86160191|ref|YP_466976.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Anaeromyxobacter
           dehalogenans 2CP-C]
 gi|123496865|sp|Q2IG34|MURB_ANADE RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|85776702|gb|ABC83539.1| UDP-N-acetylmuramate dehydrogenase [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 329

 Score =  159 bits (402), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 102/302 (33%), Positives = 147/302 (48%), Gaps = 4/302 (1%)

Query: 12  ERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLG 70
           E  +++RG+   + PL   T  R GG A+++ +P D   L   L  +    +P++++G G
Sbjct: 6   EIARRVRGEHLRDAPLAPRTAVRVGGPADLLCRPADGDALSALLGAVRELGVPLSVLGGG 65

Query: 71  SNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFY 130
           +N LV DAG+RGVVLRL    F   E  +   +++ A      L   A  HG+ G  F  
Sbjct: 66  ANTLVADAGVRGVVLRLPQ-DFPG-ESTDGDTLVLSAGAPIARLPARAHAHGLVGMEFLG 123

Query: 131 GIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLII 190
           GIPG++GGAA MNAG    E    V  +      G   V P   L Y YR+  +    ++
Sbjct: 124 GIPGTLGGAAAMNAGTRLGEMKDVVTRLELATADGAGFV-PAAALGYAYRTCRLPPGAVV 182

Query: 191 THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRG 250
             V +R  P       A +      R   QP+   T GSTF NP G  A +LIE  G +G
Sbjct: 183 ARVEVRLRPGDVAASEALMREDRERRRATQPLDRPTFGSTFTNPPGEYAGRLIEAVGLKG 242

Query: 251 LEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQ 310
              GGA  S +H NF+ N   AT  D+  L    R +V  + GI LE E++ +G+F   +
Sbjct: 243 HRVGGAVWSPVHANFVTNLGGATARDVLALIRLARARVKERFGIALETEVRLMGEFPPDE 302

Query: 311 IV 312
           + 
Sbjct: 303 LA 304


>gi|125717878|ref|YP_001035011.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           sanguinis SK36]
 gi|166222946|sp|A3CMQ6|MURB_STRSV RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|125497795|gb|ABN44461.1| UDP-N-acetylenolpyruvoylglucosamine reductase, putative
           [Streptococcus sanguinis SK36]
          Length = 301

 Score =  159 bits (402), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 99/287 (34%), Positives = 151/287 (52%), Gaps = 11/287 (3%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRG 82
           N PL Q T+ + GG A+ +  P++ ++L   +      DIP  ++G  SNI+VRD GIRG
Sbjct: 19  NEPLSQYTYTKVGGAADFLVFPRNRYELVRIVNFANQEDIPWMVLGNASNIIVRDGGIRG 78

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANS--ALRHGIGGFHFFYGIPGSIGGAA 140
            V+       +N+ V  +   ++ A      +  +  AL++ + GF F  GIPGS+GGA 
Sbjct: 79  FVIMFDK--LNNVAVDGY---MIEAEAGANLIQTTHIALQNSLTGFEFACGIPGSVGGAV 133

Query: 141 YMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI--TKDLIITHVVLRGF 198
           +MNAGA   E +  +V    +  +G    +    +K+ YR S +  T D++I+       
Sbjct: 134 FMNAGAYGGEIAHVLVSCKVLTPQGQVKTLDVRDMKFGYRHSLVQETGDIVISAKFALS- 192

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P     I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G   GG ++
Sbjct: 193 PGVHRTIRQEMERLTHLRELKQPLEYPSCGSVFKRPLGHFAGQLISEAGLKGHRIGGVEV 252

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H  FMIN D  T  D E L   V ++V   SGI LE E++ +G+
Sbjct: 253 SEKHAGFMINVDKGTAQDYENLIAHVIERVRENSGITLEREVRIIGE 299


>gi|261405667|ref|YP_003241908.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Paenibacillus sp.
           Y412MC10]
 gi|261282130|gb|ACX64101.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Paenibacillus sp.
           Y412MC10]
          Length = 301

 Score =  159 bits (402), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 101/285 (35%), Positives = 154/285 (54%), Gaps = 6/285 (2%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIRG 82
           N PL + T ++ GG A+ +  P++   LK  +TLL +  IP T +G GSN+LV D GIRG
Sbjct: 19  NEPLAKYTTWKIGGPADCLIVPENKEQLKELVTLLHAHHIPWTQLGRGSNMLVADKGIRG 78

Query: 83  VVLRLSNAGFSNIEVRNHCEMIV-GARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAY 141
            V++L   GF   E+R   E +  G   S   L+  A + G+ G  F  GIPGS+GGA Y
Sbjct: 79  AVIKLGQ-GFE--ELRFDGETVTAGGSLSFVKLSVLAGKQGLSGLEFAGGIPGSVGGAVY 135

Query: 142 MNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLRGFPE 200
           MNAGA+  + S+       +   G       + + + YR S +  +  I+T  V      
Sbjct: 136 MNAGAHGSDVSRIFKSADIVLETGELVTYAAKDMAFDYRHSILHERKGIVTEAVFELRQG 195

Query: 201 SQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISE 260
            +  I+A +A+    R   QP++  T GS F+NP G  A +LIE +G +GL  GGA++S 
Sbjct: 196 DRKEITAVMASYKDRRRRTQPLQSATAGSVFRNPPGDHAARLIEAAGLKGLRIGGAEVSL 255

Query: 261 LHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            H NF+ N   AT  D+  L E++++ +  ++GI +  E+  LG+
Sbjct: 256 QHANFIENTGQATAEDVLALMERIKETISEKNGIQMVPEVYVLGE 300


>gi|15615127|ref|NP_243430.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus halodurans
           C-125]
 gi|20139213|sp|Q9K9T1|MURB_BACHD RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|10175184|dbj|BAB06283.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus halodurans
           C-125]
          Length = 301

 Score =  159 bits (402), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 99/289 (34%), Positives = 152/289 (52%), Gaps = 4/289 (1%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRD 77
           G+ + N  L   T ++ GG A+V   P DI  LK  + L+  +     ++G GSNILV D
Sbjct: 14  GEVRVNESLAHHTTWKIGGPADVFVIPNDIEGLKNTMKLIQETGCKWRVIGRGSNILVSD 73

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G+RGV ++L + G  ++EV N   + VGA      LA    R G+ G  F  GIPGS+G
Sbjct: 74  KGLRGVTIKL-DKGLDHLEV-NGESITVGAGFPVVKLATVISRQGLAGLEFAAGIPGSVG 131

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLR 196
           GA +MNAGA+  + SQ + + H +   G    +  E++ + YR+S + K D I    +  
Sbjct: 132 GAVFMNAGAHGSDISQILTKAHVLFPDGTLRWLTNEEMAFSYRTSLLQKNDGICVEAIFS 191

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
                +  I   +     +R   QP    T GS F+NP    A QLIEK+G +G + GGA
Sbjct: 192 LTRGDKEDIKKKLQKNKDYRRDTQPWNHPTCGSVFRNPLPEYAGQLIEKAGLKGYQIGGA 251

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +IS +H NF++N  +A   D+  L   V+  +  Q  + +E E++ +G+
Sbjct: 252 QISTMHANFIVNTGDAKAADVLALIHHVKDTIQKQYQMNMETEVELIGE 300


>gi|328946192|gb|EGG40337.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK1087]
          Length = 301

 Score =  159 bits (402), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 98/287 (34%), Positives = 151/287 (52%), Gaps = 11/287 (3%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRG 82
           N PL Q T+ + GG A+ +  P++ ++L   +      DIP  ++G  SNI+VRD GIRG
Sbjct: 19  NEPLSQYTYTKVGGAADFLVFPRNRYELARIVNFANQEDIPWMVLGNASNIIVRDGGIRG 78

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANS--ALRHGIGGFHFFYGIPGSIGGAA 140
            V+       +N+ V  +   ++ A      +  +  A+++ + GF F  GIPGS+GGA 
Sbjct: 79  FVIMFDK--LNNVAVDGY---MIEAEAGANLIQTTHIAMQNSLTGFEFACGIPGSVGGAV 133

Query: 141 YMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI--TKDLIITHVVLRGF 198
           +MNAGA   E +  +V    +  +G    +    +K+ YR S +  T D++I+       
Sbjct: 134 FMNAGAYGGEIAHVLVSCKVLTPQGQVKTLDVRDMKFGYRHSLVQETGDIVISAKFALS- 192

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P     I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G   GG ++
Sbjct: 193 PGVHRTIRQEMERLTHLRELKQPLEYPSCGSVFKRPLGHFAGQLISEAGLKGHRIGGVEV 252

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H  FMIN D  T  D E L   V ++V   SGI LE E++ +G+
Sbjct: 253 SEKHAGFMINVDKGTAQDYENLIAHVIERVRENSGITLEREVRIIGE 299


>gi|153207161|ref|ZP_01945940.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Coxiella burnetii
           'MSU Goat Q177']
 gi|165918382|ref|ZP_02218468.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Coxiella burnetii
           RSA 334]
 gi|212219385|ref|YP_002306172.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Coxiella burnetii
           CbuK_Q154]
 gi|254764173|sp|B6J5K1|MURB_COXB1 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|120576822|gb|EAX33446.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Coxiella burnetii
           'MSU Goat Q177']
 gi|165917888|gb|EDR36492.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Coxiella burnetii
           RSA 334]
 gi|212013647|gb|ACJ21027.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Coxiella burnetii
           CbuK_Q154]
          Length = 316

 Score =  159 bits (402), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 109/317 (34%), Positives = 160/317 (50%), Gaps = 28/317 (8%)

Query: 11  RERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLG 70
           +E   +LRG+   + PL + T +R GG AE  ++P D+ DL+ FLT LPSD P+T +GLG
Sbjct: 3   KENFTRLRGELFCDHPLARYTSWRVGGKAERFYRPADLFDLQDFLTQLPSDEPLTWLGLG 62

Query: 71  SNILVRDAGIRGVVL----RLSNAGFSNIEV----------------RNHCEMIVGARCS 110
           SN+L+RD GI+G V+    RL      N ++                +       G  C+
Sbjct: 63  SNVLIRDGGIKGTVILTLNRLKELSVVNSQLAFREKSGTEDFFSGNGKTIIRAEAGVTCA 122

Query: 111 GKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVI 170
              LA   +  G+    FF GIPG++GGA  MNAGA   ET + V+ V  ++ +G     
Sbjct: 123 --KLAKFCVSQGLEDGAFFAGIPGTVGGALAMNAGAFGGETWRTVIGVETMNHQGEILKR 180

Query: 171 PREQLKYQYRSSEITKD--LIITHVVLR-GFPESQNIISAAIANVCHHRETVQPIKEKTG 227
             ++ K  YR  E  ++   I  +     G P+       AI  +   R   QPI + + 
Sbjct: 181 TPDEFKIHYRQVEGLENQFFIAGYFCFNHGDPDKAK---TAINALLKKRNLSQPIGKYSC 237

Query: 228 GSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKK 287
           GS F+NP G  A +LIE +G +G   G A++SE H NF++N  NA+  D+E L   V + 
Sbjct: 238 GSVFRNPPGDYAARLIESAGLKGKSIGSAEVSEKHANFILNKGNASAADIEALIHYVAQH 297

Query: 288 VFNQSGILLEWEIKRLG 304
           V    GI L  E+  +G
Sbjct: 298 VSQIHGIQLVKEVHIIG 314


>gi|295401246|ref|ZP_06811218.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|294976653|gb|EFG52259.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus
           thermoglucosidasius C56-YS93]
          Length = 307

 Score =  159 bits (402), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 101/285 (35%), Positives = 162/285 (56%), Gaps = 11/285 (3%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIRGVV 84
           PLK  T  + GG A+ +  P+    +   + L     +P T++G GSN++VRD GIRG+V
Sbjct: 25  PLKYHTLVKIGGKADFLVWPETYEQVVEVIRLKEKHRLPFTLLGNGSNVIVRDGGIRGIV 84

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           ++L +   + I+V    ++I  +    K+++  AL H + G  F  GIPGS+GGA  MNA
Sbjct: 85  VQLKH--LTEIKVEGE-KIIAQSGADIKAVSRVALEHSLTGLEFACGIPGSVGGAIMMNA 141

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK--DLIITHV--VLRGFPE 200
           GA + E    V  V  + + G Q ++ ++ L+  YR+S I+K  D+++  V  + +G P+
Sbjct: 142 GAYDGEIKDVVDHVKVVTQTGEQKILRKDDLQLGYRTSIISKTNDIVLEAVFQLKKGDPQ 201

Query: 201 SQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISE 260
               I   + ++   RE+ QP++  + GS FK P G+ A +LI+ SG +G   GGA++S 
Sbjct: 202 K---IKEKMDDLTFRRESKQPLEYPSVGSVFKRPPGYFAGKLIQDSGLQGKGVGGAEVST 258

Query: 261 LHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            H  F+IN +NAT  D     E VRK V  + G+ LE E+K +G+
Sbjct: 259 KHAGFIINKNNATASDYIATIELVRKTVKEKFGVDLELEVKIIGE 303


>gi|323465091|gb|ADX77244.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           pseudintermedius ED99]
          Length = 309

 Score =  159 bits (402), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 96/282 (34%), Positives = 148/282 (52%), Gaps = 5/282 (1%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTL-LPSDIPITIVGLGSNILVRDAGIRGVV 84
           PLK+ T+  TGG+A+    P+   D++  +      DIP+T +G GSNI++RD GIRG+V
Sbjct: 27  PLKRYTYTETGGDADFYISPERYEDVQKVVKYAYEHDIPVTYLGNGSNIIIRDGGIRGIV 86

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           L L +    N  V +   +I G+  +   ++  A    + G  F  GIPGSIGGA YMNA
Sbjct: 87  LSLLSL---NHIVTSDATIIAGSGAAIIDVSRKARDVSLTGLEFACGIPGSIGGAVYMNA 143

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFPESQN 203
           GA   E    +     ID +G    +   +L+  YR+S I +   ++        P  Q 
Sbjct: 144 GAYGGEVKDVIDYALVIDERGELLKLTHNELELDYRNSIIQQQHYVVLEAAFTLTPGKQE 203

Query: 204 IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHC 263
            I   + ++   RE+ QP++  + GS F+ P GH A QLI+ +  +G   GG ++S  H 
Sbjct: 204 DIQEKMDDLTERRESKQPLEYPSCGSVFRRPPGHFAGQLIQNADLQGHRIGGVEVSRKHA 263

Query: 264 NFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            FM+N ++ T  D E L   V+  V  + GI LE E++ +G+
Sbjct: 264 GFMVNVNHGTATDYENLIHHVQNVVKEKFGIELEREVRIIGE 305


>gi|57866357|ref|YP_187998.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           epidermidis RP62A]
 gi|71151973|sp|Q5HQZ1|MURB_STAEQ RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|71152968|sp|Q8CPZ7|MURB_STAES RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|57637015|gb|AAW53803.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           epidermidis RP62A]
          Length = 306

 Score =  159 bits (401), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 95/282 (33%), Positives = 151/282 (53%), Gaps = 5/282 (1%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRGVV 84
           PLK+ T+  TGG A+    P    +++  +     + IP+T +G GSNI++R+ GIRG+V
Sbjct: 24  PLKRYTYTETGGEADFYLSPTKNEEVQAIVKFAHENSIPVTYLGNGSNIIIREGGIRGIV 83

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           L L     ++IE  +   +I G+  +   ++N A  H + G  F  GIPGSIGGA +MNA
Sbjct: 84  LSL--LSLNHIETSDDA-IIAGSGAAIIDVSNVARDHVLTGLEFACGIPGSIGGAVFMNA 140

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLRGFPESQN 203
           GA   E    +     ++ KG+   +   +L+  YR+S +  K L++        P   +
Sbjct: 141 GAYGGEVKDCIDYALCVNEKGDLLKLTTAELELDYRNSVVQQKHLVVLEAAFTLEPGKLD 200

Query: 204 IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHC 263
            I A + ++   RE+ QP++  + GS F+ P GH A +LI+ S  +G   GG ++S  H 
Sbjct: 201 EIQAKMDDLTERRESKQPLEFPSCGSVFQRPPGHFAGKLIQDSNLQGYRIGGVEVSTKHA 260

Query: 264 NFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            FM+N DN T  D E L   V+K V  +  + L  E++ +GD
Sbjct: 261 GFMVNVDNGTATDYEALIHHVQKIVKEKFDVELNTEVRIIGD 302


>gi|29653495|ref|NP_819187.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Coxiella burnetii
           RSA 493]
 gi|161830959|ref|YP_001596105.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Coxiella burnetii
           RSA 331]
 gi|47605865|sp|Q83F16|MURB_COXBU RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|189028923|sp|A9NA46|MURB_COXBR RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|29540757|gb|AAO89701.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Coxiella burnetii
           RSA 493]
 gi|161762826|gb|ABX78468.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Coxiella burnetii
           RSA 331]
          Length = 316

 Score =  159 bits (401), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 109/317 (34%), Positives = 160/317 (50%), Gaps = 28/317 (8%)

Query: 11  RERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLG 70
           +E   +LRG+   + PL + T +R GG AE  ++P D+ DL+ FLT LPSD P+T +GLG
Sbjct: 3   KENFTRLRGELFCDHPLARYTSWRVGGKAERFYRPADLFDLQDFLTQLPSDEPLTWLGLG 62

Query: 71  SNILVRDAGIRGVVL----RLSNAGFSNIEV----------------RNHCEMIVGARCS 110
           SN+L+RD GI+G V+    RL      N ++                +       G  C+
Sbjct: 63  SNVLIRDGGIKGTVILTLNRLKELSVVNSQLVFREKSGTEDFFSGNGKTIIRAEAGVTCA 122

Query: 111 GKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVI 170
              LA   +  G+    FF GIPG++GGA  MNAGA   ET + V+ V  ++ +G     
Sbjct: 123 --KLAKFCVSQGLEDGAFFAGIPGTVGGALAMNAGAFGGETWRTVIGVETMNHQGEILKR 180

Query: 171 PREQLKYQYRSSEITKD--LIITHVVLR-GFPESQNIISAAIANVCHHRETVQPIKEKTG 227
             ++ K  YR  E  ++   I  +     G P+       AI  +   R   QPI + + 
Sbjct: 181 TPDEFKIHYRQVEGLENQFFIAGYFCFNHGDPDKAK---TAINALLKKRNLSQPIGKYSC 237

Query: 228 GSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKK 287
           GS F+NP G  A +LIE +G +G   G A++SE H NF++N  NA+  D+E L   V + 
Sbjct: 238 GSVFRNPPGDYAARLIESAGLKGKSIGNAEVSEKHANFILNKGNASAADIEALIHYVAQH 297

Query: 288 VFNQSGILLEWEIKRLG 304
           V    GI L  E+  +G
Sbjct: 298 VSQIHGIQLVKEVHIIG 314


>gi|196247921|ref|ZP_03146623.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus sp.
           G11MC16]
 gi|187609780|sp|A4ILI2|MURB_GEOTN RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|196212705|gb|EDY07462.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus sp.
           G11MC16]
          Length = 304

 Score =  159 bits (401), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 100/282 (35%), Positives = 151/282 (53%), Gaps = 5/282 (1%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIRGVV 84
           P+K  T  R GG A+ +  P+    +   L L    ++P T++G GSN+++RD G+RG+V
Sbjct: 25  PMKHHTLVRIGGKADFLVWPETYEQVVDVLRLKEEYELPFTLLGNGSNVIIRDGGLRGIV 84

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           ++L +    N   R    +I  +    K+++  AL   + G  F  GIPGS+GGA  MNA
Sbjct: 85  MQLKHL---NRIWREGNNIIAQSGADIKAVSRFALEQHLTGLEFACGIPGSVGGAIMMNA 141

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL-IITHVVLRGFPESQN 203
           GA   E    +  V      G    +  E+L+  YR+S I++   I+  VV    P    
Sbjct: 142 GAYGGEVKDVLDHVKVATLTGELKTLTNEELELGYRTSLISRTHDIVLEVVFALQPGDYG 201

Query: 204 IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHC 263
            I A + ++   RE+ QP++  + GS FK P G+ A +LI+ SG +G  FGGA++S  H 
Sbjct: 202 QIKAKMDDLTFQRESKQPLEYPSVGSVFKRPPGYFAGKLIQDSGLQGKGFGGAEVSTKHA 261

Query: 264 NFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            F+IN +NAT  D     E VRK V  + G+ LE E+K LG+
Sbjct: 262 GFIINKNNATAADYIATIEMVRKTVKEKFGVELELEVKILGE 303


>gi|182414452|ref|YP_001819518.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Opitutus terrae
           PB90-1]
 gi|177841666|gb|ACB75918.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Opitutus terrae
           PB90-1]
          Length = 796

 Score =  159 bits (401), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 97/280 (34%), Positives = 150/280 (53%), Gaps = 3/280 (1%)

Query: 31  TWFRTGGNAEVMFQPQDIHDLKYFL-TLLPSDIPITIVGLGSNILVRDAGIRGVVLRLSN 89
           T  R GG A +  +P  + DL+  L T     + + I+G GSN+LV D G+ G+V+ L++
Sbjct: 515 TTMRVGGPARIYAEPASVADLQALLRTATAVPVEVFILGRGSNLLVPDEGVEGLVISLAH 574

Query: 90  AGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNC 149
             ++  EVR    + VGA    K+L   A + G+ GF F  GIPG++GGA  MNAGA   
Sbjct: 575 EAWAQFEVRPDGRIWVGAGLRLKNLCGLAAKAGLSGFEFLEGIPGNVGGALRMNAGAMGG 634

Query: 150 ETSQYVVEVHGIDRKGNQHVIPREQLKYQYR-SSEITKDLIITHVVLRGFPESQNIISAA 208
                V E+  +   G    +PR  LK  YR   E+ + + +  ++ R    +  +++  
Sbjct: 635 WMFDVVDELQLMTMAGEVQSLPRTALKVTYRHCPELERAIGLGALLRRPAYANAEVVNQQ 694

Query: 209 IANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMIN 268
           IA     R+  QP +E + G  FKNP G SA +LI++SG +G   G A++S +H NF+IN
Sbjct: 695 IAAYRTKRQATQP-REPSAGCIFKNPPGTSAGRLIDESGLKGTRVGDAEVSPVHANFIIN 753

Query: 269 ADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFD 308
             +AT  ++  L  +VR +V    GI LE E+   G  ++
Sbjct: 754 RGHATAAEVLELVRRVRARVKEVKGINLEPEVLLYGKLWE 793


>gi|82703607|ref|YP_413173.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrosospira
           multiformis ATCC 25196]
 gi|123543906|sp|Q2Y640|MURB_NITMU RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|82411672|gb|ABB75781.1| UDP-N-acetylmuramate dehydrogenase [Nitrosospira multiformis ATCC
           25196]
          Length = 347

 Score =  159 bits (401), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 104/312 (33%), Positives = 157/312 (50%), Gaps = 25/312 (8%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RG+ + + P+K  T +R GG+AE ++ P D+ DL  FL  LP + P+ ++GLGSN+LVR
Sbjct: 15  VRGELRHDQPMKNYTSWRAGGSAERIYLPGDLPDLAAFLRGLPWNEPVYVMGLGSNLLVR 74

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHC-EMIV--GARCSGKSLANSALRHGIGGFHFFYGIP 133
           D G+RG V+ L +A  + +++ +   +M++  GA  +   +A  A   G+GG  F  GIP
Sbjct: 75  DGGVRGSVVVL-HARLNGLQLESDMGQMLIYAGAGVACAKVARFAALQGLGGAEFLAGIP 133

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR------------- 180
           G++GGA  MNAG    ET   V  V  IDR G     P    +  YR             
Sbjct: 134 GTVGGALAMNAGCYGTETWDIVSSVQTIDRLGILRRRPPGNYEIGYRHVALKAEKSSGSQ 193

Query: 181 ---SSEITKDLIITHVVLRG----FP-ESQNIISAAIANVCHHRETVQPIKEKTGGSTFK 232
              + E   D  +T     G     P +    +   I  +   R   QP+     GS F+
Sbjct: 194 KMGARENAPDDSLTDEWFSGAWFALPRDHAAAVRQKIKELLARRIHTQPLNLPNAGSVFR 253

Query: 233 NPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQS 292
           NP    A +LIE  G +    GGA +S  H NF++N   AT  D+E +   VR+ V  Q+
Sbjct: 254 NPENDKAARLIESCGLKEFRIGGAMVSPRHANFIVNTGGATASDIEAVIAAVRETVKKQT 313

Query: 293 GILLEWEIKRLG 304
           G+ L+ E++ +G
Sbjct: 314 GVELKQEVRIIG 325


>gi|167750259|ref|ZP_02422386.1| hypothetical protein EUBSIR_01233 [Eubacterium siraeum DSM 15702]
 gi|167656821|gb|EDS00951.1| hypothetical protein EUBSIR_01233 [Eubacterium siraeum DSM 15702]
          Length = 301

 Score =  159 bits (401), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 110/296 (37%), Positives = 161/296 (54%), Gaps = 16/296 (5%)

Query: 15  KQLRGKF----QENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP----SDIPITI 66
           +Q  GK+     +N P+K  T FR GG  +VM +   I+       L+     +DI   +
Sbjct: 8   EQTAGKYGAVVLKNEPMKNHTSFRIGGPCDVMIK---INCEALLCELIKQCRENDIKYYV 64

Query: 67  VGLGSNILVRDAGIRGVVLRLSNAGFSNIEVR-NHCEMIVGARCSGKSLANSALRHGIGG 125
           VG GSNILV D G++GVVL L  + F ++ V   + E   GA  S  ++   AL + + G
Sbjct: 65  VGRGSNILVCDEGLQGVVL-LIGSDFGSVRVDGEYIECNAGA--SLAAVCAVALENELTG 121

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT 185
             F YGIPGS+GGA +MNAGA   E    VV    I  KG+   IP E+++  YR S  +
Sbjct: 122 LEFAYGIPGSVGGAIFMNAGAYGGEMKDVVVSCRYITEKGDIKEIPLEKMELSYRHSFFS 181

Query: 186 -KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIE 244
            ++L IT V ++     +  I   +  +   R+  QP++  + GSTFK P G  A +LIE
Sbjct: 182 ERNLCITSVKMKLTKGEREKIKDRMDTLMERRKDKQPLEYPSAGSTFKRPEGDFAARLIE 241

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
             G +G   GGA++S  H  F+IN DNAT  D+  + + V++KV  Q+G+ LE E+
Sbjct: 242 VCGLKGTACGGAEVSTKHSGFIINKDNATFDDVMGVVDIVKQKVKEQTGVTLECEV 297


>gi|310642986|ref|YP_003947744.1| udp-n-acetylenolpyruvoylglucosamine reductase [Paenibacillus
           polymyxa SC2]
 gi|309247936|gb|ADO57503.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Paenibacillus
           polymyxa SC2]
          Length = 301

 Score =  159 bits (401), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 100/289 (34%), Positives = 152/289 (52%), Gaps = 4/289 (1%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRD 77
           GK  E+ PL + T ++ GG A+ +  P     L   L L     IP   +G GSN+LV D
Sbjct: 14  GKVLEHEPLSKYTTWKIGGPADALVIPDTKEQLAKILKLASEHGIPWMQLGRGSNMLVSD 73

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            GIRG+V++L   GF  +   +  +++ G   S   L   A + G+ G  F  GIPGS+G
Sbjct: 74  KGIRGLVIKL-GPGFDYVRFEDE-QIVAGGGVSLVKLCVMASKQGLSGLEFAGGIPGSVG 131

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL-IITHVVLR 196
           GA YMNAGA+  + SQ       +   G   V   E + + YR S + +   ++T  V +
Sbjct: 132 GAVYMNAGAHGSDVSQIFQSAEIVLDTGELAVYNAEDMHFSYRHSVLHEQRGMVTEAVFQ 191

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
                +  ISAA+A     R   QP++    GS F+NP G  A +LIE +G +GL+ GGA
Sbjct: 192 MKRGDREEISAALAAFKDRRRLTQPLQLACAGSVFRNPPGDYAARLIESAGLKGLKAGGA 251

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           ++S  H NF++N   AT  D+  L + ++  + +Q+GI L  E+  +G+
Sbjct: 252 EVSVQHANFIVNTGQATAEDVLTLMKHIQSTISSQTGIKLVPEVFVVGE 300


>gi|163815356|ref|ZP_02206731.1| hypothetical protein COPEUT_01520 [Coprococcus eutactus ATCC 27759]
 gi|158449330|gb|EDP26325.1| hypothetical protein COPEUT_01520 [Coprococcus eutactus ATCC 27759]
          Length = 307

 Score =  159 bits (401), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 97/285 (34%), Positives = 151/285 (52%), Gaps = 8/285 (2%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIRGVV 84
           P+ + T FR GGNA+   +P +  ++   + +    +IP  I+G GSN+LV D G RG++
Sbjct: 27  PMSRHTTFRIGGNADYFVKPGNADEVAAVIVVCREYNIPYFILGNGSNLLVSDDGYRGMI 86

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL--RHGIGGFHFFYGIPGSIGGAAYM 142
           + +      N++       I+ A+     +  S +   + + G  F  GIPG+IGGA YM
Sbjct: 87  INI----MDNMDSVTVDGRIITAQAGAMLVRVSVMARDNALTGLEFASGIPGTIGGAVYM 142

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLRGFPES 201
           NAGA   E    V  V  ID  G  + +  E++ + YR S +  + LI+  V L     S
Sbjct: 143 NAGAYGGEMKNVVKTVRAIDEYGRIYELDSEKMDFSYRHSIVEERKLIVLEVTLELEHGS 202

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
           +  I   +  +   R + QP++  + GSTFK P G+ A +LI  +G RG   GGA+++E 
Sbjct: 203 REAIDDRMKELAEARRSKQPLEYPSAGSTFKRPEGYFAGKLIMDAGLRGYSVGGAQVAEK 262

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           HC F+IN   AT  D+  L   V+  V ++ G+ LE E+K LG+F
Sbjct: 263 HCGFVINKGGATASDVVELIRDVQHDVDDKFGVTLEPEVKMLGEF 307


>gi|148989511|ref|ZP_01820870.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP6-BS73]
 gi|147925054|gb|EDK76135.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP6-BS73]
          Length = 295

 Score =  159 bits (401), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 100/293 (34%), Positives = 151/293 (51%), Gaps = 17/293 (5%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDA 78
           +F+E  PL   ++ + GG A+ +  P++  +L   +      +IP  ++G  SNI+VRD 
Sbjct: 11  RFKE--PLHSYSYTKVGGEADYLVFPRNRFELARLVKFANQENIPWMVLGNASNIIVRDG 68

Query: 79  GIRGVVL---RLSNAGFS--NIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           GIRG V+   +L+N       IE      +I   R         ALRH + GF F  GIP
Sbjct: 69  GIRGFVILCDKLNNVSVDGYTIEAEAGANLIETTRI--------ALRHSLTGFEFACGIP 120

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITH 192
           GS+GGA +MNAGA   E +  +     + + G    +  + L + YR S I +   ++  
Sbjct: 121 GSVGGAVFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAKDLAFGYRHSAIQESGAVVLS 180

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
           V     P +  +I   +  + H RE  QP++  + GS FK P G+ A QLI ++G +G  
Sbjct: 181 VKFALAPGTHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGYFAGQLISEAGLKGYR 240

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            GG ++SE H  FMIN  + T  D E L + V +KV   SGI LE E++ LG+
Sbjct: 241 IGGVEVSEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGITLEREVRILGE 293


>gi|288553160|ref|YP_003425095.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           pseudofirmus OF4]
 gi|288544320|gb|ADC48203.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           pseudofirmus OF4]
          Length = 305

 Score =  159 bits (401), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 96/289 (33%), Positives = 157/289 (54%), Gaps = 6/289 (2%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRD 77
           G  + + PL Q T ++ GG A+V+ +P +I  L   + ++  + +P   +G GSN+LV D
Sbjct: 14  GTIKVSEPLSQHTTWKIGGPADVLVEPANIEGLINTMEIVKEAGVPWRAIGRGSNLLVSD 73

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            GI GVV++L   G  ++E+ +  E+ VG       L     R G+ G  F  GIPGS+G
Sbjct: 74  EGIEGVVIKLGK-GLDHLEIDDE-EITVGGGYPLIKLVTIISRQGLSGLEFAGGIPGSVG 131

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI--TKDLIITHVVL 195
           GA +MNAGA+  E +  +++   +   G    I    +++ YR+S +   K + +  V  
Sbjct: 132 GAVFMNAGAHGAEVADILIKARVLYPDGRLEWIKGSDMQFSYRTSRLQHEKGICVEAVFK 191

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
               E + I+     N  + RET QP    T GS F+NP  + A  LIE++G +G + GG
Sbjct: 192 LKKGEKEEIVKHMQKNKDYRRET-QPWSHPTCGSVFRNPLPNHAGALIEEAGLKGYQIGG 250

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           A+IS++H NF++N DNA   D+  L +  ++ +    GI +E E++ +G
Sbjct: 251 AQISDMHANFIVNVDNAKAEDVLNLIKHAKETIKESKGIEMETEVEMIG 299


>gi|138894478|ref|YP_001124931.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus
           thermodenitrificans NG80-2]
 gi|134265991|gb|ABO66186.1| UDP-N-acetylenolpyruvoyl-glucosamine reductase [Geobacillus
           thermodenitrificans NG80-2]
          Length = 325

 Score =  158 bits (400), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 100/282 (35%), Positives = 151/282 (53%), Gaps = 5/282 (1%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIRGVV 84
           P+K  T  R GG A+ +  P+    +   L L    ++P T++G GSN+++RD G+RG+V
Sbjct: 46  PMKHHTLVRIGGKADFLVWPETYEQVVDVLRLKEEYELPFTLLGNGSNVIIRDGGLRGIV 105

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           ++L +    N   R    +I  +    K+++  AL   + G  F  GIPGS+GGA  MNA
Sbjct: 106 MQLKHL---NRIWREGNNIIAQSGADIKAVSRFALEQHLTGLEFACGIPGSVGGAIMMNA 162

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL-IITHVVLRGFPESQN 203
           GA   E    +  V      G    +  E+L+  YR+S I++   I+  VV    P    
Sbjct: 163 GAYGGEVKDVLDHVKVATLTGELKTLTNEELELGYRTSLISRTHDIVLEVVFALQPGDYG 222

Query: 204 IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHC 263
            I A + ++   RE+ QP++  + GS FK P G+ A +LI+ SG +G  FGGA++S  H 
Sbjct: 223 QIKAKMDDLTFQRESKQPLEYPSVGSVFKRPPGYFAGKLIQDSGLQGKGFGGAEVSTKHA 282

Query: 264 NFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            F+IN +NAT  D     E VRK V  + G+ LE E+K LG+
Sbjct: 283 GFIINKNNATAADYIATIEMVRKTVKEKFGVELELEVKILGE 324


>gi|332976295|gb|EGK13153.1| UDP-N-acetylmuramate dehydrogenase [Desmospora sp. 8437]
          Length = 302

 Score =  158 bits (400), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 90/285 (31%), Positives = 158/285 (55%), Gaps = 5/285 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRG 82
           N PL + T ++ GG A+++  P D  +L+  ++++    +P  ++G GSN+LVRD GIRG
Sbjct: 19  NEPLSRHTTWKVGGPADLLVYPADKGELERAMSVIRKHGLPWRVIGRGSNLLVRDGGIRG 78

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
            V+++ N G  +++V     +  G   S   L+    RHG+ G  F  GIPG++GGA +M
Sbjct: 79  AVIKMGN-GLDHLQVEGD-RVTAGGGYSFVKLSVMVARHGLTGLEFAGGIPGTVGGAVFM 136

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL--IITHVVLRGFPE 200
           NAGA+  E  + + +   +   G   V   E+L++ YR+S + K+   ++T    +    
Sbjct: 137 NAGAHGAEVCEVLEKAEVLLENGEWAVFHNEELQFSYRTSILQKERRGVVTEATFQLKEG 196

Query: 201 SQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISE 260
           ++  ++A +A     R   QP++++  GS F+NP G  + +LIE +G +G   G A++S 
Sbjct: 197 NREEVAAVMARFKDRRRQTQPLQDRCAGSVFRNPPGDHSGRLIEAAGLKGYRIGDAEVST 256

Query: 261 LHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            H NF+IN  NAT  D+  L   +   +  + G+ L  E++ +G+
Sbjct: 257 RHANFIINRGNATANDVLTLIRHIIGTIEQKYGVTLVPEVQVVGE 301


>gi|322421360|ref|YP_004200583.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacter sp. M18]
 gi|320127747|gb|ADW15307.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacter sp. M18]
          Length = 301

 Score =  158 bits (400), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 101/290 (34%), Positives = 149/290 (51%), Gaps = 5/290 (1%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILV 75
           +RG    + P+ + T  + GG A++  +P D+ DLK  + L+  S IP  +VG G N+LV
Sbjct: 15  VRGGVLWDEPMSRHTSLKVGGPADLFLEPADLDDLKRAMELIRRSSIPFLVVGSGFNLLV 74

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD GIRG V+ L      ++       + VGA  + ++L   A  + +GG  F  GIPGS
Sbjct: 75  RDGGIRGCVISLKR--LDSMIQMPGARLEVGAGVTNQALTRFAAENCLGGVEFLSGIPGS 132

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
            GGA  MNAGA+  ET Q V E     R     V    +++Y YR   +    ++    L
Sbjct: 133 FGGALAMNAGAHGGETMQRV-ETLTTLRDAEVLVRKGSEVEYGYRFLRLEPGEVVLGARL 191

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           R  P  + +I   +      R   Q +     GS FKNP G SAW LI+++G RG   GG
Sbjct: 192 RLEPAERRLIEERMQEYISKRGG-QRVGFPNAGSFFKNPPGGSAWSLIDQAGLRGKTVGG 250

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           A++SE+H NF++N   A   D   L   ++ +V   SG  LE E++ +G+
Sbjct: 251 AQVSEVHTNFLVNRGGARAADFLTLAALIKLRVKETSGAELEEEVRVVGE 300


>gi|315282308|ref|ZP_07870743.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria marthii FSL
           S4-120]
 gi|313614044|gb|EFR87753.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria marthii FSL
           S4-120]
          Length = 298

 Score =  158 bits (400), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 101/284 (35%), Positives = 150/284 (52%), Gaps = 5/284 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRG 82
           N PL   T+ +TGG A++   P+ I + +  ++    + IP+TI+G GSN++++D GIRG
Sbjct: 16  NEPLSNYTYTKTGGMADIFVMPKTIEETQEVVSYCHQNKIPLTILGNGSNLIIKDGGIRG 75

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           V+L L       IE RN+ ++   +       A  AL   + G  F  GIPGSIGGA +M
Sbjct: 76  VILHLDL--LQTIE-RNNTQITAMSGAKLIDTAKFALDESLSGLEFACGIPGSIGGALHM 132

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLRGFPES 201
           NAGA   E S  +     + + G    + R +LK  YR S I  K  I+         E 
Sbjct: 133 NAGAYGGEISDVLEAATVLTQTGELKKLKRSELKAAYRFSTIAEKHYIVLDATFSLALED 192

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
           +N I A +  +   RE+ QP++  + GS FK P GH A +LI+ SG +G   GGA++S  
Sbjct: 193 KNAIQAKMDELTAARESKQPLEYPSCGSVFKRPPGHFAGKLIQDSGLQGHIIGGAQVSLK 252

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           H  F++N   AT  D   L   V+K V  +  + LE E+K +G+
Sbjct: 253 HAGFIVNIGGATATDYMDLIAYVQKTVREKFDVELETEVKIIGE 296


>gi|210631756|ref|ZP_03296998.1| hypothetical protein COLSTE_00883 [Collinsella stercoris DSM 13279]
 gi|210159876|gb|EEA90847.1| hypothetical protein COLSTE_00883 [Collinsella stercoris DSM 13279]
          Length = 316

 Score =  158 bits (400), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 99/289 (34%), Positives = 160/289 (55%), Gaps = 9/289 (3%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFL-TLLPSDIPITIVGLGSNILVRDAGIRGVV 84
           P++  T F+ GG A+VM  P     L   L T    ++P+T+VG GS++LV D G+RGVV
Sbjct: 29  PMRDHTTFKIGGPADVMVTPTTPEALVRVLDTCYLGNVPVTVVGNGSDLLVGDRGVRGVV 88

Query: 85  LRLSNAGFSNIEV-RNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMN 143
           + L +   S +E+  +   +   A    + +A +A   G+ G    +GIP ++GGA +MN
Sbjct: 89  VLLRD-NLSEVELDASRWRVTAQAGALLRDVALAAADAGLSGMEPLWGIPATVGGACFMN 147

Query: 144 AGANNCETSQYV--VEVHGIDRKGNQ-HVIPRE--QLKYQYRSSEITKD-LIITHVVLRG 197
           AGA +  T + +  V  +   ++GN+  V+  E   L   YR S +  D LI+     + 
Sbjct: 148 AGAYDGTTGEVLESVRAYVPSKQGNRGSVVTLEARDLNMGYRKSRVHDDGLIVISATFKL 207

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P +  ++ AA+ +    RE  QP++  + GSTFK P G+ A +LI  +G RG   G A+
Sbjct: 208 SPSTPAMVRAAMDDYQARREEKQPLEMASAGSTFKRPAGYFAGKLIMDAGLRGARVGDAQ 267

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           +SE HC F++N  +A+  D+  L E V+ +V  Q G+ LE E++ +G+F
Sbjct: 268 VSEKHCGFVVNTGHASAKDVLGLIEHVQSEVKAQFGVDLEPEVRMVGEF 316


>gi|322385403|ref|ZP_08059048.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus cristatus ATCC
           51100]
 gi|321270662|gb|EFX53577.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus cristatus ATCC
           51100]
          Length = 300

 Score =  158 bits (400), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 101/286 (35%), Positives = 152/286 (53%), Gaps = 9/286 (3%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAGIRG 82
           N PL Q T+ + GG A+ +  P++ ++L   + L    +IP  ++G  SNI+VRD GIRG
Sbjct: 19  NEPLSQYTYTKVGGAADFLVFPRNRYELARIVKLANRENIPWLVLGNSSNIIVRDGGIRG 78

Query: 83  VVLRLSNAGFSNIEVRNHC-EMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAY 141
            V+       +N+ V  +  E   GA  +  +    AL H + GF F  GIPGS+GGA +
Sbjct: 79  FVIMFDK--LNNVTVDGYTIEAEAGANLTQTT--RIALHHSLTGFEFACGIPGSVGGAVF 134

Query: 142 MNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI--TKDLIITHVVLRGFP 199
           MNAGA   E +  +V    +  +G    +    +++ YR S I  T D++I+        
Sbjct: 135 MNAGAYGGEIAHVLVSCKVLTPEGEIKTLDARDMRFGYRHSLIQETGDIVISAKFGLAPG 194

Query: 200 ESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKIS 259
             QNI    +  + + RE  QP++  + GS FK P GH A QLI ++G +G   GG ++S
Sbjct: 195 VHQNI-RQEMERLTYLRELKQPLEYPSCGSVFKRPLGHFAGQLISEAGLKGYRIGGVEVS 253

Query: 260 ELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           E H  FM+N D+ T  D E L   V K V   SG+ LE E++ +G+
Sbjct: 254 EKHAGFMVNVDHGTASDYEELIAHVIKTVEEHSGVTLEREVRIIGE 299


>gi|139439499|ref|ZP_01772931.1| Hypothetical protein COLAER_01957 [Collinsella aerofaciens ATCC
           25986]
 gi|133775052|gb|EBA38872.1| Hypothetical protein COLAER_01957 [Collinsella aerofaciens ATCC
           25986]
          Length = 320

 Score =  158 bits (400), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 108/295 (36%), Positives = 154/295 (52%), Gaps = 16/295 (5%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFL-TLLPSDIPITIVGLGSNILVRDAGIRGVV 84
           P+++ T F+ GG A+V   P     L   L T    D+P+TIVG GS++LV D GIRGVV
Sbjct: 29  PMREHTTFKIGGPADVFVTPDTEQGLVATLDTCYRCDLPLTIVGNGSDLLVGDKGIRGVV 88

Query: 85  LRLSNAGFSNIEVR-NHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMN 143
           + L   G S+I +   H     GA  S   +A +A    + G     GIPGS+GGA YMN
Sbjct: 89  VALGE-GLSDITIDGTHVTAAAGALLS--DVAAAAAEACLTGMEPISGIPGSVGGACYMN 145

Query: 144 AGANNCETSQYV--VEVHGIDRK--------GNQHVIPREQLKYQYRSSEITKD-LIITH 192
           AGA     +  +  V V+   R+        GN      ++L   YR S I  D  I+  
Sbjct: 146 AGAYGACMADVLEYVRVYKPARQLDDGTRGSGNIIEFDVDELNLGYRKSRIADDGFIVLS 205

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
                 P +  +I A + +    RE  QP+   + GSTFK P G+ A +LI  +G RG  
Sbjct: 206 ATFNLTPGNAAMIKADMDDYRQRREDKQPLDMPSAGSTFKRPEGYFAGKLIMDAGLRGHA 265

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFF 307
            GGA++SE HC F++NAD+AT  D++ L   ++  V +Q  + LE E+ R+G+F 
Sbjct: 266 VGGAQVSEKHCGFIVNADHATAADVDELIRHIQATVKDQFNVDLEPEVHRVGEFL 320


>gi|281416828|ref|ZP_06247848.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           thermocellum JW20]
 gi|281408230|gb|EFB38488.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           thermocellum JW20]
          Length = 304

 Score =  158 bits (400), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 95/292 (32%), Positives = 160/292 (54%), Gaps = 12/292 (4%)

Query: 22  QENF----PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVR 76
           QEN     P+K  T F+ GG A+++  P  +  L   L L  +  +P+ ++G G+N++VR
Sbjct: 16  QENVKLDEPMKNHTSFKVGGPADILVTPVSVSQLSQILKLCKNKSVPVFVMGNGTNLIVR 75

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCS--GKSLANSALRHGIGGFHFFYGIPG 134
           D GIRGVV+++    F N+      + I+ A        ++  A  +G+ G  F  GIPG
Sbjct: 76  DKGIRGVVVKI----FDNLNQFTVKDDIITAYAGILLSRVSTIAYENGLTGLEFACGIPG 131

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL-IITHV 193
           ++GGA  MNAGA   E    VVE   +D+ G   V+  +  ++ YR+S I K+  I+   
Sbjct: 132 TLGGAVAMNAGAYGGEMKDVVVETEYMDKDGEIRVVRDDGHQFGYRTSFIQKNSGIVIKT 191

Query: 194 VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEF 253
           +++    ++  I A + ++   R+  QP++  + GS FK P G+ A +LIE  G RG   
Sbjct: 192 LMKLKKGNKEEIKALMDDLTQRRQEKQPLEMPSAGSIFKRPEGYFAGKLIEDCGLRGHRI 251

Query: 254 GGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           GGA++S+ HC F++N  +A   D+  L E +R  V  + G+ ++ E++ +G+
Sbjct: 252 GGAEVSQKHCGFIVNTGDAKAKDILDLIEYIRNTVKMKFGVDMQTEVRIVGE 303


>gi|197124218|ref|YP_002136169.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Anaeromyxobacter sp.
           K]
 gi|254764130|sp|B4UES3|MURB_ANASK RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|196174067|gb|ACG75040.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Anaeromyxobacter sp.
           K]
          Length = 329

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 101/301 (33%), Positives = 145/301 (48%), Gaps = 4/301 (1%)

Query: 12  ERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLG 70
           E  +++RG+   + PL   T  R GG A+++ +P D   L   L  +    +P++++G G
Sbjct: 6   EIARRVRGEHLRDAPLAPRTAVRVGGPADLLCRPADGDALSALLRAVRELGVPLSVLGGG 65

Query: 71  SNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFY 130
           +N LV DAG+RGVVLRL    F   E  +   +++ A      L   A  HG+ G  F  
Sbjct: 66  ANTLVADAGVRGVVLRLPQE-FPG-ESTDGGTLVLSAGAPISRLPARAHAHGLVGMEFLG 123

Query: 131 GIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLII 190
           GIPG++GGAA MNAG    E    V  +      G   V P   L Y YR+  +    +I
Sbjct: 124 GIPGTLGGAAAMNAGTRLGEMKDVVTRLELATPDGTGFV-PASALGYAYRTCRLPPGAVI 182

Query: 191 THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRG 250
             V +R          A +      R   QP+   T GSTF NP G  A +L+E  G +G
Sbjct: 183 ARVEVRLHAGDVAASEALMREDRERRRATQPLDRPTFGSTFTNPPGEYAGRLVEAVGLKG 242

Query: 251 LEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQ 310
              G A  S +H NF+ N   AT  D+  L    R +V  + GI LE E++ +G+F D  
Sbjct: 243 HRVGNAIWSPVHANFVTNLGGATARDVLALVRLARARVKERFGIALETEVRLMGEFLDED 302

Query: 311 I 311
           +
Sbjct: 303 L 303


>gi|223937419|ref|ZP_03629324.1| UDP-N-acetylenolpyruvoylglucosamine reductase [bacterium Ellin514]
 gi|223893970|gb|EEF60426.1| UDP-N-acetylenolpyruvoylglucosamine reductase [bacterium Ellin514]
          Length = 303

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 98/286 (34%), Positives = 150/286 (52%), Gaps = 3/286 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAG 79
            + + PL + T  R GGNA+V  +P    +L   L +      PI I+G GSN+LVRD G
Sbjct: 19  LRADEPLAKRTTMRVGGNADVYVEPASETELAQVLQICNRLHAPIFILGRGSNLLVRDGG 78

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           I GVV+ L +  FS +E   +  M  GA    K +A  + +H + G  F  GIPG++GGA
Sbjct: 79  IHGVVICLVHPNFSKVEFSGYL-MHCGAGAKLKQVAMDSKKHQLTGLEFLEGIPGTVGGA 137

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFP 199
             MNAGA    T   V  +  +D  G  H     ++K +YRS  + K  I    VL+G P
Sbjct: 138 LRMNAGAMGGWTFDVVESIRYMDYGGEVHEQQATEIKVEYRSCPLLKTHIALGAVLKGHP 197

Query: 200 ESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKIS 259
            ++ ++   +      R   QP    + G  FKNP    A +LI++ G +G   GGA +S
Sbjct: 198 SNREVVEKRLKTFSAKRWESQP-AAPSAGCIFKNPGTIPAGKLIDELGMKGTRVGGAMVS 256

Query: 260 ELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           + H NF+IN   AT  D+  L + ++++  ++ G+ LE E++ +G+
Sbjct: 257 QEHGNFIINEGQATAKDVLNLIQLIKQRARSERGVELETEVEIVGE 302


>gi|108762211|ref|YP_633741.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Myxococcus xanthus
           DK 1622]
 gi|122980789|sp|Q1D0T2|MURB_MYXXD RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|108466091|gb|ABF91276.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Myxococcus xanthus
           DK 1622]
          Length = 310

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 105/316 (33%), Positives = 163/316 (51%), Gaps = 15/316 (4%)

Query: 1   MIYGRISRLLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP 59
           M+   +   L  R + L G + +   PL  +T  R GG AE + +P+    L   L L  
Sbjct: 1   MVEAGVKTALAARVESLGGCEVKAGEPLAPLTSVRAGGAAEALVRPRSPDALVALLKLAR 60

Query: 60  SD-IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCE--MIVGARCSGKSLAN 116
            + +P++I+G G+N LV D G+ G+ L+L    F  +      E  + +GA  +   L N
Sbjct: 61  EEGVPVSILGGGANTLVGDGGVPGLTLKLPGDLFPEVADVGPEEGRLTLGAGAAIVRLIN 120

Query: 117 SALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYV--VEVHGIDRKGNQHVIPREQ 174
               H + G  F  GIPG++GGA  MNAG  N E  + +  VEV   D  G    + + Q
Sbjct: 121 VMRAHALVGAEFLAGIPGTLGGAVSMNAGTKNGEAFRVIEAVEVATADGVG---WLTKAQ 177

Query: 175 LKYQYRSSEITKDLIITHV--VLRGFPESQNIISAAIANV-CHHRETVQPIKEKTGGSTF 231
           + Y YR SE+    ++T V   LR   +   + S A+ +    +R+  QP+ +   GS F
Sbjct: 178 VPYSYRHSELPPGGVVTRVRFALR---KGDVVASKAVMDADLGYRKRTQPLSQPNFGSVF 234

Query: 232 KNPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQ 291
            NP G  A +LIE +G +G   G A++S LH N+++N   AT  D+  L   ++++V  Q
Sbjct: 235 TNPPGDHAGRLIELAGLKGYSLGRAQVSTLHANWIVNLGGATARDVLGLVTLMQQRVLEQ 294

Query: 292 SGILLEWEIKRLGDFF 307
           SG+ ++ E+KRLGDF 
Sbjct: 295 SGVDMKPEVKRLGDFL 310


>gi|242242108|ref|ZP_04796553.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           epidermidis W23144]
 gi|242234421|gb|EES36733.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           epidermidis W23144]
          Length = 310

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 94/282 (33%), Positives = 151/282 (53%), Gaps = 5/282 (1%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRGVV 84
           PLK+ T+  TGG A+    P    +++  +     + IP+T +G GSNI++R+ GIRG+V
Sbjct: 28  PLKRYTYTETGGKADFYLSPTKNEEVQAIVKFAHENSIPVTYLGNGSNIIIREGGIRGIV 87

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           L L     ++IE  +   +I G+  +   ++N A  H + G  F  GIPGSIGGA +MNA
Sbjct: 88  LSL--LSLNHIETSDDA-IIAGSGAAIIDVSNVARDHVLTGLEFACGIPGSIGGAVFMNA 144

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLRGFPESQN 203
           GA   E    +     ++ KG+   +   +L+  YR+S +  K L++        P   +
Sbjct: 145 GAYGGEVKDCIDYALCVNEKGDLLKLTTAELELDYRNSVVQQKHLVVLEAAFTLEPGKLD 204

Query: 204 IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHC 263
            I A + ++   RE+ QP++  + GS F+ P GH A +LI+ S  +G   GG ++S  H 
Sbjct: 205 EIQAKMDDLTERRESKQPLEFPSCGSVFQRPPGHFAGKLIQDSNLQGYRIGGVEVSTKHA 264

Query: 264 NFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            FM+N DN T  D E L   V+K V  +  + L  E++ +G+
Sbjct: 265 GFMVNVDNGTATDYEALIHHVQKTVKEKFDVELNTEVRIIGE 306


>gi|89895652|ref|YP_519139.1| hypothetical protein DSY2906 [Desulfitobacterium hafniense Y51]
 gi|89335100|dbj|BAE84695.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 288

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 94/287 (32%), Positives = 152/287 (52%), Gaps = 6/287 (2%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLK-YFLTLLPSDIPITIVGLGSNILV 75
           +RG+ +  +PLK++  +R GG AE +  P+   +L+  +L      IP  + G GSNIL 
Sbjct: 1   MRGRVEHQYPLKKLNTWRIGGLAETVCWPESEEELREIWLKCQEQGIPFRLFGRGSNILF 60

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMI-VGARCSGKSLANSALRHGIGGFHFFYGIPG 134
            D G+ GV +  +    S  +     E + VGA  S   L+  A   G+ G  F  GIPG
Sbjct: 61  PDEGLTGVTVISTGLAQSAWD----SEWVSVGAGYSLARLSQEAADRGLTGLEFARGIPG 116

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVV 194
           ++GGA  MNAGA+       + EV  +   G    I ++ +++ YR   +   +I+   V
Sbjct: 117 TVGGAVVMNAGAHGGSIQDILEEVTILTPDGEVQQIAKQDIQFGYRECSLRDQVIVLAGV 176

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
            R      ++I A ++     R+  QP++    GS F+NP G SA +LIE++G +G   G
Sbjct: 177 FRLKAGDPDVIQATMSENLAKRKAAQPLELPNAGSVFRNPPGDSAGRLIEEAGWKGKRLG 236

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           GA++S  H NF++N  NAT  D+  L  +++K V +Q G+ L+ E++
Sbjct: 237 GAQVSSKHANFIVNQGNATARDVLALIREIQKDVHHQFGVELKTEVR 283


>gi|319401185|gb|EFV89400.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           epidermidis FRI909]
          Length = 306

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 94/282 (33%), Positives = 151/282 (53%), Gaps = 5/282 (1%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRGVV 84
           PLK+ T+  TGG A+    P    +++  +     + IP+T +G GSNI++R+ GIRG+V
Sbjct: 24  PLKRYTYTETGGKADFYLSPTKNEEVQAIVKFAHENSIPVTYLGNGSNIIIREGGIRGIV 83

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           L L     ++IE  +   +I G+  +   ++N A  H + G  F  GIPGSIGGA +MNA
Sbjct: 84  LSL--LSLNHIETSDDA-IIAGSGAAIIDVSNVARDHVLTGLEFACGIPGSIGGAVFMNA 140

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLRGFPESQN 203
           GA   E    +     ++ KG+   +   +L+  YR+S +  K L++        P   +
Sbjct: 141 GAYGGEVKDCIDYALCVNEKGDLLKLTTAELELDYRNSVVQQKHLVVLEAAFTLEPGKLD 200

Query: 204 IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHC 263
            I A + ++   RE+ QP++  + GS F+ P GH A +LI+ S  +G   GG ++S  H 
Sbjct: 201 EIQAKMDDLTERRESKQPLEFPSCGSVFQRPPGHFAGKLIQDSNLQGYRIGGVEVSTKHA 260

Query: 264 NFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            FM+N DN T  D E L   V+K V  +  + L  E++ +G+
Sbjct: 261 GFMVNVDNGTATDYEALIHHVQKTVKEKFDVELNTEVRIIGE 302


>gi|160947767|ref|ZP_02094934.1| hypothetical protein PEPMIC_01702 [Parvimonas micra ATCC 33270]
 gi|158446901|gb|EDP23896.1| hypothetical protein PEPMIC_01702 [Parvimonas micra ATCC 33270]
          Length = 298

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 99/283 (34%), Positives = 157/283 (55%), Gaps = 5/283 (1%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRGVV 84
           PLK  T F+ GGN   + +P+++ D+   + +   + I   ++G GSN+LV D G  GV+
Sbjct: 18  PLKNHTTFKIGGNCIALIEPREVSDIVETIKICRENSIKFFVIGNGSNLLVPDEGYNGVI 77

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           ++L +  FS I+V++   +IV +      +   A  + + GF F  GIPG+IGGA YMNA
Sbjct: 78  IKLKSE-FSTIQVKDEY-LIVNSGAKLSEVYTVAYENSLTGFEFASGIPGTIGGAIYMNA 135

Query: 145 GANNCETSQYVVEVHGIDRKGNQ-HVIPREQLKYQYRSSEIT-KDLIITHVVLRGFPESQ 202
           GA   E    V  V  +D    +   +  E+L++ YR S I  K+ I+T + L+    ++
Sbjct: 136 GAYGGEMKDIVESVEVLDLDNFELRELKNEELEFSYRKSIIQRKNYIVTTIKLKLQKGNK 195

Query: 203 NIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELH 262
             I+A   ++   R + QP+   + GSTFK P GH A +LIE +G +G     A +SE H
Sbjct: 196 EEINAVYEDLRERRNSKQPLNFGSAGSTFKRPEGHFASKLIEDAGLKGYHINDAWVSEKH 255

Query: 263 CNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
             F++N  NA+  ++  L E V+K VF + G+ LE E++ L D
Sbjct: 256 SGFVVNKGNASYKEVMELIEYVQKVVFEKFGVKLETEVRILKD 298


>gi|307701928|ref|ZP_07638937.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus mitis
           NCTC 12261]
 gi|307616743|gb|EFN95931.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus mitis
           NCTC 12261]
          Length = 301

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 101/294 (34%), Positives = 151/294 (51%), Gaps = 19/294 (6%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDA 78
           +F+E  PL   ++ + GG A+ +  P++  +L   +      +IP  ++G  SNI+VRD 
Sbjct: 17  RFKE--PLHSYSYTKVGGEADYLVFPRNRFELARVVKFANQENIPWMVLGNASNIIVRDG 74

Query: 79  GIRGVVL------RLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGI 132
           GIRG V+       +S  G++ IE      +I   R         ALRH + GF F  GI
Sbjct: 75  GIRGFVILCDKLNHVSVDGYT-IEAEAGANLIETTRI--------ALRHSLTGFEFACGI 125

Query: 133 PGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIIT 191
           PGS+GGA +MNAGA   E +  +     + + G    +  + L + YR S I +   ++ 
Sbjct: 126 PGSVGGAVFMNAGAYGGEIAHILQSCKILTKDGEIETLSVKDLAFGYRHSAIQESGAVVL 185

Query: 192 HVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGL 251
                  P S  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G 
Sbjct: 186 SAKFALAPGSHPVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGY 245

Query: 252 EFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
             GG ++SE H  FMIN  + T  D E L E V +KV   SG+ LE E++ LG+
Sbjct: 246 RIGGVEVSEKHAGFMINVADGTAKDYEDLIESVIEKVKEHSGVTLEREVRILGE 299


>gi|116512017|ref|YP_809233.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactococcus lactis
           subsp. cremoris SK11]
 gi|122940170|sp|Q02Z11|MURB_LACLS RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|116107671|gb|ABJ72811.1| UDP-N-acetylmuramate dehydrogenase [Lactococcus lactis subsp.
           cremoris SK11]
          Length = 299

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 101/289 (34%), Positives = 152/289 (52%), Gaps = 9/289 (3%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYF-LTLLPSDIPITIVGLGSNILVRDA 78
           KF E  PL   T+ + GG A+++  P  I  L         +D P+T++G  SN++VRD 
Sbjct: 16  KFNE--PLSNYTYTKVGGPADILAFPATIEALTELSAKAKATDTPVTVLGNASNLIVRDG 73

Query: 79  GIRGVVLRLSNAGFSNIEVRNHC-EMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
           GIRGVV+ L      +++V  +  E   GA+   K +   A  + + GF F  GIPGSIG
Sbjct: 74  GIRGVVILLEK--LDSVKVAGYTIEAQAGAKL--KEVTQVAQANSLTGFEFACGIPGSIG 129

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLR 196
           GA +MNAGA   E  Q +V    +D  GN  V+   ++++ YR S I  K+LI+      
Sbjct: 130 GAVFMNAGAYGGEIYQVLVSCKVMDAAGNVSVLSASEMQFGYRHSVIRDKNLIVLSAKFE 189

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
                   I   +  +   RE+ QP++  + GS FK P GH A QLI+++  +G   GG 
Sbjct: 190 LQAGDPTQIQNEMDRLNFLRESKQPLEYPSCGSVFKRPVGHFAGQLIQEAKLQGQRIGGV 249

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           ++S+ H  FM+N  +    D E L   V +KV   SG+ LE E++ +G+
Sbjct: 250 EVSKKHAGFMVNVADGNATDYEKLIALVIEKVKENSGVTLEPEVRIIGE 298


>gi|228475323|ref|ZP_04060047.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus hominis SK119]
 gi|228270699|gb|EEK12113.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus hominis SK119]
          Length = 308

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 94/285 (32%), Positives = 155/285 (54%), Gaps = 5/285 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIRG 82
           N PLK+ T+ +TGGNA+    P +   ++  +       +P+T +G GSNI++R+ GIRG
Sbjct: 23  NEPLKRYTYTKTGGNADFYLSPIENEQVQTIVRYAQEHQLPVTYLGNGSNIIIREGGIRG 82

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           +V+ L     ++I V +   +I G+  +   ++ +A  + + G  F  GIPGS+GGA YM
Sbjct: 83  IVISL--LSLNHINVSDDA-IIAGSGAAIIDVSRAARDYVLTGLEFACGIPGSVGGAVYM 139

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFPES 201
           NAGA   E    +     ++  G+   + +EQL   YR+S + K  L++        P +
Sbjct: 140 NAGAYGGEIKDCIDYALCVNEHGDLIQLTKEQLHLDYRNSVVQKQHLVVLEAAFTLEPGN 199

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
            N I A + ++   RE+ QP++  + GS F+ P GH A +LI+ S  +G   GG ++S  
Sbjct: 200 LNEIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHFAGKLIQDSNLQGHRIGGVEVSTK 259

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           H  FM+N DN T  D E L   V+K V  +  + L  E++ +G++
Sbjct: 260 HAGFMVNVDNGTATDYENLIHYVQKVVKEKFDVELHREVRIIGEY 304


>gi|167630130|ref|YP_001680629.1| udp-n-acetylenolpyruvoylglucosamine reductase [Heliobacterium
           modesticaldum Ice1]
 gi|254764193|sp|B0TGC2|MURB_HELMI RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|167592870|gb|ABZ84618.1| udp-n-acetylenolpyruvoylglucosamine reductase [Heliobacterium
           modesticaldum Ice1]
          Length = 314

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 102/294 (34%), Positives = 153/294 (52%), Gaps = 5/294 (1%)

Query: 15  KQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNI 73
           +  RG++ +  P+ + T ++ GG A++   P D  DL   +       IP  +VG GSN+
Sbjct: 6   RDFRGQWMQQEPMSRHTTWKIGGPADLFAIPADEADLAGLIRRCREKGIPWMVVGNGSNL 65

Query: 74  LVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           LV D GIRGVV+ L  A FS+  + +   +  G  C+   LA  A+R G+ G  F  GIP
Sbjct: 66  LVADKGIRGVVIHLGRA-FSDRRLDDR-RLTAGGGCALSGLARFAVRAGLQGLEFACGIP 123

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITH 192
            S+GGA  MNAGA+       V  V  ID +G       E++ + YR S + ++  I+  
Sbjct: 124 ASLGGAVAMNAGAHGGAMENIVRWVDVIDDEGRIRRYRGEEMDFAYRHSRLQREKAIVVR 183

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGH-SAWQLIEKSGCRGL 251
           V +      +  +   +      R   QP++    GS F NP G  SA QLIE++G +G 
Sbjct: 184 VGMELRWGDREALERWMEEKLALRRKSQPLEFPNAGSVFLNPPGSLSAGQLIEEAGMKGF 243

Query: 252 EFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
             GGA++SE H NF++N   AT  D+  L + VR +V    GI L+ E++ +GD
Sbjct: 244 AIGGAQVSERHANFIVNRGGATAADVLALIDAVRARVLATCGIELQSEVRVIGD 297


>gi|86609025|ref|YP_477787.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86557567|gb|ABD02524.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 328

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 99/303 (32%), Positives = 154/303 (50%), Gaps = 5/303 (1%)

Query: 9   LLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIV 67
           L R     L G+ Q   PL  +T FR GG AE   +P+   +L+  L    ++ IP T++
Sbjct: 28  LPRGPAALLSGRIQSGIPLAPLTTFRVGGKAEWYCEPRSHLELQQCLAWARAEGIPTTLL 87

Query: 68  GLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFH 127
           G GSN+L+ DAG++G+V+         I++     +   A     +L+ +A R G  G  
Sbjct: 88  GAGSNLLISDAGLKGLVI--GTRRLRGIQLLEGGRIWAAAGEPLVNLSRAAARQGWSGLE 145

Query: 128 FFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD 187
           +  GIPG++GGA  MNAGA+    +  +VEV  +D +     +    L++ YR S +   
Sbjct: 146 WAIGIPGTLGGAVVMNAGAHGRAMADVLVEVQILDEEQEPCRLEPADLQFGYRRSRLQDS 205

Query: 188 -LIITHVVLRGFPE-SQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEK 245
              +T   L+  P    + +        + R + QP    + GS F+NP  H A  LIE+
Sbjct: 206 PWTVTGATLQLIPSRDPSQVQWETQRYLNQRLSSQPYHLPSCGSVFRNPESHPAGWLIEQ 265

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            G +G   GGA+ISE H NF++N   A+  D+  L    ++KV+ Q  +LLE E++ LG 
Sbjct: 266 VGLKGYRIGGAQISERHANFILNCHQASAKDIYRLIRLAQEKVYQQWSVLLEPEVRILGS 325

Query: 306 FFD 308
           F D
Sbjct: 326 FED 328


>gi|189423737|ref|YP_001950914.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacter lovleyi
           SZ]
 gi|254764189|sp|B3E3Y0|MURB_GEOLS RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|189419996|gb|ACD94394.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacter lovleyi
           SZ]
          Length = 302

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 100/288 (34%), Positives = 149/288 (51%), Gaps = 5/288 (1%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILV 75
            +G+   + PL +    + GG  +++  P    +L+  +TLL    IP  ++G G N+L 
Sbjct: 12  FKGELLFHEPLARHVSLKVGGPVDLLATPDSREELQQLVTLLDQQQIPRFVLGGGFNLLP 71

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
            D G RG  + L       +   +   + + A  S +SLA +    G+ G  F  GIPGS
Sbjct: 72  SDVGYRGCAISLKQINRLQL---DDTVVAIEAGASNQSLARAVAELGLSGIEFLIGIPGS 128

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           +GGA  MNAGA+  +    V  V  +D +G    +PREQL Y YR  EI  + +I  V L
Sbjct: 129 VGGAVRMNAGAHGSDIFSVVKTVTLLD-QGQFRELPREQLTYGYRCFEIPDNSVIVAVTL 187

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           +   +S   + + +      R   Q +K    GS FKNP G SAW+LI+++G RG   G 
Sbjct: 188 QLSEDSLQAVRSRMEEQLGLRWATQNVKFPNAGSFFKNPPGESAWRLIDQAGLRGFSIGN 247

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           A++SE+H NF+IN  NAT  D   L   V+++V    GI LE E++ L
Sbjct: 248 AQVSEVHTNFLINRGNATAADFRALAAAVKERVKATCGIELEEEVQLL 295


>gi|256004723|ref|ZP_05429699.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           thermocellum DSM 2360]
 gi|255991316|gb|EEU01422.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           thermocellum DSM 2360]
 gi|316941126|gb|ADU75160.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           thermocellum DSM 1313]
          Length = 304

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 95/292 (32%), Positives = 159/292 (54%), Gaps = 12/292 (4%)

Query: 22  QENF----PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVR 76
           QEN     P+K  T F+ GG A+++  P  +  L   L L  +  +P+ ++G G+N++VR
Sbjct: 16  QENVKLDEPMKNHTSFKVGGPADILVTPVSVSQLSQILKLCKNKSVPVFVMGNGTNLIVR 75

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCS--GKSLANSALRHGIGGFHFFYGIPG 134
           D GIRGVV+++    F N+      + I+ A        ++  A  +G+ G  F  GIPG
Sbjct: 76  DKGIRGVVVKI----FDNLNQFTVKDDIITAYAGILLSRVSTIAYENGLTGLEFACGIPG 131

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL-IITHV 193
           ++GGA  MNAGA   E    VVE   +D+ G   V+  +  ++ YR+S I K+  I+   
Sbjct: 132 TLGGAVAMNAGAYGGEMKDVVVETEYMDKDGEIRVVRDDGHQFGYRTSFIQKNSGIVIKT 191

Query: 194 VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEF 253
            ++    ++  I A + ++   R+  QP++  + GS FK P G+ A +LIE  G RG   
Sbjct: 192 SMKLKKGNKEEIKALMDDLTQRRQEKQPLEMPSAGSIFKRPEGYFAGKLIEDCGLRGHRI 251

Query: 254 GGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           GGA++S+ HC F++N  +A   D+  L E +R  V  + G+ ++ E++ +G+
Sbjct: 252 GGAEVSQKHCGFIVNTGDAKAKDILDLIEYIRNTVKMKFGVDMQTEVRIVGE 303


>gi|329922660|ref|ZP_08278212.1| UDP-N-acetylmuramate dehydrogenase [Paenibacillus sp. HGF5]
 gi|328942002|gb|EGG38285.1| UDP-N-acetylmuramate dehydrogenase [Paenibacillus sp. HGF5]
          Length = 301

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 100/285 (35%), Positives = 153/285 (53%), Gaps = 6/285 (2%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIRG 82
           N PL + T ++ GG A+ +  P++   LK  +TLL +  IP T +G GSN+LV D GIRG
Sbjct: 19  NEPLAKYTTWKIGGPADCLIVPENKEQLKELVTLLHAHHIPWTQLGRGSNMLVADKGIRG 78

Query: 83  VVLRLSNAGFSNIEVRNHCEMIV-GARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAY 141
            V++L   GF   E+R   E +  G   S   L+  A + G+ G  F  GIPGS+GGA Y
Sbjct: 79  AVIKLGQ-GFE--ELRFDGETVTAGGSLSFVKLSVLAGKQGLSGLEFAGGIPGSVGGAVY 135

Query: 142 MNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLRGFPE 200
           MNAGA+  + S+       +   G       + + + YR S +  +  I+T         
Sbjct: 136 MNAGAHGSDVSRIFKSADIVLETGELVTYAAKDMAFDYRHSILHERKGIVTEAAFELRQG 195

Query: 201 SQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISE 260
            +  I+A +A+    R   QP++  T GS F+NP G  A +LIE +G +GL  GGA++S 
Sbjct: 196 DRKEITAVMASYKDRRRRTQPLQSATAGSVFRNPPGDHAARLIEAAGLKGLRIGGAEVSL 255

Query: 261 LHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            H NF+ N   AT  D+  L E++++ +  ++GI +  E+  LG+
Sbjct: 256 QHANFIENTGQATAEDVLALMERIKETISEKNGIQMVPEVYVLGE 300


>gi|291528582|emb|CBK94168.1| UDP-N-acetylmuramate dehydrogenase [Eubacterium rectale M104/1]
          Length = 319

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 98/306 (32%), Positives = 157/306 (51%), Gaps = 28/306 (9%)

Query: 23  ENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIR 81
           ++ P+K+ T FR GG A+   +P DI  +   + +  + D+P+T++G GSN+LV D GIR
Sbjct: 20  QDEPMKKHTTFRIGGPADYYAEP-DISRISKLIEMAKACDMPVTVIGNGSNLLVGDKGIR 78

Query: 82  GVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRH-------------------- 121
           G+V+ +   G S I+V       V  + + + L      H                    
Sbjct: 79  GLVIGIGK-GLSEIDVTEA----VAQQSTAQDLTAQDNGHIITAGAGAILAAVAAKAAEA 133

Query: 122 GIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS 181
            + G  F  GIPGS+GGA  MNAGA   E    +++   +  +G    + R++L   YR 
Sbjct: 134 SLSGLEFASGIPGSVGGAVVMNAGAYGGEIKDVLIDATVLTAEGELKTVTRDELDLSYRH 193

Query: 182 SEIT-KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
           S +  K  I+     R  P+ ++ I + +A +   R   QP++  + GSTFK P G+ A 
Sbjct: 194 SIVPEKGYIVLSARFRLTPKPKDEIKSYMAELRTKRVEKQPLEYPSAGSTFKRPEGYFAG 253

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LI  +G RG   G A++S+ HC F++N   AT  D+  L + V++ V  Q G+ LE E+
Sbjct: 254 KLIMDAGLRGYSVGDAQVSQKHCGFVVNKGEATAADVLTLIKDVQETVLKQFGVKLEPEV 313

Query: 301 KRLGDF 306
           K +G+F
Sbjct: 314 KMIGEF 319


>gi|125972636|ref|YP_001036546.1| UDP-N-acetylmuramate dehydrogenase [Clostridium thermocellum ATCC
           27405]
 gi|166222838|sp|A3DBM4|MURB_CLOTH RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|125712861|gb|ABN51353.1| UDP-N-acetylmuramate dehydrogenase [Clostridium thermocellum ATCC
           27405]
          Length = 305

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 95/292 (32%), Positives = 159/292 (54%), Gaps = 12/292 (4%)

Query: 22  QENF----PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVR 76
           QEN     P+K  T F+ GG A+++  P  +  L   L L  +  +P+ ++G G+N++VR
Sbjct: 17  QENVKLDEPMKNHTSFKVGGPADILVTPVSVSQLSQILKLCKNKSVPVFVMGNGTNLIVR 76

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCS--GKSLANSALRHGIGGFHFFYGIPG 134
           D GIRGVV+++    F N+      + I+ A        ++  A  +G+ G  F  GIPG
Sbjct: 77  DKGIRGVVVKI----FDNLNQFTVKDDIITAYAGILLSRVSTIAYENGLTGLEFACGIPG 132

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL-IITHV 193
           ++GGA  MNAGA   E    VVE   +D+ G   V+  +  ++ YR+S I K+  I+   
Sbjct: 133 TLGGAVAMNAGAYGGEMKDVVVETEYMDKDGEIRVVRDDGHQFGYRTSFIQKNSGIVIKT 192

Query: 194 VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEF 253
            ++    ++  I A + ++   R+  QP++  + GS FK P G+ A +LIE  G RG   
Sbjct: 193 SMKLKKGNKEEIKALMDDLTQRRQEKQPLEMPSAGSIFKRPEGYFAGKLIEDCGLRGHRI 252

Query: 254 GGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           GGA++S+ HC F++N  +A   D+  L E +R  V  + G+ ++ E++ +G+
Sbjct: 253 GGAEVSQKHCGFIVNTGDAKAKDILDLIEYIRNTVKMKFGVDMQTEVRIVGE 304


>gi|291286416|ref|YP_003503232.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Denitrovibrio
           acetiphilus DSM 12809]
 gi|290883576|gb|ADD67276.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Denitrovibrio
           acetiphilus DSM 12809]
          Length = 284

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 99/285 (34%), Positives = 151/285 (52%), Gaps = 6/285 (2%)

Query: 22  QENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGI 80
           ++  PLK    ++TGG AE    P D  DLK  L     + IP+T++G G NILV D G+
Sbjct: 3   EKKVPLKDYCSYKTGGKAEFFTCPTDTFDLKVVLKFASDNSIPVTLIGTGYNILVSDKGV 62

Query: 81  RGVVLRLSNAGFSNIEVRNHCEMI-VGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           +G+V+   + G  N +++   E++  GA  S   L    + +G+ G     GIPGS+GGA
Sbjct: 63  KGLVV---STGCMNNDIQIEGELVFAGAGVSLNDLILKCIDNGLAGLENMSGIPGSVGGA 119

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFP 199
             MNAGA   E     V++      G    I  E   + YR +E  K  I+T + L+   
Sbjct: 120 VIMNAGAFGTEIKDVAVQIEMCGFDGVVSSIHAEDAGFGYRKAENLKG-IVTGLGLKLEH 178

Query: 200 ESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKIS 259
            +++ + A  A +   R   QP++  + GS FK P G  A  LIE+ G +G + GGA++S
Sbjct: 179 GNKDELLAKRAEILKKRSEKQPLEFPSCGSVFKRPEGGYAGTLIEQCGLKGYKIGGAQVS 238

Query: 260 ELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           E H NF++N   A   D+  L   V++ VF ++GI LE E++ +G
Sbjct: 239 EKHANFIVNTGKAKSADIYALINHVQETVFKETGIKLEREVRFVG 283


>gi|315221365|ref|ZP_07863286.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           anginosus F0211]
 gi|319939313|ref|ZP_08013674.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           anginosus 1_2_62CV]
 gi|315189484|gb|EFU23178.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           anginosus F0211]
 gi|319811567|gb|EFW07851.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           anginosus 1_2_62CV]
          Length = 300

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 101/290 (34%), Positives = 151/290 (52%), Gaps = 11/290 (3%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDA 78
           +F E  PLKQ T+ + GG A+ +  P++ ++L   +     + IP  ++G  SNI+VRD 
Sbjct: 17  RFDE--PLKQYTYTKVGGAADYLVFPRNRYELARVVKFANREQIPWMVLGNASNIIVRDG 74

Query: 79  GIRGVVLRLSNAGFSNIEVRNHC-EMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
           GIRG V+       + + V  +  E   GA        + AL H + GF F  GIPGSIG
Sbjct: 75  GIRGFVIMFDK--LNGVAVDGYTIEAEAGANLI--ETTHIALHHSLTGFEFACGIPGSIG 130

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI--TKDLIITHVVL 195
           GA +MNAGA   E S  ++    + R G    I  + +K+ YR S +  T D++I+    
Sbjct: 131 GAVFMNAGAYGGEISHILLSCKVLTRDGEIKNISAQDMKFGYRRSYVQQTGDVVISAKFA 190

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
              P    +I   +  + H R+  QP++  + GS FK P GH A QLI ++  +G   GG
Sbjct: 191 LA-PGMHRVIRQEMERLTHLRQLKQPLEYPSCGSVFKRPVGHFAGQLISEANLKGHRIGG 249

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            ++S  H  FM+N DN T  D E L   V + V   SG+ LE E++ +G+
Sbjct: 250 VEVSTKHAGFMVNVDNGTAADYENLIAHVIETVKAHSGVTLEREVRIIGE 299


>gi|327469460|gb|EGF14929.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK330]
          Length = 301

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 98/287 (34%), Positives = 151/287 (52%), Gaps = 11/287 (3%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRG 82
           N PL Q T+ + GG A+ +  P++ ++L   +      DIP  ++G  SNI+VRD GIRG
Sbjct: 19  NEPLSQYTYTKVGGAADFLVFPRNRYELARIVNFANQEDIPWMVLGNASNIIVRDGGIRG 78

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANS--ALRHGIGGFHFFYGIPGSIGGAA 140
            V+       +N+ V  +   ++ A      +  +  AL++ + GF F  GIPGS+GGA 
Sbjct: 79  FVIMFDK--LNNVAVDGY---MIEAEAGANLIQTTHIALQNSLTGFEFACGIPGSVGGAV 133

Query: 141 YMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI--TKDLIITHVVLRGF 198
           +MNAGA   E +  +V    +  +G    +    +K+ YR+S +  T D++I+       
Sbjct: 134 FMNAGAYGGEIAHVLVSCKVLTPQGQVKTLDVRDMKFGYRNSLVQETGDIVISAKFALS- 192

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P     I   +  + H RE  QP++  + GS FK P G+ A QLI ++G +G   GG ++
Sbjct: 193 PGVHRTIRQEMERLTHLRELKQPLEYPSCGSVFKRPLGYFAGQLISEAGLKGHRIGGVEV 252

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H  FMIN D  T  D E L   V  +V   SGI LE E++ +G+
Sbjct: 253 SEKHAGFMINVDKGTAQDYENLIAHVIGRVRENSGITLEREVRIIGE 299


>gi|56419453|ref|YP_146771.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus
           kaustophilus HTA426]
 gi|81347827|sp|Q5L1H7|MURB_GEOKA RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|56379295|dbj|BAD75203.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus
           kaustophilus HTA426]
          Length = 304

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 106/306 (34%), Positives = 160/306 (52%), Gaps = 11/306 (3%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS- 60
           IY R+  +  ER   LR +     P+K  T  R GG A+ +  P+    +   L L    
Sbjct: 7   IYQRLVEICGER-NVLRDE-----PMKNHTLVRIGGKADFLVWPETYEQVIEVLRLKEEY 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
            +P T++G GSN+++RD G+RG+V++L +    N   R    +I  +    K+++  AL 
Sbjct: 61  GLPFTLLGNGSNVIIRDGGLRGIVMQLKHL---NRIWREGNNVIAQSGADIKAVSRFALE 117

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             + G  F  GIPGS+GGA  MNAGA   E    +  V      G    +  E+L+  YR
Sbjct: 118 QHLTGLEFACGIPGSVGGAIMMNAGAYGGEVKDVLDHVKVATLSGELKTLKNEELELGYR 177

Query: 181 SSEITKDL-IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
           +S I++   I+  VV    P     I A + ++   RE+ QP++  + GS FK P G+ A
Sbjct: 178 TSLISRTHDIVLEVVFALRPGDYAQIKAKMDDLTFQRESKQPLEYPSVGSVFKRPPGYFA 237

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LI+ SG +G  FGGA++S  H  F+IN +NAT  D     E VRK V  + G+ LE E
Sbjct: 238 GKLIQDSGLQGKGFGGAEVSTKHAGFIINKNNATAADYIATIEMVRKTVKEKFGVDLELE 297

Query: 300 IKRLGD 305
           +K +G+
Sbjct: 298 VKIIGE 303


>gi|88607276|ref|YP_505324.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Anaplasma
           phagocytophilum HZ]
 gi|88598339|gb|ABD43809.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Anaplasma
           phagocytophilum HZ]
          Length = 302

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 92/290 (31%), Positives = 154/290 (53%), Gaps = 5/290 (1%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
           ++RG ++ +  +  +TW   GG A ++F+P+DI DL  FL    + +  + +G GSN++V
Sbjct: 12  KVRGVYKRSVKMHSMTWVGVGGVAPLLFKPKDIDDLATFLK--NTSLTASAIGAGSNVIV 69

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD     VV+RL    FS++   ++  + VG   S   LA  A  + + GF F  G+PG+
Sbjct: 70  RDGVFNNVVVRLERE-FSDMRCEDNA-ITVGCGASISELAAFARENSLSGFEFCVGMPGT 127

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           +GGA   NA  +  + +  +  V  ++  G    + ++ ++Y  RS  +    +      
Sbjct: 128 VGGAIATNARCHGKDIASILHSVIAVNEYGEICTLYKDDMQYSRRSHGLEGRWVFVEARF 187

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKE-KTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
            G P   N I   ++ +   R   QPI   K+ G  F++     A  LIE++GCRGL+ G
Sbjct: 188 VGNPAELNTIRNTMSELLIKRNATQPIYYGKSIGYIFQDAGNAEAKALIEEAGCRGLQVG 247

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            A +SE HCNF+ N   A+  ++E LG +V++ V  ++G+ LEW I+ LG
Sbjct: 248 CAVVSEKHCNFIENIGGASAAEIEDLGSEVKRLVKEKTGVNLEWSIEFLG 297


>gi|16332095|ref|NP_442823.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Synechocystis sp.
           PCC 6803]
 gi|6225733|sp|P74529|MURB_SYNY3 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|1653724|dbj|BAA18635.1| slr1424 [Synechocystis sp. PCC 6803]
          Length = 317

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 99/292 (33%), Positives = 150/292 (51%), Gaps = 8/292 (2%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAG 79
            Q    L + T +R GG AE    P+ + DL   L      D+P+T +G GSN+L+ D G
Sbjct: 26  IQPETSLAEFTTYRVGGKAEWYAAPRCLEDLVAVLDWFQGQDLPLTFLGAGSNLLISDQG 85

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           + G+VL       S  +       +       K +   A + G  G  +  GIPG++GGA
Sbjct: 86  LAGLVLSTRYLRQSKFDEEQGLITVAAGEPIAK-VGWQAAKRGWQGLEWAVGIPGTVGGA 144

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK---DLIITHVVLR 196
             MNAGA+N  T++ +VE   +   G   V+  EQL + YR+S + K   D ++     +
Sbjct: 145 VVMNAGAHNQCTAETLVEATVMRPDGGLEVLTNEQLGFSYRTSNLQKHLGDRLVVDATFK 204

Query: 197 GFP--ESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
             P    + I+     N+ H R++ QP  +   GS F+NPT   + +LIE+ G +G   G
Sbjct: 205 LTPGFTREEIMGCTTRNL-HQRKSTQPYDKPNCGSVFRNPTPLYSARLIEELGLKGYRIG 263

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           GA++S+ H NF++N DNA   D+  L   V+ +V    GILLE E+K LG+F
Sbjct: 264 GAEVSQRHANFIVNIDNAKAQDVFNLIFHVQGEVEKHYGILLEPEVKMLGEF 315


>gi|309390055|gb|ADO77935.1| UDP-N-acetylmuramate dehydrogenase [Halanaerobium praevalens DSM
           2228]
          Length = 308

 Score =  156 bits (395), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 92/279 (32%), Positives = 158/279 (56%), Gaps = 9/279 (3%)

Query: 33  FRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRGVVLRLSNAG 91
           F+ GG A++   P++I  L+  + ++  S +P  I+G GSN+++ D G RG+++      
Sbjct: 34  FKVGGPADLFLTPKNIASLQKIMPVIYKSQLPYFILGKGSNLIISDKGYRGIIIYTGQ-- 91

Query: 92  FSNIEVR-NHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCE 150
            +  +V+ N      G + S   LA+ A ++ +GGF F  GIPG++GGA YMNAGA   E
Sbjct: 92  LNKFQVKENLITAQTGIKLS--ELADIACQNNLGGFEFAAGIPGTLGGALYMNAGAYGGE 149

Query: 151 TSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD---LIITHVVLRGFPESQNIISA 207
               + + + I++KG    + ++ L+  YR+S + K    LI   + ++    +Q  I+A
Sbjct: 150 IKDIIKKANLINKKGEIETLTKKDLELSYRNSLLQKQSQKLIAVSLEIKLEITAQEQITA 209

Query: 208 AIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMI 267
            +  +   R T QP++  + GS FK P  +    LIE++  +G + GGA++S  H  F++
Sbjct: 210 KMEELHQKRWTKQPMELPSAGSIFKRPPNNYTGPLIEQAELKGYQIGGAQVSTKHAGFIV 269

Query: 268 NADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           N  NAT  D+  L  +V+K+V+ +SGI L+ E + LG+F
Sbjct: 270 NKGNATAEDIVNLINKVKKEVYKKSGIQLKVEPRFLGEF 308


>gi|256827054|ref|YP_003151013.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Cryptobacterium
           curtum DSM 15641]
 gi|256583197|gb|ACU94331.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Cryptobacterium
           curtum DSM 15641]
          Length = 306

 Score =  156 bits (395), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 91/280 (32%), Positives = 156/280 (55%), Gaps = 4/280 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFL-TLLPSDIPITIVGLGSNILVRDAGIRG 82
           N P+ + T FR GG A+V+  PQ      + + +   + +P+ ++G GS++LV D G+ G
Sbjct: 22  NEPMSKHTTFRIGGPADVLVMPQTEEQAAFVVRSCRAASVPLRVIGRGSDLLVADTGLSG 81

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           VV++++    +++ V N   +   A  S   +A +A +  + G+ F  GIPG++GGAA M
Sbjct: 82  VVMKIAG-NLADVRV-NGSRIEAQAGASNARIAEAAAQAALTGYEFAAGIPGTVGGAAIM 139

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLRGFPES 201
           NAGA   E       +  ++  G    +   + ++ YR S + T + I+  V+L+  P +
Sbjct: 140 NAGAYGGEFRDVACRLVCLNAAGEVVSLRAYEAQWGYRCSAMDTTNTIVLRVILQLMPGN 199

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
              I   +A++   R   QP++  + GSTFK P G+ A +LIE +G RG   GGA++S+ 
Sbjct: 200 TQDIRDRMADLSRRRREKQPLEMPSAGSTFKRPVGYFAGKLIEDAGLRGFSIGGAQVSQK 259

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           H  F++NAD AT  D+  L  +V+++V   SG+ L  E++
Sbjct: 260 HTGFVVNADGATASDVRTLIREVQRRVRENSGVDLHPEVR 299


>gi|95930729|ref|ZP_01313462.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Desulfuromonas
           acetoxidans DSM 684]
 gi|95133209|gb|EAT14875.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Desulfuromonas
           acetoxidans DSM 684]
          Length = 309

 Score =  156 bits (395), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 97/301 (32%), Positives = 154/301 (51%), Gaps = 8/301 (2%)

Query: 9   LLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIV 67
           +LR+R   + G    + PL  +T ++ GG  + + +P+   DLK    ++  + +P  ++
Sbjct: 8   VLRQR---ICGDCLFDEPLAPLTTWKVGGATQCLVRPRHEEDLKVLSAVIQDAGVPWWVL 64

Query: 68  GLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFH 127
           G GSN+L+ D G+ GVV++LS+   S IE +    + VG  CS   L  + +  G+GG  
Sbjct: 65  GGGSNVLISDQGLPGVVVQLSH--LSQIETQPEQRLSVGGGCSLAELVRTTVEQGLGGIE 122

Query: 128 FFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVI--PREQLKYQYRSSEIT 185
              GIPGS+GGA   NAGA   +  Q VV+        +  V     EQ  + YR S + 
Sbjct: 123 ALAGIPGSVGGAVSGNAGAAGQQIGQRVVDARVWTPLEHHDVTTWSAEQCDFGYRHSALI 182

Query: 186 KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEK 245
            D ++ +V L+    S   + A  + V  HR     +     GS F+NP G  AW+LI  
Sbjct: 183 PDHVVINVTLQLDHCSVEALRARSSEVLAHRRQAHNVGGPNAGSVFRNPPGQQAWRLIGD 242

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            G RG++ G A++S  H NF++N   AT  ++  L  +V+  V    G+ L+ E++ LG 
Sbjct: 243 CGMRGVQVGKAQVSSQHANFIVNTGGATAEEIYQLIHKVQHAVARHHGVSLQPEVRLLGS 302

Query: 306 F 306
           F
Sbjct: 303 F 303


>gi|290967918|ref|ZP_06559468.1| UDP-N-acetylmuramate dehydrogenase [Megasphaera genomosp. type_1
           str. 28L]
 gi|290782057|gb|EFD94635.1| UDP-N-acetylmuramate dehydrogenase [Megasphaera genomosp. type_1
           str. 28L]
          Length = 307

 Score =  156 bits (395), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 93/285 (32%), Positives = 153/285 (53%), Gaps = 6/285 (2%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIRG 82
           N P+ + T F  GG A+++  P  + ++   +    +  +PIT++G GSN+LV D GIRG
Sbjct: 25  NEPMSRHTTFAVGGPADLLLLPYTVKEMSLAIRAARALQLPITVLGGGSNVLVLDGGIRG 84

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
            V++L     + +  R+   +   A      +   A   G+GG  F  GIPG++GGA +M
Sbjct: 85  AVIQLQ--ALTQVLYRHDDRITASAGHMLADVCEFACAEGLGGAEFACGIPGTLGGAVFM 142

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI--TKDLIITHVVLRGFPE 200
           NAGA + E S  V  V  +D +G  H       ++ YR S    T++ ++   +L     
Sbjct: 143 NAGAYDGEMSHIVARVRTVDHRGGVHTYAAAACRFAYRRSRFQETQEYVVEAELLL-HAA 201

Query: 201 SQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISE 260
           S+  I A +  +   R + QP++  + GSTFK P G+ A  LI+++G +GL FGGA++S 
Sbjct: 202 SRTAIQARMEELMRRRRSKQPLEMASAGSTFKRPPGYFAGTLIDQTGLKGLTFGGAQVST 261

Query: 261 LHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            H  F++N   AT  D+  +   V+++V    G+ LE E++ LG+
Sbjct: 262 KHAGFVVNTGRATARDVLQVIHAVQERVEAAHGVRLEPEVRILGE 306


>gi|320528419|ref|ZP_08029581.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Solobacterium moorei
           F0204]
 gi|320131333|gb|EFW23901.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Solobacterium moorei
           F0204]
          Length = 299

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 93/281 (33%), Positives = 151/281 (53%), Gaps = 6/281 (2%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLK-YFLTLLPSDIPITIVGLGSNILVRDAGIRGVV 84
           PL+ +T  R GGNA+ +  P+    +   F  +  + +P  ++G GS++L  D    G+V
Sbjct: 19  PLRTMTTLRIGGNAKYVVYPETYVAIDGIFRIIEENQLPFKVIGKGSDLLCSDDEFEGIV 78

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           + L    F N +  +  +++  A CS  SL+  A++ G+ G  F  GIPG++GG  +MNA
Sbjct: 79  ICLDR--FFNHQYFDGNDLVAEAGCSIISLSTEAMKRGLSGLEFASGIPGTVGGCLFMNA 136

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS--EITKDLIITHVVLRGFPESQ 202
           GA N      V EV  + R      +P  +  + YR S  +  K+ +I  V     P+ +
Sbjct: 137 GAYNISMKDVVKEVL-VYRDHQLTWLPVSECDFSYRHSIFQTNKNWLILGVRYGLTPKPK 195

Query: 203 NIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELH 262
             I A + +    R   QP+   + GS FKNP GH+AWQLI+  G RG + GGA +S+ H
Sbjct: 196 EEIEALMDSRRKRRVDSQPLNFPSCGSVFKNPEGHNAWQLIDGIGYRGKQIGGAMVSDKH 255

Query: 263 CNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           CNF++N   AT  +   L E+++++V N+  I L+ E+++ 
Sbjct: 256 CNFILNVHKATALEYLTLIEEIQREVKNKYNIDLKMEVEKF 296


>gi|73663287|ref|YP_302068.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           saprophyticus subsp. saprophyticus ATCC 15305]
 gi|90109791|sp|Q49VT7|MURB_STAS1 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|72495802|dbj|BAE19123.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           saprophyticus subsp. saprophyticus ATCC 15305]
          Length = 308

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 93/282 (32%), Positives = 155/282 (54%), Gaps = 5/282 (1%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIRGVV 84
           PLK+ T+ +TGG A+    P     ++  +    + DIP+T +G GSNI++R+ GIRG+V
Sbjct: 24  PLKKYTYTQTGGKADYYLSPTHNEHVQAIVHYAYTHDIPVTYLGNGSNIIIREGGIRGIV 83

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           + L +  +  I+V +   +I G+  +   ++ +A  HG+ G  F  GIPGSIGGA +MNA
Sbjct: 84  ISLLSLDY--IDVSDDA-IISGSGAAIIDVSRAARDHGLTGLEFACGIPGSIGGAVFMNA 140

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFPESQN 203
           GA   E    +     ++ KG    +  ++L+  YR+S + K+ L++        P  Q 
Sbjct: 141 GAYGGEVKDCIDYALCVNNKGELITLTNKELELDYRNSIVQKEHLVVLEAAFTLAPGDQQ 200

Query: 204 IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHC 263
            I A++ ++   RE+ QP++  + GS F+ P GH A +LI+ +  +G   GG ++S  H 
Sbjct: 201 EIQASMDDLTERRESKQPLEYPSCGSVFQRPPGHFAGKLIQDAHLQGHRIGGVEVSTKHA 260

Query: 264 NFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            FM+N D  T  D E L   V+K V  +  + L  E++ +G+
Sbjct: 261 GFMVNVDKGTATDYEDLIHYVQKIVQEKFDVELHPEVRIIGE 302


>gi|295397026|ref|ZP_06807140.1| UDP-N-acetylmuramate dehydrogenase [Aerococcus viridans ATCC 11563]
 gi|294974717|gb|EFG50430.1| UDP-N-acetylmuramate dehydrogenase [Aerococcus viridans ATCC 11563]
          Length = 311

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 100/308 (32%), Positives = 167/308 (54%), Gaps = 9/308 (2%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVG 68
           LR+   Q   KF E  PL   T+ +TGG A+V+  P+   +++  +     +  PI ++G
Sbjct: 6   LRKAFPQSTIKFNE--PLNNYTYTKTGGPADVLIFPETPEEIQALVRFANKAHEPILVLG 63

Query: 69  LGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHF 128
             SN+++ D G+ GVVL L+      I+   H +   G++     ++ SA   G+ GF F
Sbjct: 64  NSSNVIISDEGVSGVVLMLTEMDHIQID-GTHIKAGAGSKII--DVSRSAGAEGLTGFEF 120

Query: 129 FYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI--TK 186
             GIPGS GGA YMNAGA   E S+ +VEV  + + G  + +  E L   YR S++  T 
Sbjct: 121 ACGIPGSTGGAVYMNAGAYGGEISEVLVEVDVVTKAGRMYTLKNEDLNLSYRHSDLQETG 180

Query: 187 DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKS 246
           D+++         + ++I+ A +  + + RE+ QP++  + GS FK P GH   +LI+++
Sbjct: 181 DIVVEARFKLKKGDLKSIL-AKMDELTYLRESKQPLEYPSCGSVFKRPEGHFTGKLIQEA 239

Query: 247 GCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           G +G   GGA+IS+ H  F+IN   AT  D   +   +++ +++ + + LE E++ LG  
Sbjct: 240 GLQGYTIGGAQISKKHAGFIINVGGATATDYINMIHHIQEVIWDLNKVALEPEVRILGKR 299

Query: 307 FDHQIVDA 314
             +  VDA
Sbjct: 300 SKYDTVDA 307


>gi|291523955|emb|CBK89542.1| UDP-N-acetylmuramate dehydrogenase [Eubacterium rectale DSM 17629]
          Length = 319

 Score =  156 bits (394), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 97/306 (31%), Positives = 157/306 (51%), Gaps = 28/306 (9%)

Query: 23  ENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIR 81
           ++ P+K+ T FR GG A+   +P D+  +   + +  + D+P+T++G GSN+LV D GIR
Sbjct: 20  QDEPMKKHTTFRIGGPADYYAEP-DMSRISKLIEMAKACDMPVTVIGNGSNLLVGDKGIR 78

Query: 82  GVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRH-------------------- 121
           G+V+ +   G S I+V       V  + + + L      H                    
Sbjct: 79  GLVIGIGK-GLSEIDVTEA----VAQQSTAQDLTAQDNGHIITAGAGAILAAVAAKAAEA 133

Query: 122 GIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS 181
            + G  F  GIPGS+GGA  MNAGA   E    +++   +  +G    + R++L   YR 
Sbjct: 134 SLSGLEFASGIPGSVGGAVVMNAGAYGGEIKDVLIDATVLTAEGELKTVTRDELDLSYRH 193

Query: 182 SEIT-KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
           S +  K  I+     R  P+ ++ I + +A +   R   QP++  + GSTFK P G+ A 
Sbjct: 194 SIVQEKGYIVLSARFRLTPKPKDEIKSYMAELRTKRVEKQPLEYPSAGSTFKRPEGYFAG 253

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LI  +G RG   G A++S+ HC F++N   AT  D+  L + V++ V  Q G+ LE E+
Sbjct: 254 KLIMDAGLRGYSVGDAQVSQKHCGFVVNKGEATAADVLTLIKDVQETVLKQFGVKLEPEV 313

Query: 301 KRLGDF 306
           K +G+F
Sbjct: 314 KMIGEF 319


>gi|199597304|ref|ZP_03210735.1| UDP-N-acetylmuramate dehydrogenase [Lactobacillus rhamnosus HN001]
 gi|199591820|gb|EDY99895.1| UDP-N-acetylmuramate dehydrogenase [Lactobacillus rhamnosus HN001]
          Length = 287

 Score =  156 bits (394), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 95/284 (33%), Positives = 155/284 (54%), Gaps = 9/284 (3%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRGVV 84
           PL   T+ +TGG A+++  P+D+ +++  + +    D+P+T++G  SN++VRD GIRG+V
Sbjct: 6   PLSHYTFTKTGGPADLLAFPKDVAEVQALVEMARERDMPLTVIGNASNLIVRDGGIRGLV 65

Query: 85  LRLSNAGFSNIEVR-NHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMN 143
           L L+      I V  N      GAR    +   +A R G+ G  F  GIPGS+GGA +MN
Sbjct: 66  LILT--AMKKITVNGNDVTAQAGARLIDTT--EAAYRAGLTGLEFAAGIPGSVGGALFMN 121

Query: 144 AGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI--TKDLIITHVVLRGFPES 201
           AGA N E    + + H + R G        +L ++YR S +  T D++++      F + 
Sbjct: 122 AGAYNGEVCSVISQAHVLTRAGELKTYNHRELNFRYRHSVVQDTGDIVLSVTFSMKFGD- 180

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
           +  I A +  +   R   QP++  + GS FK P  H    +I+K+G +G   GGA++S+ 
Sbjct: 181 KPTIRAKMDELNARRAAKQPLEYPSCGSVFKRPPDHFVGPMIQKAGLQGHIIGGAQVSKK 240

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           H  F+IN  NAT  D   +   ++K V  + G+ LE E++ +G+
Sbjct: 241 HAGFIINLGNATATDYLDMIHLIQKTVKAKFGVDLEPEVRIIGE 284


>gi|167461908|ref|ZP_02326997.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Paenibacillus larvae
           subsp. larvae BRL-230010]
 gi|322381649|ref|ZP_08055615.1| UDP-N-acetylenolpyruvoylglucosamine reductase-like protein
           [Paenibacillus larvae subsp. larvae B-3650]
 gi|321154389|gb|EFX46699.1| UDP-N-acetylenolpyruvoylglucosamine reductase-like protein
           [Paenibacillus larvae subsp. larvae B-3650]
          Length = 308

 Score =  156 bits (394), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 97/286 (33%), Positives = 147/286 (51%), Gaps = 15/286 (5%)

Query: 27  LKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIRGVVL 85
           LK  T+ +TGG A++   P         +    + D+P+T++G GSN++VRD GIRG+VL
Sbjct: 26  LKLFTYTKTGGTADLFITPPTYEAAGQLIRYARNHDLPVTLIGNGSNLIVRDGGIRGIVL 85

Query: 86  RLS-----NAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAA 140
            L      N G   I  ++   +I         ++++AL+  + G  F  GIPGS+GGA 
Sbjct: 86  SLMKLNKINPGVHAITAQSGAAII--------DVSSAALKQHLSGLEFACGIPGSVGGAL 137

Query: 141 YMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGF-P 199
           +MNAGA   E S  +     +  +G    + +E L   YR S I +   I      G  P
Sbjct: 138 FMNAGAYGGEISDVLKSALVLTSEGELLQLTKEDLALSYRKSAIAEKRYIALEATFGLTP 197

Query: 200 ESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKIS 259
            +   I A +  +   RE+ QP++  + GS FK P  H A +LI+ SG +G   GGA++S
Sbjct: 198 SNPAAIKAKMDELTFLRESKQPLEYPSCGSVFKRPPNHFAGKLIQDSGLQGTRIGGAEVS 257

Query: 260 ELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
             H  F++N DNAT  D   L   V+  V  + G+ LE E+K +G+
Sbjct: 258 RKHAGFIVNIDNATAKDYTNLIRLVQNTVKEKFGVDLETEVKIIGE 303


>gi|261419140|ref|YP_003252822.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus sp.
           Y412MC61]
 gi|297530890|ref|YP_003672165.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus sp.
           C56-T3]
 gi|319765956|ref|YP_004131457.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus sp.
           Y412MC52]
 gi|261375597|gb|ACX78340.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus sp.
           Y412MC61]
 gi|297254142|gb|ADI27588.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus sp.
           C56-T3]
 gi|317110822|gb|ADU93314.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus sp.
           Y412MC52]
          Length = 304

 Score =  156 bits (394), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 106/306 (34%), Positives = 160/306 (52%), Gaps = 11/306 (3%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS- 60
           IY R+  +  ER   LR +     P+K  T  R GG A+ +  P+    +   L L    
Sbjct: 7   IYQRLVEICGER-NVLRDE-----PMKNHTLVRIGGKADFLVWPETYEQVIEVLRLKEEY 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
            +P T++G GSN+++RD G+RG+V++L +    N   R    +I  +    K+++  AL 
Sbjct: 61  GLPFTLLGNGSNVIIRDGGLRGIVMQLRHL---NRIWREGNNVIAQSGADIKAVSRFALE 117

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             + G  F  GIPGS+GGA  MNAGA   E    +  V      G    +  E+L+  YR
Sbjct: 118 QHLTGLEFACGIPGSVGGAIMMNAGAYGGEVKDVLDHVKVATLSGELKTLKNEELELGYR 177

Query: 181 SSEITKDL-IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
           +S I++   I+  VV    P     I A + ++   RE+ QP++  + GS FK P G+ A
Sbjct: 178 TSIISRTHDIVLEVVFALRPGDYAQIKAKMDDLTFQRESKQPLEYPSVGSVFKRPPGYFA 237

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LI+ SG +G  FGGA++S  H  F+IN +NAT  D     E VRK V  + G+ LE E
Sbjct: 238 GKLIQDSGLQGKGFGGAEVSTKHAGFIINKNNATAADYIATIEMVRKTVKEKFGVDLELE 297

Query: 300 IKRLGD 305
           +K +G+
Sbjct: 298 VKIIGE 303


>gi|282891351|ref|ZP_06299853.1| hypothetical protein pah_c050o152 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281498848|gb|EFB41165.1| hypothetical protein pah_c050o152 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 293

 Score =  156 bits (394), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 98/285 (34%), Positives = 144/285 (50%), Gaps = 7/285 (2%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAG 79
           +QEN  L  ++ F  GG A    + +DI  ++  L    + DIP  I+G GSN L  DAG
Sbjct: 7   YQENKLLSGLSTFGIGGPARYYAKVRDIPSMQQMLAFCSAHDIPFFILGKGSNCLFDDAG 66

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMI-VGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
             G+V+      F N       E+  VGA  S   L     R G  G  F  GIP S+GG
Sbjct: 67  FDGLVIHNKIDFFEN----PRPELFRVGAGYSFSLLGVKTAREGWSGLEFASGIPASVGG 122

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGF 198
           A +MNAGAN CET   + EV  +D  G  ++  +E L + YR+S   +++    V    F
Sbjct: 123 AVFMNAGANGCETCASLYEVEYVDETGQLYIFSKENLPFSYRTSPF-QNMSGAVVAASFF 181

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
               +        +  +R+  QP  EK+ G  F+NP    A  LIE++G +G   GGAK+
Sbjct: 182 LSRLDSARQKQFEILDYRKKTQPYGEKSAGCIFRNPQSGHAGALIEQTGLKGQVIGGAKV 241

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           S +H NF++N  NA   D+  L   ++++V  Q G+ LE E++ +
Sbjct: 242 SSMHANFIVNDGNARAQDVLELIAHIKEEVLKQQGVELESEVRYI 286


>gi|289422276|ref|ZP_06424130.1| UDP-N-acetylmuramate dehydrogenase [Peptostreptococcus anaerobius
           653-L]
 gi|289157327|gb|EFD05938.1| UDP-N-acetylmuramate dehydrogenase [Peptostreptococcus anaerobius
           653-L]
          Length = 306

 Score =  156 bits (394), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 95/285 (33%), Positives = 151/285 (52%), Gaps = 10/285 (3%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDL-KYFLTLLPSDIPITIVGLGSNILVRDAGIRGVV 84
           P+     F+ GG A+++ +P+   ++ K F     ++IP  I G GSNIL++D G RG+V
Sbjct: 24  PMHNHISFKVGGPADILVRPRTEEEIQKVFKIAKENNIPFIIKGNGSNILIKDGGFRGLV 83

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           + +++  FS+ ++     M V A      +   A+   + GF F  GIPG++GGA  MNA
Sbjct: 84  IEIAD-NFSDYKIEEET-MTVQAGALLSIIGKKAMEASLTGFEFASGIPGTLGGALAMNA 141

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPESQNI 204
           GA   E    V  V  +D  GN      E++ + YR S ++      H+ L    + Q  
Sbjct: 142 GAYGGEMKNIVESVRIMDEDGNIKEYSNEEMAFSYRHSRLSD---TKHIALSARIKLQKG 198

Query: 205 ISAAIANVCHH----RETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISE 260
           I   I  +       R + QP++  + GSTFK P G+ A +LI+ S  +G + GGA++S 
Sbjct: 199 IYEDIKEIMDDLRLKRTSKQPLEYPSAGSTFKRPEGYFAGKLIQDSDLKGYQMGGAQVSS 258

Query: 261 LHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            H  F+IN D A+  D+  L + V+++VF   G+ LE E+K LG+
Sbjct: 259 KHSGFIINYDKASAKDIINLIDHVKERVFECFGVRLEEEVKILGE 303


>gi|309776416|ref|ZP_07671402.1| UDP-N-acetylmuramate dehydrogenase [Erysipelotrichaceae bacterium
           3_1_53]
 gi|308915807|gb|EFP61561.1| UDP-N-acetylmuramate dehydrogenase [Erysipelotrichaceae bacterium
           3_1_53]
          Length = 300

 Score =  156 bits (394), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 103/291 (35%), Positives = 151/291 (51%), Gaps = 5/291 (1%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNIL 74
           Q  G  +   PL + T FR GG  +    P+D   L   L +L  + IP  I G GSNIL
Sbjct: 8   QSYGDVECRVPLSKRTTFRIGGTCKYFIYPKDELCLLRILDILNEEAIPHRIFGKGSNIL 67

Query: 75  VRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPG 134
             D    G +L L    F++         +V A  S   LA+ A+++   G  F  GIPG
Sbjct: 68  CSDDDYEGAILCLDRY-FTDFFFEEEGSCLVQAGASIIMLAHEAMKNSFSGLEFASGIPG 126

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS--EITKDLIITH 192
           ++GGA +MNAGA   + SQ + EV+ +  + +  V+  E+L+Y YR S  +  +D II  
Sbjct: 127 TLGGAVFMNAGAYKSDISQILKEVYVLKER-SIVVMRAEELEYAYRHSIFQSHRDWIILG 185

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
             L+     Q  I   + +    R + QP+ +   GS F+NP  + AWQLIE+ G RG  
Sbjct: 186 ARLQLEKGDQKEIRDLMDSRRKRRMSSQPLDKPCAGSMFRNPKDYQAWQLIEEIGMRGTR 245

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
            GGA +SE H NF++N DNA   D+  L E ++K+V  + G+ L  E++R 
Sbjct: 246 VGGAMVSEKHANFIVNEDNARAEDVIQLVEVIQKEVRKRFGVELITEVERF 296


>gi|149175313|ref|ZP_01853935.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Planctomyces maris
           DSM 8797]
 gi|148845922|gb|EDL60263.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Planctomyces maris
           DSM 8797]
          Length = 292

 Score =  156 bits (394), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 88/277 (31%), Positives = 152/277 (54%), Gaps = 3/277 (1%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTL-LPSDIPITIVGLGSNILVRDAGIRGVV 84
           PL + ++F+ GG A+   +P++  +L+  +   + ++IP+ + G  SNIL++D+G++G V
Sbjct: 16  PLAKYSYFKIGGPAQFFLEPRNADELQAVIKCCVENEIPVRVFGGASNILIKDSGVQGAV 75

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           +R+    FS I +     +  GA     +L +  ++ G+ G     GIPG++GGA + NA
Sbjct: 76  IRIHADEFSKISIEGTT-VTAGAGALLSNLVSETVKAGLAGLESLVGIPGTVGGALHGNA 134

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPESQNI 204
           G +N +T Q+   V  +  +G + V   ++L + YR S I +  II  V      +S+ +
Sbjct: 135 GGHNGDTGQFATSVTVLTARGEKFVRTADELSFSYRESSINELAIIEAVFELTADDSEEV 194

Query: 205 ISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCN 264
            +    N    +   QP+  ++ G  FKNP G  A  LIE++G +G   GGA+IS+ H N
Sbjct: 195 TNRMKKNWIMKKAN-QPLTHQSAGCIFKNPRGMHAGALIEQAGLKGTRIGGAEISDRHAN 253

Query: 265 FMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           F+IN +NAT  ++  L    +  V  + G+ LE EI+
Sbjct: 254 FIINDENATTENVLDLINLAQNTVSEKFGVDLELEIE 290


>gi|223042981|ref|ZP_03613029.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           capitis SK14]
 gi|222443835|gb|EEE49932.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           capitis SK14]
          Length = 310

 Score =  155 bits (393), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 92/282 (32%), Positives = 153/282 (54%), Gaps = 5/282 (1%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTL-LPSDIPITIVGLGSNILVRDAGIRGVV 84
           PLK+ T+  TGG A+    P    +++  +     ++IP+T +G GSNI++R+ GIRG+V
Sbjct: 28  PLKRYTYTETGGEADFYLSPTKNEEVQAIVAYAYNNNIPVTYLGNGSNIIIREGGIRGIV 87

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           L L      +I+V +   +I G+  +   ++  A  H + G  F  GIPGSIGGA +MNA
Sbjct: 88  LSL--LSLDHIDVSDDA-IIAGSGAAIIDVSRVARDHVLTGLEFACGIPGSIGGAVFMNA 144

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFPESQN 203
           GA   E    +     ++ KG+   +  E+L+  YR+S + K  L++        P   +
Sbjct: 145 GAYGGEVKDCIDYALCVNEKGDLIKLTNEELELDYRNSIVQKKHLVVLEAAFTLMPGHLD 204

Query: 204 IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHC 263
            I A + ++   RE+ QP++  + GS F+ P GH A +LI+ S  +G   GG ++S+ H 
Sbjct: 205 EIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHFAGKLIQDSDLQGHRIGGVEVSKKHA 264

Query: 264 NFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            FM+N D  T  D E L   V++ V ++  + L  E++ +G+
Sbjct: 265 GFMVNVDKGTATDYEDLIHHVQRTVKDKFDVELNTEVRIIGE 306


>gi|295399715|ref|ZP_06809696.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|312111766|ref|YP_003990082.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus sp.
           Y4.1MC1]
 gi|294978118|gb|EFG53715.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|311216867|gb|ADP75471.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus sp.
           Y4.1MC1]
          Length = 303

 Score =  155 bits (393), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 99/299 (33%), Positives = 155/299 (51%), Gaps = 5/299 (1%)

Query: 9   LLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIV 67
           +++E      GK +E  PL   T  + GG A+V+ +P  I  L+  + ++   ++P   +
Sbjct: 4   MIKELANANVGKVKEREPLANHTTMKVGGPADVLIEPSSIESLQNAIAIVKKYEVPWRAI 63

Query: 68  GLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFH 127
           G GSN+LV D GI GVV+++ + G   + V     + VG   S   LA    + G+ G  
Sbjct: 64  GRGSNLLVSDEGIEGVVIKM-DEGLDELHVDGET-VTVGGGYSLVRLATLMSKQGLSGLE 121

Query: 128 FFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS--EIT 185
           F  GIPGS+GGA YMNAGA+  + +Q V     +   G    +  E++++ YR+S  +  
Sbjct: 122 FAGGIPGSVGGAVYMNAGAHGSDMAQIVKRALILFPDGTMEWLTNEEMEFAYRTSVLQTK 181

Query: 186 KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEK 245
           +  I     LR    ++  I A +     +R   QP  +   GS F+NP    A +LIE+
Sbjct: 182 RRGICVAAELRLASGNREKIVAKMRENKDYRRKTQPWDKPCAGSIFRNPLPQHAGRLIEE 241

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           +G +G   GGAKISE H NF++N  NA   D+  L   V+K +    GI L+ E++ +G
Sbjct: 242 AGLKGYAIGGAKISEQHANFIVNTGNAKAKDVLDLIRFVKKTINELYGIHLQTEVEIIG 300


>gi|229086474|ref|ZP_04218646.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           Rock3-44]
 gi|228696791|gb|EEL49604.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           Rock3-44]
          Length = 306

 Score =  155 bits (393), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 103/303 (33%), Positives = 161/303 (53%), Gaps = 7/303 (2%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           + +L +E  +   G   EN  L + T  + GG A+++  P  +  ++  L L+    I  
Sbjct: 6   MKQLAKELIEAEVGTVLENEALARYTTMKIGGPADILVMPSSVVGVEKTLYLVKKYHIKW 65

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T +G GSN+LV D GI GVV+RL   G  ++EV     + VG       L+    R G+ 
Sbjct: 66  TAIGRGSNLLVSDNGIEGVVIRLGE-GLEHLEVEG-TTVRVGGGYPLIKLSTLLSRQGLA 123

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS-- 182
           G  F  GIPGS+GGA YMNAGA+  + S+ +   H +   G    + +E++++ YR+S  
Sbjct: 124 GLEFASGIPGSMGGAVYMNAGAHKSDVSEVLTRAHIMFDDGTMKWLTKEEMEFSYRTSVL 183

Query: 183 EITKDLIITHVVLR-GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
           +  +  I+    L+      + I+S    N  + RET QP      GS F+NP  H A  
Sbjct: 184 QTKRSGIVVEAELQLKAGNREEIVSIMQKNKDYRRET-QPWNYPCAGSIFRNPLPHFAGD 242

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           L+EK+G RG + GGAKISE+H NF++NA  A+  D+  L   V+K +  + G+ +  E++
Sbjct: 243 LVEKAGLRGYQIGGAKISEMHGNFIVNAGFASAQDVLDLIAFVKKTIKEKFGVDMHTEVE 302

Query: 302 RLG 304
            +G
Sbjct: 303 IIG 305


>gi|322387534|ref|ZP_08061143.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus infantis ATCC
           700779]
 gi|321141401|gb|EFX36897.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus infantis ATCC
           700779]
          Length = 304

 Score =  155 bits (393), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 99/289 (34%), Positives = 146/289 (50%), Gaps = 15/289 (5%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRG 82
           N PLK  T+ + GG A+ +  P + +++   +      +I   ++G  SNI+VR+ GIRG
Sbjct: 22  NEPLKTYTYTKVGGKADYLAFPSNHYEMARVVKFANQENISWMVLGNASNIIVREGGIRG 81

Query: 83  VVL---RLSNAGFS--NIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            V+   +L+N       IE      +I   R         ALRH + GF F  GIPGS+G
Sbjct: 82  FVIMCDKLNNVSVDGYTIEAEAGANLIETTRI--------ALRHSLTGFEFACGIPGSVG 133

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLR 196
           GA +MNAGA   E S  +     + + G    +  + L + YR S I     ++      
Sbjct: 134 GAVFMNAGAYGGEISNILQSCKVLTKDGEIETLSAKDLAFGYRHSAIQDSGAVVLSAKFA 193

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
             P +   I+  +  + H RE  QP++  + GS FK P GH A QLI ++G +G   GG 
Sbjct: 194 LSPGNYETINQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGYRIGGV 253

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           ++SE H  FMIN  + T  D E L E V +KV   SG+ LE E++ LG+
Sbjct: 254 EVSEKHAGFMINVADGTARDYEDLIESVIEKVKEHSGVTLEREVRILGE 302


>gi|160878488|ref|YP_001557456.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           phytofermentans ISDg]
 gi|187609716|sp|A9KSS3|MURB_CLOPH RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|160427154|gb|ABX40717.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           phytofermentans ISDg]
          Length = 310

 Score =  155 bits (393), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 100/289 (34%), Positives = 153/289 (52%), Gaps = 10/289 (3%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIRG 82
           N PL + T F+ GG A+     + I +    +      ++P+ ++G GSN+L+ DAGIRG
Sbjct: 21  NEPLSKHTSFKIGGPADYFVITKKIEETAAVIQCCNQHNLPLLMIGKGSNLLISDAGIRG 80

Query: 83  VVLRLSN--AGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAA 140
           VVL+  +   GF   +      +  GA  +  + A       + GF F  GIPGS+GGA 
Sbjct: 81  VVLKQEDNTEGFFVTQCEEGYLVTGGAGMNLSAFAMKIANESLTGFEFAAGIPGSLGGAV 140

Query: 141 YMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD----LIITHVVLR 196
           YMNAGA   E    +     + ++G    + RE+L+  YRSS I K     +  T ++ +
Sbjct: 141 YMNAGAYGGEIKDCIKSARVLTKEGQILSLNREELELSYRSSIIQKKGYYVIDATFLLQK 200

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G   +Q  I   I  +   R+  QP++  + GSTFK P G+ A +LI  +G RG   GGA
Sbjct: 201 G---NQEDILRKIEELNQARKDKQPLEYPSAGSTFKRPEGYFAGKLIMDAGLRGYRVGGA 257

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            +SE HC F+IN  +AT  D+  L + VR+ V  + G+ LE E++ +G+
Sbjct: 258 MVSEKHCGFVINTGDATAKDVLQLIDDVRRIVKEKFGVTLEPEVRLIGE 306


>gi|269926709|ref|YP_003323332.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermobaculum
           terrenum ATCC BAA-798]
 gi|269790369|gb|ACZ42510.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermobaculum
           terrenum ATCC BAA-798]
          Length = 301

 Score =  155 bits (393), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 101/296 (34%), Positives = 161/296 (54%), Gaps = 13/296 (4%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTL-LPSDIPITIVGLGSNILVRDA 78
           K + N PL + T  + GG A +  + +   +L   +   +  ++P  ++G GSNI+V DA
Sbjct: 10  KIEYNEPLWKHTSVKVGGPARLFTRVRGSEELLNAVRWAIAENMPFMVIGSGSNIVVADA 69

Query: 79  GIRGVVLRLSNAGFSNIEV-RNHCEMIVGARCSGKSLANSALRH---GIGGFHFFYGIPG 134
           G  G+V+   N+   ++ V R   + ++    +G  L  +A +    G+ G  +  GIPG
Sbjct: 70  GFNGLVI---NSISRDVRVVREEDDQVIVELDAGTFLPTAAKKLASLGLAGLEWGVGIPG 126

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVV 194
           ++GGA   NAGA   +T++ +V++  ID +G    +  E+L +QYRSS I +  I    V
Sbjct: 127 TVGGAVVGNAGAYGGDTAERLVDIDAIDLRGEFITLTNEELAFQYRSSAIKRGEIEIAAV 186

Query: 195 LRG----FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRG 250
           +R     F    N+I+  I +    R+  +P+ E + GSTFKNP G+ A  +IE +G +G
Sbjct: 187 IRARYRVFRSDPNLINIKIRHFLMERKRKEPV-EPSIGSTFKNPPGNYAGAIIESAGLKG 245

Query: 251 LEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           L  GGA +S  H N++IN  NAT  D+  L E +R  V  + GI LE EI+  GD+
Sbjct: 246 LRVGGAMVSPKHANYIINTGNATASDIRDLVETIRDLVLERKGIRLETEIEFKGDW 301


>gi|227552169|ref|ZP_03982218.1| UDP-N-acetylmuramate dehydrogenase [Enterococcus faecium TX1330]
 gi|257886667|ref|ZP_05666320.1| UDP-N-acetylmuramate dehydrogenase [Enterococcus faecium 1,141,733]
 gi|257892877|ref|ZP_05672530.1| UDP-N-acetylmuramate dehydrogenase [Enterococcus faecium 1,231,408]
 gi|257895242|ref|ZP_05674895.1| UDP-N-acetylmuramate dehydrogenase [Enterococcus faecium Com12]
 gi|257897864|ref|ZP_05677517.1| UDP-N-acetylmuramate dehydrogenase [Enterococcus faecium Com15]
 gi|293377226|ref|ZP_06623431.1| UDP-N-acetylmuramate dehydrogenase [Enterococcus faecium PC4.1]
 gi|227178701|gb|EEI59673.1| UDP-N-acetylmuramate dehydrogenase [Enterococcus faecium TX1330]
 gi|257822721|gb|EEV49653.1| UDP-N-acetylmuramate dehydrogenase [Enterococcus faecium 1,141,733]
 gi|257829256|gb|EEV55863.1| UDP-N-acetylmuramate dehydrogenase [Enterococcus faecium 1,231,408]
 gi|257831807|gb|EEV58228.1| UDP-N-acetylmuramate dehydrogenase [Enterococcus faecium Com12]
 gi|257835776|gb|EEV60850.1| UDP-N-acetylmuramate dehydrogenase [Enterococcus faecium Com15]
 gi|292644087|gb|EFF62192.1| UDP-N-acetylmuramate dehydrogenase [Enterococcus faecium PC4.1]
          Length = 311

 Score =  155 bits (392), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 97/285 (34%), Positives = 154/285 (54%), Gaps = 11/285 (3%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAGIRGVV 84
           PL   T+ +TGG A+V+  P+   ++K  +      DIP  ++G  SN++V+D GIRGVV
Sbjct: 20  PLMNYTFTKTGGPADVLAFPKKQEEVKQIIDYCRIHDIPWMVLGNASNLIVQDGGIRGVV 79

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           + L+      I V+    +I  A  S      +AL   + GF F  GIPGS+GGA YMNA
Sbjct: 80  IMLTE--MKQIHVKGTM-VIAEAGASLIDTTYAALAESLTGFEFACGIPGSVGGAVYMNA 136

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPESQN- 203
           GA   E      EV  +   G    + +E++ + YR S+I +   +  +VL      Q  
Sbjct: 137 GAYGGEIKDVFAEVDLLLEDGTLKTLTKEEMVFSYRHSKIQE---LRAIVLEARFSLQTG 193

Query: 204 ---IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISE 260
               I A +  +   R++ QP++  + GS FK P GH   QLI+++G +GL++GGA+ISE
Sbjct: 194 DYEAIKARMDELTELRQSKQPLEYPSCGSVFKRPVGHYTGQLIQQAGLQGLKWGGAQISE 253

Query: 261 LHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            H  F++N D+AT  D   L   +++ +  +  + LE E++ +G+
Sbjct: 254 KHAGFIVNIDHATATDYIELIAHIQEVIKEKFDVSLETEVRIIGE 298


>gi|270290672|ref|ZP_06196896.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Pediococcus
           acidilactici 7_4]
 gi|304386196|ref|ZP_07368529.1| UDP-N-acetylmuramate dehydrogenase [Pediococcus acidilactici DSM
           20284]
 gi|270280732|gb|EFA26566.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Pediococcus
           acidilactici 7_4]
 gi|304327553|gb|EFL94780.1| UDP-N-acetylmuramate dehydrogenase [Pediococcus acidilactici DSM
           20284]
          Length = 300

 Score =  155 bits (392), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 98/289 (33%), Positives = 156/289 (53%), Gaps = 7/289 (2%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDA 78
           K  ++ PL + T  +TGG A+++  P+ + + K  +     +  P+T++G  SN++VRD 
Sbjct: 14  KVYKDEPLSKYTNTQTGGPADLLVFPKSVTETKQLMIWAKETATPLTVIGNASNLIVRDG 73

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIRG+VL L+     NI+V N   +I  A  +       A + G+ GF F  GIPGS+GG
Sbjct: 74  GIRGLVLILTK--MDNIQV-NGNTVIAEAGAALIQATEVAYQSGLTGFEFAAGIPGSVGG 130

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK--DLIITHVVLR 196
           A +MNAGA   E S+ V     +   G    +   +L + YR S +    D++I+    +
Sbjct: 131 AIFMNAGAYGGEISEIVESAEVLTPDGQIKRLNNHELDFGYRHSSVQDYHDVVIS-ASFK 189

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
             P  Q  I A +  +   R + QP++  + GS FK PTG+   +LI ++G +G   GGA
Sbjct: 190 LRPGDQTKIRARMDELNRLRASKQPLEYPSCGSVFKRPTGYFTGKLIHEAGLQGFTIGGA 249

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           ++S+ H  F+IN  NAT  D   +   V+  VF Q G+ LE E++ +G+
Sbjct: 250 QVSKKHAGFIINIGNATATDYLDVIHHVQATVFKQFGVKLETEVRIIGE 298


>gi|259046534|ref|ZP_05736935.1| UDP-N-acetylmuramate dehydrogenase [Granulicatella adiacens ATCC
           49175]
 gi|259036699|gb|EEW37954.1| UDP-N-acetylmuramate dehydrogenase [Granulicatella adiacens ATCC
           49175]
          Length = 303

 Score =  155 bits (392), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 99/285 (34%), Positives = 163/285 (57%), Gaps = 7/285 (2%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRG 82
           N PLK+ T+ +TGGNA ++  P+D  +       L   +I  TI+G  SN++++D GI G
Sbjct: 18  NEPLKKYTFTKTGGNAAILIFPKDKQEASEVTHWLREQNIQTTILGNASNVIIKDGGISG 77

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
            V+ L++   S+++V +  +++     +   ++  A ++G+ G  F  GIPGS+GGA YM
Sbjct: 78  AVIMLND--MSHLKV-DGTKIVAEGGVALIDVSKEAAKNGLTGLEFACGIPGSVGGAIYM 134

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI--TKDLIITHVVLRGFPE 200
           NAGA   E S+ V  V  I  +G+      E+L++ YR S I  T DL+I  V  +    
Sbjct: 135 NAGAYGGEVSEVVEYVEVITPEGHLKTYSAEELEFSYRHSFIQNTGDLVI-EVGFQLEKG 193

Query: 201 SQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISE 260
           +Q  I   IA + H R++ QP++  + GS FK P G+   +LI+ +G +G + GGA++S 
Sbjct: 194 NQEEIDEKIAELTHLRQSKQPLEYPSCGSVFKRPEGYFTGKLIQDAGLQGYQIGGAQVSN 253

Query: 261 LHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            H  F++N DNAT  D   L   ++K +  + G+ LE E++ +G+
Sbjct: 254 KHAGFIVNIDNATATDYMDLIRHIQKVILEKDGVSLEPEVRIIGE 298


>gi|313901766|ref|ZP_07835192.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermaerobacter
           subterraneus DSM 13965]
 gi|313467972|gb|EFR63460.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermaerobacter
           subterraneus DSM 13965]
          Length = 330

 Score =  155 bits (392), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 105/314 (33%), Positives = 158/314 (50%), Gaps = 8/314 (2%)

Query: 9   LLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIV 67
           + RE    ++G  +   PL + T FR GG AE++ +P    DL   LT      +P+T++
Sbjct: 8   MARELQGLVQGAVRVAEPLARYTTFRIGGPAELLVEPAAEDDLARTLTWARERGLPVTLL 67

Query: 68  GLGSNILVRDAGIRGVVLRLSNAG--FSNIEVRNHCEMIVGARCSGKSLANSALRHGIGG 125
           G GSN+LV D G+ GVV+R+   G  +   + +    ++VGA      L + A R G  G
Sbjct: 68  GGGSNVLVPDEGLPGVVVRIGLDGIRWEPPDPQGRRGVVVGAGTVLARLVHEAARRGFRG 127

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT 185
                GIPG++GGA  MNAG  +    Q V  V  ++  G      RE+  + YRSS + 
Sbjct: 128 LEPCAGIPGTVGGALVMNAGTRHGSIGQVVDWVRVVEPAGRVARWSREECGFAYRSSRMQ 187

Query: 186 KD---LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
           K+   ++   +VL   P    +I   I     +R+  QP++    GS FKNP G ++ +L
Sbjct: 188 KEAVPVVAARLVLE--PGDPRVILEEIRRHTAYRQRTQPLRYPNCGSVFKNPPGDASGRL 245

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IE  G +GL  G A+ISE H NF+IN   A   D+  L     + V ++ GI LE E++ 
Sbjct: 246 IEACGLKGLRHGQAQISEQHANFIINLGGARAEDVLALMTTAWRCVRDRFGITLEPEVRL 305

Query: 303 LGDFFDHQIVDATK 316
           LG        +A +
Sbjct: 306 LGSLARRWPPEAPE 319


>gi|182684348|ref|YP_001836095.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae CGSP14]
 gi|259509761|sp|B2IQK6|MURB_STRPS RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|182629682|gb|ACB90630.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae CGSP14]
          Length = 301

 Score =  155 bits (392), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 101/295 (34%), Positives = 149/295 (50%), Gaps = 21/295 (7%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQ---DIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +F+E  PL   ++ + GG  + +  P+   ++  LK F       IP  ++G  SNI+VR
Sbjct: 17  RFKE--PLHSYSYTKVGGEPDYLVFPRNRCELARLKRFSN--QEHIPWMVLGNASNIIVR 72

Query: 77  DAGIRGVVL---RLSNAGFS--NIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYG 131
           D GIRG V+   +L+N       IE      +I   R         ALRH + GF F  G
Sbjct: 73  DGGIRGFVILCDKLNNVSVDGYTIEAEAGANLIETTRI--------ALRHSLTGFEFACG 124

Query: 132 IPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LII 190
           IPGS+GGA +MNAGA   E +  +     + + G    +  + L + YR S I +   ++
Sbjct: 125 IPGSVGGAVFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAKDLAFGYRHSAIQESGSVV 184

Query: 191 THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRG 250
                   P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G
Sbjct: 185 LSAKFALAPGTHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKG 244

Query: 251 LEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
              GG ++SE H  FMIN  + T  D E L E V +KV   SG+ LE E++ LG+
Sbjct: 245 YRIGGVEVSEKHAGFMINVADGTAKDYEDLIESVIEKVKEHSGVTLEREVRILGE 299


>gi|223984512|ref|ZP_03634644.1| hypothetical protein HOLDEFILI_01939 [Holdemania filiformis DSM
           12042]
 gi|223963498|gb|EEF67878.1| hypothetical protein HOLDEFILI_01939 [Holdemania filiformis DSM
           12042]
          Length = 299

 Score =  155 bits (391), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 153/288 (53%), Gaps = 9/288 (3%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDA 78
           + Q    +   T F  GG AE++  P     L+  + L   + IP  ++G  SN+L+  A
Sbjct: 17  ELQRRVTMAPYTSFHIGGPAELVALPDTADKLRACIELARRAKIPYRVLGQASNVLIASA 76

Query: 79  GIRG--VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           G  G  ++LR + AG S    R   +    A  + K L + A++ G+ G    YGIPGS+
Sbjct: 77  GYPGMIILLRSNWAGLSQEGTRLRAD----AGLTIKRLCDGAMQAGLSGLERLYGIPGSV 132

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVL 195
           GGA + N+GA   E S+ ++E   I   G +    R+QL++ YRSS +  ++ ++   V 
Sbjct: 133 GGALHNNSGAFGTELSE-ILESAQILVDGEEKTFTRDQLRFGYRSSLLNDQNHVLVRAVF 191

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           R  P  +  I A +      R   QP+   + GS FK P GH A  LI++ G +G + GG
Sbjct: 192 RLTPGRRQEIKALMEETMARRTAKQPLDYPSAGSVFKRPAGHYASALIDQCGLKGKQIGG 251

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           A++SE H  F+IN + A+  D+  L   ++K+VF+Q+ ++LE EI+ L
Sbjct: 252 AQVSEKHAGFIINRNQASSGDVTALVAHIQKEVFDQTSVVLECEIETL 299


>gi|295105631|emb|CBL03175.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Faecalibacterium
           prausnitzii SL3/3]
          Length = 298

 Score =  155 bits (391), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 102/286 (35%), Positives = 145/286 (50%), Gaps = 10/286 (3%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAG 79
           ++EN PL     F+ GG A +  QP D   L   + L  +  +   ++G GSNIL  D G
Sbjct: 15  YKENEPLAAHCTFKIGGPARLFVQPADRAQLCRAVALCKAQGVRYYLLGNGSNILFADEG 74

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
             GVVL +S+     +EV    ++  GA     +L  +AL HG+ G  F YGIPG++GGA
Sbjct: 75  YNGVVLDISSMQ-DTVEVHGT-QLTAGAGVRLSALCKTALEHGLTGLEFAYGIPGTVGGA 132

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD----LIITHVVL 195
            YMNAGA   E    +  V  +  +G        +L  +YR S   ++    L     + 
Sbjct: 133 VYMNAGAYGGEMKDVLTTVQYLTAEGEVKEAAAAELDLRYRHSIFEENGGCILSAQFALT 192

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
            G PE   +I A +  +   R   QP+ + + GSTFK P G  A  LI++ G RG   GG
Sbjct: 193 PGEPE---VIRAKMDELMAKRLDKQPLDKPSAGSTFKRPVGAFAAALIDQCGLRGYRHGG 249

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           A +SE HC F++N   AT  D+  L E+VR  V  ++G  LE EI+
Sbjct: 250 AAVSEKHCGFVVNLGGATCADVLALCEEVRTIVKEKTGYDLEKEIR 295


>gi|28212078|ref|NP_783022.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium tetani
           E88]
 gi|47605874|sp|Q890Y6|MURB_CLOTE RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|28204521|gb|AAO36959.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium tetani
           E88]
          Length = 307

 Score =  155 bits (391), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 99/303 (32%), Positives = 166/303 (54%), Gaps = 10/303 (3%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLT-LLPSDIPI 64
           IS L+   G +     + N  +K  T F+ GG  +++  P+    ++Y +     ++IP 
Sbjct: 8   ISNLIENLGSE---NVKTNELMKNHTSFKVGGPVDILVTPESYEQVQYVIKHSRGNNIPY 64

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            I+G GSN+LVRD GIRG+V++        IE     ++I  +      ++N A ++ + 
Sbjct: 65  FIMGNGSNLLVRDGGIRGLVIKFCKLNRIKIE---DDKIIAQSGVLLSKVSNMAAKNNLE 121

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGSIGGA  MNAGA N E SQ +     +D+ G    + +E+L+  YR+S I
Sbjct: 122 GLEFASGIPGSIGGALTMNAGAYNGEISQVIDSALVLDKSGEILNLSKEELELGYRTSSI 181

Query: 185 TKD--LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
            K+  +++  ++     +S+NI    I  +   R+T QP++  + GSTFK P G+ A +L
Sbjct: 182 LKNGYVVLEAILKLSLGDSKNIYDR-IKELTEKRKTKQPLEYPSAGSTFKRPQGYFAAKL 240

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IE+SG +G+  G A++S+ H  F+IN  NA+  D+  +   V+  V ++  + L  E+  
Sbjct: 241 IEESGLKGINVGDAEVSQKHSGFIINKGNASAKDILNVINIVQDTVKSKFDVELHTEVLI 300

Query: 303 LGD 305
           +G+
Sbjct: 301 IGE 303


>gi|18309335|ref|NP_561269.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens str. 13]
 gi|110798584|ref|YP_694802.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens ATCC 13124]
 gi|168204465|ref|ZP_02630470.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens E str. JGS1987]
 gi|168210458|ref|ZP_02636083.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens B str. ATCC 3626]
 gi|168216566|ref|ZP_02642191.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens NCTC 8239]
 gi|169344098|ref|ZP_02865084.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens C str. JGS1495]
 gi|29336835|sp|Q8XNI0|MURB_CLOPE RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|123149012|sp|Q0TU88|MURB_CLOP1 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|18144011|dbj|BAB80059.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens str. 13]
 gi|110673231|gb|ABG82218.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens ATCC 13124]
 gi|169297833|gb|EDS79930.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens C str. JGS1495]
 gi|170663988|gb|EDT16671.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens E str. JGS1987]
 gi|170711463|gb|EDT23645.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens B str. ATCC 3626]
 gi|182381288|gb|EDT78767.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens NCTC 8239]
          Length = 304

 Score =  155 bits (391), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 99/286 (34%), Positives = 155/286 (54%), Gaps = 15/286 (5%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIRGVV 84
           P+ +  +FR GG A+++  P +   +   L L    ++P  I+G GSNILV+D GI GVV
Sbjct: 25  PMSEHIYFRVGGPADILVTPVNEEQVVNTLKLCREYNVPYFILGNGSNILVKDGGISGVV 84

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSG--KSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           ++ +    + I    +C   V A+     K ++ +AL + + GF F  GIPGSIGGA +M
Sbjct: 85  IKFNK--LNKITTEGNC---VTAQSGALLKDVSKAALENNLRGFEFACGIPGSIGGAVFM 139

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPESQ 202
           NAGA + E +  +     ID   N   + +E+L+  YRSS + K     +VV+    E +
Sbjct: 140 NAGAYDGEMAHVIKSARVIDENCNIKNLTKEELELGYRSSIVMKK---GYVVIEATVELE 196

Query: 203 N----IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           +     I   I ++ + RE+ QP++  + GSTFK P G+ A +LI+ SG +G   GGA +
Sbjct: 197 SGEYASIKDKIDDLTNRRESKQPLEYPSAGSTFKRPEGYFAGKLIQDSGLKGFSIGGAAV 256

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           SE H  F+IN   AT  D+  +   V+K V     + L  E++ +G
Sbjct: 257 SEKHSGFVINKGGATAKDVLDVIAHVQKTVKENFDVELHTEVRIIG 302


>gi|118443439|ref|YP_877366.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium novyi
           NT]
 gi|166222837|sp|A0PYB4|MURB_CLONN RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|118133895|gb|ABK60939.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium novyi
           NT]
          Length = 307

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 99/294 (33%), Positives = 156/294 (53%), Gaps = 13/294 (4%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVR 76
           + + + N  +K  T F+ GG A++   P     +K  + +   ++IP  I+G GSN+LVR
Sbjct: 17  KEEIKNNILMKNYTSFKVGGPADIFVTPNSYEKVKGVINICKENNIPYFILGNGSNVLVR 76

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSL-ANSALRHGIGGFHFFYGIPGS 135
           D GIRGVV+  +       +V      ++    +  S+ AN+AL+  + G  F +GIPGS
Sbjct: 77  DGGIRGVVVSFNKLN----KVYAEGNKVIAESGTLLSMVANTALKSDLTGLEFAHGIPGS 132

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD----LIIT 191
           +GGA  MNAGA N E SQ +     ID  G    + +E+L   YR+S I K+    L  T
Sbjct: 133 VGGAVTMNAGAYNGEISQVIESATVIDNNGKIIKLSKEELDLSYRNSIILKNGYVVLNAT 192

Query: 192 HVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGL 251
             + +G     + I   + ++   R+  QP++  + GSTFK P G+ A +LIE SG +G 
Sbjct: 193 FALQKG---DHDAIKGRMDDLMRRRKEKQPLEYPSAGSTFKRPEGYFAAKLIEDSGLKGT 249

Query: 252 EFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
             G A++S  H  F+IN   A+  D+  L E V+K V  +  + L  E++ +G+
Sbjct: 250 HVGDAEVSIKHSGFLINKGKASAKDILDLIEVVKKTVKEKFNVELNTEVRIVGE 303


>gi|116074301|ref|ZP_01471563.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Synechococcus sp.
           RS9916]
 gi|116069606|gb|EAU75358.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Synechococcus sp.
           RS9916]
          Length = 309

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 99/293 (33%), Positives = 147/293 (50%), Gaps = 11/293 (3%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAG 79
            +   PL   T ++ GG AE + +P D+  L   +       +P  ++G GSN+L+ DAG
Sbjct: 9   LRPQVPLAGYTTWKVGGPAEWLAEPTDLEQLSSLMAWAQQRQMPWRVMGAGSNLLISDAG 68

Query: 80  IRGVVLRLSN-AGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           + G+ L L    G S        E + G      +LA  A R G+ G  +  GIPG++GG
Sbjct: 69  LPGLTLCLRKLQGMSVDATTGVVEALAGEPI--PTLARQAARAGLHGLEWAVGIPGTVGG 126

Query: 139 AAYMNAGAN-----NCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITH 192
           AA MNAGA      +C  S  V++    D  G    +  + L + YR S +    L++  
Sbjct: 127 AAVMNAGAQGGCTADCLMSVKVIDTKAKDDAGTMRTLNNDALAFAYRHSVLQDSALMVVS 186

Query: 193 VVLRGFP-ESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGL 251
              +  P      +S   ++  +HR T QP +  + GS F+NP  H A QLIE  G +G 
Sbjct: 187 ARFQLEPGHDPKELSRITSSNLNHRTTTQPYQWPSCGSVFRNPEPHKAGQLIEALGLKGR 246

Query: 252 EFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
             GGA++S +H NF++N  NAT  D+  L E V+++V    GI L  E+KRLG
Sbjct: 247 RIGGAEVSTVHANFIVNTGNATANDILALIELVQQEVQRSHGIGLHPEVKRLG 299


>gi|289209359|ref|YP_003461425.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thioalkalivibrio sp.
           K90mix]
 gi|288944990|gb|ADC72689.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thioalkalivibrio sp.
           K90mix]
          Length = 319

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 106/294 (36%), Positives = 152/294 (51%), Gaps = 13/294 (4%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLT----LLPSDIPITIVGLGSNI 73
           RG+ + + PL  +T +R GG A+ +F+P D  DL   L       P+ +P+T +GLGSN+
Sbjct: 19  RGEVRPHAPLAGLTSWRVGGPADWLFRPVDRADLVSALADHARHAPA-MPVTFLGLGSNV 77

Query: 74  LVRDAGIRGVVLRLSNAGFSNIEVR---NHCEMIVGARCSGKSLANSALRHGIGGFHFFY 130
           L+RD GI G+V+ LS  G  N   R   N   +  G  C+    A    R G+ G  F  
Sbjct: 78  LIRDGGIEGLVVHLS--GVINERERLEGNRVRLGAGLACA--QAARFCARQGLVGGEFLA 133

Query: 131 GIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLII 190
           GIPG++GGA  MNAGA   E    V  V  +D  G +H     + +  YRS E   D   
Sbjct: 134 GIPGTLGGALRMNAGAWGGEIWPLVEAVSTVDADGQEHRREPAEYRIGYRSVE-GPDEWF 192

Query: 191 THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRG 250
           T  VL+         +A I  +   R   QP+   + GS F+NP G  A +LIE +G +G
Sbjct: 193 TGCVLQLESGDPAAGTARIKELLRERSRKQPLGLPSCGSVFRNPPGDHAARLIEAAGLKG 252

Query: 251 LEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           L  GGA+IS  H NF+ +  +A   D+E+L    + +V  + G+ LE E++ LG
Sbjct: 253 LRHGGAEISPKHANFITHDGSAHAADIEWLLRHAQSEVERRFGVRLEPEVRLLG 306


>gi|110802755|ref|YP_697663.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens SM101]
 gi|122956880|sp|Q0SW37|MURB_CLOPS RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|110683256|gb|ABG86626.1| UDP-N-acetylmuramate dehydrogenase [Clostridium perfringens SM101]
          Length = 304

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 99/286 (34%), Positives = 155/286 (54%), Gaps = 15/286 (5%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIRGVV 84
           P+ +  +FR GG A+++  P +   +   L L    ++P  I+G GSNILV+D GI GVV
Sbjct: 25  PMSEHIYFRVGGPADILVTPVNEEQVVNTLKLCREYNVPYFILGNGSNILVKDGGISGVV 84

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSG--KSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           ++ +    + I    +C   V A+     K ++ +AL + + GF F  GIPGSIGGA +M
Sbjct: 85  IKFNK--LNKITTEGNC---VTAQSGALLKDVSKAALENNLRGFEFACGIPGSIGGAVFM 139

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPESQ 202
           NAGA + E +  +     ID   N   + +E+L+  YRSS + K     +VV+    E +
Sbjct: 140 NAGAYDGEMAHVIKSARVIDENCNIKNLTKEELELGYRSSIVMKK---GYVVIEATIELE 196

Query: 203 N----IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           +     I   I ++ + RE+ QP++  + GSTFK P G+ A +LI+ SG +G   GGA +
Sbjct: 197 SGEYASIKDKIDDLTNRRESKQPLEYPSAGSTFKRPEGYFAGKLIQDSGLKGFSIGGAAV 256

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           SE H  F+IN   AT  D+  +   V+K V     + L  E++ +G
Sbjct: 257 SEKHSGFVINKGGATAKDVLDVIAHVQKTVKENFDVELHTEVRIIG 302


>gi|325694410|gb|EGD36321.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK150]
          Length = 301

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 99/290 (34%), Positives = 152/290 (52%), Gaps = 17/290 (5%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRG 82
           N PL Q T+ + GG A+ +  P++ ++L   +      DIP  ++G  SNI+VRD GIRG
Sbjct: 19  NEPLSQYTYTKVGGAADFLVFPRNRYELARIVNFANQEDIPWMVLGNASNIIVRDGGIRG 78

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANS--ALRHGIGGFHFFYGIPGSIGGAA 140
            V+       +N+ V  +   ++ A      +  +  AL++ + GF F  GIPGS+GGA 
Sbjct: 79  FVIMFDK--LNNVAVDGY---MIEAEAGANLIQTTHIALQNSLTGFEFACGIPGSVGGAV 133

Query: 141 YMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI--TKDLIITHVVLRGF 198
           +MNAGA   E +  +V    +  +G    +    +K+ YR S +  T D++I+      F
Sbjct: 134 FMNAGAYGGEIAHVLVSCKVLTPQGQVKTLDVRDMKFGYRHSLVQETGDIVIS----AKF 189

Query: 199 PESQNI---ISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
             S  +   I   +  + H RE  QP++  + GS FK P GH A  LI ++G +G   GG
Sbjct: 190 ALSLGVHRTIRQEMERLTHLRELKQPLEYPSCGSVFKRPLGHFAGLLISEAGLKGHRIGG 249

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            ++SE H  FMIN D  T  D E L   V ++V   SGI LE E++ +G+
Sbjct: 250 VEVSEKHAGFMINVDKGTAQDYENLIAHVIERVRENSGITLEREVRIIGE 299


>gi|187251676|ref|YP_001876158.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Elusimicrobium
           minutum Pei191]
 gi|186971836|gb|ACC98821.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Elusimicrobium
           minutum Pei191]
          Length = 298

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 97/307 (31%), Positives = 157/307 (51%), Gaps = 28/307 (9%)

Query: 15  KQLRGKFQENF----PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGL 69
           K+L+  F +N     P+   T ++TGG AE +  P+ + D  + L L   +D+P  ++G 
Sbjct: 5   KELKDFFGDNCLLDEPMHTHTTYKTGGMAEALVYPKTVEDWSFILKLANVNDLPFRVLGF 64

Query: 70  GSNILVRDAGIRGVVL---RLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGF 126
           GSN++V D G++G+     R++    ++  ++    + +            A+  G+ G 
Sbjct: 65  GSNVIVSDRGLKGITASTKRMTEVTITDTALKAEAGLALDKAIE------IAVDSGLAGM 118

Query: 127 HFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK 186
               GIPGSIGGA  MNAGA   ET   +     I+R+G   +I +E L+Y YR     +
Sbjct: 119 EKMSGIPGSIGGAVKMNAGAFGQETFDKLDYFEIINREGRPSIIQKEDLQYGYRCVAGIE 178

Query: 187 DLIITHVVL-------RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
           D I+            +   ES+N+I          R   QP+   + GS FK P G  A
Sbjct: 179 DFIVISAAFELKKDNFKQLIESRNLI-------LSKRALNQPLDLPSAGSVFKRPAGDYA 231

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LI+++G RGL  GGAK+SE H  F++N + A+  D++ L ++V++ V  ++G+ LE E
Sbjct: 232 SRLIDEAGLRGLSIGGAKVSEKHAGFIVNFNAASSQDIKNLIDEVQRIVKEKTGVKLELE 291

Query: 300 IKRLGDF 306
               GDF
Sbjct: 292 QILWGDF 298


>gi|307704558|ref|ZP_07641463.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus mitis
           SK597]
 gi|307621855|gb|EFO00887.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus mitis
           SK597]
          Length = 295

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 99/293 (33%), Positives = 149/293 (50%), Gaps = 17/293 (5%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDA 78
           +F+E  PL   ++ + GG A+ +  P++  +L   +      +IP  ++G  SNI+V D 
Sbjct: 11  RFKE--PLHSYSYTKVGGEADYLVFPRNRFELARVVKFANQENIPWMVLGNASNIIVCDG 68

Query: 79  GIRGVVL---RLSNAGFS--NIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           GIRG V+   +L+N       IE      +I   R         ALRH + GF F  GIP
Sbjct: 69  GIRGFVILCDKLNNVSVDGYTIEAEAGANLIETTRI--------ALRHSLTGFEFACGIP 120

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITH 192
           GS+GGA +MNAGA   E +  +     + + G    +  + L + YR S I +   ++  
Sbjct: 121 GSVGGAVFMNAGAYGGEIAHILQSCKVLTKDGEIETLSVKDLAFGYRHSAIQESGAVVLS 180

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
                 P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G  
Sbjct: 181 AKFALAPGTHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGYR 240

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            GG ++SE H  FMIN  + T  D E L E V +KV   SG+ LE E++ LG+
Sbjct: 241 IGGVEVSEKHAGFMINVADGTAKDYEDLIEFVIEKVKEHSGVTLEREVRILGE 293


>gi|182624492|ref|ZP_02952275.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens D str. JGS1721]
 gi|177910300|gb|EDT72681.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens D str. JGS1721]
          Length = 304

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 99/286 (34%), Positives = 155/286 (54%), Gaps = 15/286 (5%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIRGVV 84
           P+ +  +FR GG A+++  P +   +   L L    ++P  I+G GSNILV+D GI GVV
Sbjct: 25  PMSEHIYFRVGGPADILVTPVNEEQVVNTLKLCREYNVPYFILGNGSNILVKDGGISGVV 84

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSG--KSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           ++ +    + I    +C   V A+     K ++ +AL + + GF F  GIPGSIGGA +M
Sbjct: 85  IKFNK--LNKITTDGNC---VTAQSGALLKDVSKAALENNLRGFEFACGIPGSIGGAVFM 139

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPESQ 202
           NAGA + E +  +     ID   N   + +E+L+  YRSS + K     +VV+    E +
Sbjct: 140 NAGAYDGEMAHVIKSARVIDENCNIKNLTKEELELGYRSSIVMKK---GYVVIEATVELE 196

Query: 203 N----IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           +     I   I ++ + RE+ QP++  + GSTFK P G+ A +LI+ SG +G   GGA +
Sbjct: 197 SGEYASIKDKIDDLTNKRESKQPLEYPSAGSTFKRPEGYFAGKLIQDSGLKGFSIGGAAV 256

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           SE H  F+IN   AT  D+  +   V+K V     + L  E++ +G
Sbjct: 257 SEKHSGFVINKGGATAKDVLDVIAHVQKTVKENFDVELHTEVRIIG 302


>gi|168212740|ref|ZP_02638365.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens CPE str. F4969]
 gi|170715845|gb|EDT28027.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens CPE str. F4969]
          Length = 304

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 99/286 (34%), Positives = 155/286 (54%), Gaps = 15/286 (5%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIRGVV 84
           P+ +  +FR GG A+++  P +   +   L L    ++P  I+G GSNILV+D GI GVV
Sbjct: 25  PMSEHIYFRVGGPADILATPVNEEQVVNTLKLCREYNVPYFILGNGSNILVKDGGISGVV 84

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSG--KSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           ++ +    + I    +C   V A+     K ++ +AL + + GF F  GIPGSIGGA +M
Sbjct: 85  IKFNK--LNKITTEGNC---VTAQSGALLKDVSKAALENNLRGFEFACGIPGSIGGAVFM 139

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPESQ 202
           NAGA + E +  +     ID   N   + +E+L+  YRSS + K     +VV+    E +
Sbjct: 140 NAGAYDGEMAHVIKSARVIDENCNIKNLTKEELELGYRSSIVMKK---GYVVIEATVELE 196

Query: 203 N----IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           +     I   I ++ + RE+ QP++  + GSTFK P G+ A +LI+ SG +G   GGA +
Sbjct: 197 SGEYASIKDKIDDLTNRRESKQPLEYPSAGSTFKRPEGYFAGKLIQDSGLKGFSIGGAAV 256

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           SE H  F+IN   AT  D+  +   V+K V     + L  E++ +G
Sbjct: 257 SEKHSGFVINKGGATAKDVLDVIAHVQKTVKENFDVELHTEVRIIG 302


>gi|320546889|ref|ZP_08041192.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus equinus ATCC
           9812]
 gi|320448484|gb|EFW89224.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus equinus ATCC
           9812]
          Length = 300

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 100/292 (34%), Positives = 157/292 (53%), Gaps = 15/292 (5%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRG 82
           N PLK+ T+ + GG A+ +  P++ ++L   +     +DIP  ++G  SNI+VRD GIRG
Sbjct: 17  NEPLKKYTFTKVGGPADYLAFPRNRYELVRIVEFANKNDIPWMVLGNASNIIVRDGGIRG 76

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANS---ALRHGIGGFHFFYGIPGSIGGA 139
            V+       + + V  +   ++ A  +G +LA +   A  H + GF F  GIPGS+GGA
Sbjct: 77  FVIMFDK--LNTVTVNGY---VIEAE-AGANLAETTRIAKYHSLTGFEFACGIPGSVGGA 130

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI--TKDLIIT-HVVLR 196
            +MNAGA   E S  +V    + ++G    I    +K+ YR S +  + D++I+    L+
Sbjct: 131 VFMNAGAYGGEISHVLVSAQVLTKEGKVKTIEARDMKFGYRHSAVQDSGDIVISAKFALK 190

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
             P    +I   +A + H RE  QP++  + GS FK P GH A QLI ++  +G   GG 
Sbjct: 191 --PGDYVLIEQEMARLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLITEANLKGHRIGGV 248

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFD 308
           ++S+ H  FM+N  + T  D E L   V   V   SG+ LE E++ +G+  D
Sbjct: 249 EVSKKHAGFMVNVADGTAQDYEDLIAYVIDTVEKNSGVRLEREVRIIGEKKD 300


>gi|53803429|ref|YP_114841.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylococcus
           capsulatus str. Bath]
 gi|81681289|sp|Q604V9|MURB_METCA RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|53757190|gb|AAU91481.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylococcus
           capsulatus str. Bath]
          Length = 304

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 140/288 (48%), Gaps = 1/288 (0%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRD 77
           RG + E+ PL   T +R GG AE  +QP D+ DL  FL  L    P+  +GLGSN+LVRD
Sbjct: 15  RGTWLEHEPLAGHTSWRVGGPAERFYQPADLDDLVQFLRALSPQEPLFWLGLGSNVLVRD 74

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            GIRG V+   N     IE R    +   A      +A         G  F  GIPG++G
Sbjct: 75  GGIRGTVVCTKNR-LRVIEARGPACVYAEAGIPCAHVARFCTERDWVGAEFLAGIPGTLG 133

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRG 197
           GA  MNAGA   ET   V  V  ++R G       E+ +  YR  +  +        L  
Sbjct: 134 GALAMNAGAFGGETWSLVRRVLTVNRGGRTIWRAPEEFEVGYRHVQGPEGEWFVAAELEL 193

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P         I  +   R   QP  + + GS F+NP    A +LIE  G +G   GGA+
Sbjct: 194 APGDGRAGRERIKALLARRSATQPTHQPSCGSVFRNPPSDFAARLIEACGLKGHTVGGAQ 253

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S  H NF++N+ +AT  D+E L  +VR +V    G+ LE E++ +G+
Sbjct: 254 VSLKHANFIVNSGDATAADIETLIAEVRDRVALLCGVWLEPEVRIVGE 301


>gi|74316139|ref|YP_313879.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thiobacillus
           denitrificans ATCC 25259]
 gi|90109794|sp|Q3SMH1|MURB_THIDA RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|74055634|gb|AAZ96074.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thiobacillus
           denitrificans ATCC 25259]
          Length = 324

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 101/305 (33%), Positives = 154/305 (50%), Gaps = 18/305 (5%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRG+F  N P+ +   +R GG+A  ++ P D+ DL + +  +P+D  I +VGLGSN+LVR
Sbjct: 20  LRGRFLYNEPMSRHVSWRAGGSARRLYVPADLEDLVWLVRSVPADEAIHMVGLGSNLLVR 79

Query: 77  DAGIRGVVLRLSNAGFS-NIEVRNH-----------CEMIVGARCSGKSLANSALRHGIG 124
           D G+ GVV+ L        +E R H             +   A  +   LA  A  HG+ 
Sbjct: 80  DGGVAGVVILLHGVLTKLALESRTHGLPPAPPARDTAVVYAQAGVASPKLARFAATHGLV 139

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPG++GGA  MNAG    ET   +V++H +DR+G  +    E+    YR + +
Sbjct: 140 GGEFLAGIPGTVGGAIAMNAGCYGSETWDTLVQLHTLDRQGQLNERLPEEYVTGYRHAAL 199

Query: 185 TKDLIITHVVLRGFPESQNIISAA----IANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
            +        + G+   +    AA    I ++   R   QP+     GS F+NP G  A 
Sbjct: 200 KRPH--EEWFIGGWFRLERGDGAASRERIRSLLKTRIASQPLNLPNAGSVFRNPPGDFAA 257

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LIE  G +G   G A++S  H NF++N   AT  D+E L E V   V  ++ + L  E+
Sbjct: 258 RLIEACGLKGHRIGDAQVSTKHANFIVNVGKATATDIERLIEHVEDSVEARTNVRLMREV 317

Query: 301 KRLGD 305
           + +G+
Sbjct: 318 RIIGE 322


>gi|118479129|ref|YP_896280.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis str. Al Hakam]
 gi|118418354|gb|ABK86773.1| UDP-N-acetylmuramate dehydrogenase [Bacillus thuringiensis str. Al
           Hakam]
          Length = 303

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 96/290 (33%), Positives = 156/290 (53%), Gaps = 7/290 (2%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRD 77
           G+   + PL + T  + GG A+++  P+ +  ++  L L+       T++G GSN+LV D
Sbjct: 16  GRVLVDEPLARYTTMKIGGPADILIVPKRVAGIEKTLQLVKKYKTKCTVIGRGSNLLVSD 75

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            GI GVV+RL   G  ++EV  H  + VG   S   L+    R G+ G  F  GIPGS+G
Sbjct: 76  QGIEGVVIRLGE-GLDHLEVEKH-RVRVGGGYSLIKLSTLLSRQGLAGLEFASGIPGSVG 133

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD---LIITHVV 194
           GA YMNAGA+  + S  + +   +   G    +   ++++ YR+S +      +++    
Sbjct: 134 GAVYMNAGAHKSDISNILSKALILFEDGTIDWLTHGEMEFSYRTSVLQTKRPGIVLEAEF 193

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
                E + I+S    N  + RET QP      GS F+NPT + A  LIEK+G RG + G
Sbjct: 194 QLQIGERERIVSVMQKNKDYRRET-QPWNHPCAGSVFRNPTPYFAGDLIEKAGLRGYQIG 252

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           GA+ISE+H NF+IN   A+  D+  L   +++ + ++ G+ +  E++ +G
Sbjct: 253 GAQISEMHGNFIINTGGASAQDVLSLIALIKQTIKDKFGVEMHTEVEIIG 302


>gi|225865891|ref|YP_002751269.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           03BB102]
 gi|229186150|ref|ZP_04313319.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus BGSC
           6E1]
 gi|225788298|gb|ACO28515.1| UDP-N-acetylmuramate dehydrogenase [Bacillus cereus 03BB102]
 gi|228597326|gb|EEK54977.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus BGSC
           6E1]
          Length = 301

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 96/290 (33%), Positives = 156/290 (53%), Gaps = 7/290 (2%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRD 77
           G+   + PL + T  + GG A+++  P+ +  ++  L L+       T++G GSN+LV D
Sbjct: 14  GRVLVDEPLARYTTMKIGGPADILIVPKRVAGIEKTLQLVKKYKTKCTVIGRGSNLLVSD 73

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            GI GVV+RL   G  ++EV  H  + VG   S   L+    R G+ G  F  GIPGS+G
Sbjct: 74  QGIEGVVIRLGE-GLDHLEVEKH-RVRVGGGYSLIKLSTLLSRQGLAGLEFASGIPGSVG 131

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD---LIITHVV 194
           GA YMNAGA+  + S  + +   +   G    +   ++++ YR+S +      +++    
Sbjct: 132 GAVYMNAGAHKSDISNILSKALILFEDGTIDWLTHGEMEFSYRTSVLQTKRPGIVLEAEF 191

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
                E + I+S    N  + RET QP      GS F+NPT + A  LIEK+G RG + G
Sbjct: 192 QLQIGERERIVSVMQKNKDYRRET-QPWNHPCAGSVFRNPTPYFAGDLIEKAGLRGYQIG 250

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           GA+ISE+H NF+IN   A+  D+  L   +++ + ++ G+ +  E++ +G
Sbjct: 251 GAQISEMHGNFIINTGGASAQDVLSLIALIKQTIKDKFGVEMHTEVEIIG 300


>gi|293400976|ref|ZP_06645121.1| UDP-N-acetylmuramate dehydrogenase [Erysipelotrichaceae bacterium
           5_2_54FAA]
 gi|291306002|gb|EFE47246.1| UDP-N-acetylmuramate dehydrogenase [Erysipelotrichaceae bacterium
           5_2_54FAA]
          Length = 304

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 99/283 (34%), Positives = 147/283 (51%), Gaps = 5/283 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQ-DIHDLKYFLTLLPSDIPITIVGLGSNILVRDAGIRG 82
           N  LK  T FR GGN      P+ ++  L+    L   ++PI I G GSNIL  D    G
Sbjct: 20  NVSLKTRTTFRIGGNCSYFIYPKNELCLLRVMDILKDEEMPIKIFGKGSNILCSDDDYDG 79

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           V+L L    F++         +V A  S   LA+ A++  + G  F  GIPG+IGGA +M
Sbjct: 80  VILCLDRY-FTDFYFEEDGSCLVQAGTSIILLAHEAMKRSLSGLEFASGIPGTIGGALFM 138

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS--EITKDLIITHVVLRGFPE 200
           NAGA   + +  V EV+ + ++    ++ +++L Y YR S  +  +D +I    L+    
Sbjct: 139 NAGAYKSDMAGIVQEVYVL-KEHTICIMRKDELDYAYRHSIFQQHRDWLILGCRLQLQEG 197

Query: 201 SQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISE 260
            Q  I   + +    R   QP+ +   GS F+NP  H AWQLIE  G RG   GGA +SE
Sbjct: 198 DQKEIRDVMDSRRKRRMDSQPLNKPCAGSVFRNPESHQAWQLIESIGMRGKRIGGAMVSE 257

Query: 261 LHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
            H NF++N DNA   D+  L E+++K+V  +  I L  E+++ 
Sbjct: 258 KHANFIVNEDNAKANDVAALVEEIQKEVKERFDIDLITEVEKF 300


>gi|303233168|ref|ZP_07319841.1| UDP-N-acetylmuramate dehydrogenase [Atopobium vaginae PB189-T1-4]
 gi|302480753|gb|EFL43840.1| UDP-N-acetylmuramate dehydrogenase [Atopobium vaginae PB189-T1-4]
          Length = 309

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 149/283 (52%), Gaps = 4/283 (1%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRGVV 84
           PL + T FR GG  ++   P    +++  + L   +++P  I+G GS++LV DAG RGVV
Sbjct: 29  PLCRHTTFRIGGPCDIYVIPDTYDEVRDIVALCRTNNVPYYILGRGSDLLVSDAGYRGVV 88

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           + LS+ G  N+      E+   A  + +  +  A   G+ GF F  GIPGSIGG  +MNA
Sbjct: 89  IALSD-GLVNVTYEGE-EITCQAGVTLREASEMACELGLTGFEFACGIPGSIGGGLFMNA 146

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFPESQN 203
           GA +   +  V  +  +  +G    IP  +L   YR S + +D L++     R       
Sbjct: 147 GAYDGCIADIVDSIKALTPEGAIVTIPASELHLGYRQSRVQEDNLVVLAATFRLHEGKSE 206

Query: 204 IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHC 263
            I A + +    R   QP++  + GSTFK P G+   +L+  +G +G   GGA +SE H 
Sbjct: 207 DIRAKMDDFTQRRREKQPLEYPSAGSTFKRPEGYYVGKLLTDAGLKGYRSGGAAVSEKHA 266

Query: 264 NFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
            F+IN D+AT  D+  +   V+ ++   +G+ LE EI+ LG+F
Sbjct: 267 GFVINVDHATAADVIAVITHVQHEIKRLNGVDLEPEIRFLGEF 309


>gi|171777628|ref|ZP_02919293.1| hypothetical protein STRINF_00128 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171283156|gb|EDT48580.1| hypothetical protein STRINF_00128 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 300

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 102/301 (33%), Positives = 161/301 (53%), Gaps = 16/301 (5%)

Query: 16  QLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNI 73
           +L+G   + N PLK+ T+ + GG A+ +  P++ ++L   +     +DIP  ++G  SNI
Sbjct: 8   ELKGIDIRVNEPLKKYTYTKVGGPADYLAFPRNRYELIRIVEFANKNDIPWMVLGNASNI 67

Query: 74  LVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANS---ALRHGIGGFHFFY 130
           +VRD GIRG V+       + + V  +   ++ A  SG +L  +   A  H + GF F  
Sbjct: 68  IVRDGGIRGFVIMFDK--LNTVTVNGY---VIEAE-SGANLVETTRIAKYHSLTGFEFAC 121

Query: 131 GIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI--TKDL 188
           GIPGS+GGA +MNAGA   E S  +V    + ++G    I    +K+ YR S +  + D+
Sbjct: 122 GIPGSVGGAVFMNAGAYGGEISHVLVSAQVLTKEGKVKTIEARDMKFGYRHSAVQDSGDI 181

Query: 189 IIT-HVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSG 247
           +I+    L+  P    +I   +A + H RE  QP++  + GS FK P GH A QLI ++ 
Sbjct: 182 VISAKFALK--PGDYVLIEQEMARLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLITEAN 239

Query: 248 CRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFF 307
            +G   GG ++S+ H  FM+N  + T  D E L   V   V   SG+ LE E++ +G+  
Sbjct: 240 LKGHRIGGVEVSKKHAGFMVNVADGTAQDYEDLIAYVIDTVEKNSGVRLEREVRIIGEKK 299

Query: 308 D 308
           D
Sbjct: 300 D 300


>gi|196045766|ref|ZP_03112995.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           03BB108]
 gi|196023206|gb|EDX61884.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           03BB108]
          Length = 301

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 96/290 (33%), Positives = 156/290 (53%), Gaps = 7/290 (2%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRD 77
           G+   + PL + T  + GG A+++  P+ +  ++  L L+       T++G GSN+LV D
Sbjct: 14  GRVLVDEPLARYTTMKIGGPADILIVPKRVAGIEKTLQLVKKYKTKCTVIGRGSNLLVSD 73

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            GI GVV+RL   G  ++EV  H  + VG   S   L+    R G+ G  F  GIPGS+G
Sbjct: 74  LGIEGVVIRLGE-GLDHLEVEKH-RVRVGGGYSLIKLSTLLSRQGLAGLEFASGIPGSVG 131

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD---LIITHVV 194
           GA YMNAGA+  + S  + +   +   G    +   ++++ YR+S +      +++    
Sbjct: 132 GAVYMNAGAHKSDISNILSKALILFEDGTIDWLTHGEMEFSYRTSVLQTKRPGIVLEAEF 191

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
                E + I+S    N  + RET QP      GS F+NPT + A  LIEK+G RG + G
Sbjct: 192 QLQIGERERIVSVMQKNKDYRRET-QPWNHPCAGSVFRNPTPYFAGDLIEKAGLRGYQIG 250

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           GA+ISE+H NF+IN   A+  D+  L   +++ + ++ G+ +  E++ +G
Sbjct: 251 GAQISEMHGNFIINTGGASAQDVLSLIALIKQTIKDKFGVEMHTEVEIIG 300


>gi|319938165|ref|ZP_08012563.1| hypothetical protein HMPREF9488_03399 [Coprobacillus sp. 29_1]
 gi|319806686|gb|EFW03335.1| hypothetical protein HMPREF9488_03399 [Coprobacillus sp. 29_1]
          Length = 303

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 94/290 (32%), Positives = 159/290 (54%), Gaps = 5/290 (1%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNIL 74
           Q + ++++N  LK+ T    GG A +M  P+ + +++  L L    D+   ++G GSNIL
Sbjct: 16  QYQIQYKQNVFLKEYTTLHIGGRAHIMIFPKSVQEIEQCLKLCQKYDMIYVVLGKGSNIL 75

Query: 75  VRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPG 134
             D G  GV++ L+   F  ++  +   + V +  + K++ +  L+  + G  F  GIPG
Sbjct: 76  ASDQGYHGVIINLTM--FCEMKRLDGQRICVQSGATLKNVCDFCLQQELTGLEFACGIPG 133

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL-IITHV 193
           +IGGA YMNAGA   E  + V +V  +D KG +  +   ++++ YR S  ++   II  V
Sbjct: 134 TIGGAVYMNAGAYGGEMQEVVEKVVYLDDKGVK-TLSHSEMQFSYRHSYFSQQKGIILEV 192

Query: 194 VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEF 253
           +      ++ ++   + ++   R   QP+ + + GSTFK P GH A  LI++ G +G + 
Sbjct: 193 ICCLKIGNKELMKKQMNDLMRRRHEKQPMSDYSAGSTFKRPNGHYASALIKQCGLQGFQI 252

Query: 254 GGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           GGA++S  H  F+IN  +AT  +   L + V+K V+ Q+G  LE EIK L
Sbjct: 253 GGAQVSLKHAGFLINCGHATSQEFLQLIKYVQKTVYKQTGYQLECEIKML 302


>gi|229829564|ref|ZP_04455633.1| hypothetical protein GCWU000342_01661 [Shuttleworthia satelles DSM
           14600]
 gi|229791553|gb|EEP27667.1| hypothetical protein GCWU000342_01661 [Shuttleworthia satelles DSM
           14600]
          Length = 297

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 93/283 (32%), Positives = 147/283 (51%), Gaps = 5/283 (1%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDAGIRGVVL 85
           P+   T FR GG A++  +P+          L  + +P+ I+G GSN+LV D GIRG V+
Sbjct: 18  PMSAHTSFRIGGPADLFLEPRKDQLSPLLAALKEAKVPLMILGNGSNLLVGDKGIRGAVI 77

Query: 86  RLSNAGFSNIEV-RNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
            + N+  + I V  +  E   GA      +A  A R G+ G     GIPGS+GGA  MNA
Sbjct: 78  HIGNS-MNQIRVSEDRIEAEAGALLV--RVARQAQRAGLSGMESLSGIPGSLGGAIMMNA 134

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL-IITHVVLRGFPESQN 203
           GA     +  +  V  +  +G       E++ + YR S +  +  I+   +L+       
Sbjct: 135 GAYGGTMADVLASVELLTEEGEIRNYSLEEMDFSYRHSRVRDEGGIVLSAILQLTRGDAG 194

Query: 204 IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHC 263
            I AA+A++   R   QP++  + GS FK P G+ A +LI+ +G RG   G A++SE HC
Sbjct: 195 EIDAAMADLTRRRTARQPLEMASAGSAFKRPEGYFAGKLIQDAGLRGYRVGQAQVSEKHC 254

Query: 264 NFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
            F++N   A+  ++  L E VR +V  +  + LE E++ +G+F
Sbjct: 255 GFVVNLGGASAAEVRQLMEDVRARVKEKFHVDLEPEVRFVGEF 297


>gi|262282613|ref|ZP_06060381.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus sp.
           2_1_36FAA]
 gi|262261904|gb|EEY80602.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus sp.
           2_1_36FAA]
          Length = 302

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 103/302 (34%), Positives = 158/302 (52%), Gaps = 11/302 (3%)

Query: 8   RLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITI 66
            LL+     +  +F E  PLK+ T+ + GG A+ +  P++ ++L   +     + IP  +
Sbjct: 5   ELLKSELAGIDIRFDE--PLKKYTYTKVGGPADYLAFPRNRYELVRLVKFANREQIPWMV 62

Query: 67  VGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHC-EMIVGARCSGKSLANSALRHGIGG 125
           +G  SNI+VRD GIRG V+         I V  +  E   GA+    +  + AL H + G
Sbjct: 63  LGNASNIIVRDGGIRGFVIMFDQ--LHTIMVNGYTIEAEAGAKLIDTT--HVALHHSLTG 118

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI- 184
           F F  GIPGS+GGA +MNAGA   E +  +V    +  +G    I  E++K+ YRSS I 
Sbjct: 119 FEFACGIPGSVGGAVFMNAGAYGGEIAHVLVSCKVLTPEGEIKTISAEEMKFGYRSSVIQ 178

Query: 185 -TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            T D++I+       P +   I   +  + H RE  QP++  + GS FK P GH A QLI
Sbjct: 179 ETGDIVISAKFALS-PGNYTAIQQEMKRLTHLRELKQPLEYPSCGSVFKRPLGHFAGQLI 237

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
            ++G +G   GG ++S  H  FM+N  +    + E L   V + V  +SGI LE E++ +
Sbjct: 238 SEAGLKGHRIGGVEVSTKHAGFMVNIADGNAQNYEDLIAHVIQTVEKESGIKLEREVRII 297

Query: 304 GD 305
           G+
Sbjct: 298 GE 299


>gi|116333328|ref|YP_794855.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus brevis
           ATCC 367]
 gi|122269984|sp|Q03SJ8|MURB_LACBA RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|116098675|gb|ABJ63824.1| UDP-N-acetylmuramate dehydrogenase [Lactobacillus brevis ATCC 367]
          Length = 304

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 92/289 (31%), Positives = 150/289 (51%), Gaps = 7/289 (2%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDA 78
           K   + PL   T  +TGG A+ +  P ++ + K  L       +P+T+VG  SN++VRD 
Sbjct: 14  KILRDEPLAHYTHTKTGGPADYLAFPTNVQETKSLLAYANQISLPVTVVGNASNLIVRDG 73

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIRG+V+ L+    + I    +  +   A  +  +    A  H + G  F  GIPGS+GG
Sbjct: 74  GIRGLVMILTQ--MAAITTAGNT-VTAEAGAALITTTQVAQAHALSGLEFAAGIPGSVGG 130

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK--DLIITHVVLR 196
           A +MNAGA   E S   V    +  +G    + + +L + YR S I    D+++T     
Sbjct: 131 AIFMNAGAYGGEISTVAVAAEVLTPEGEIRTLNQAELDFGYRHSSIQDYHDIVLT-ATFA 189

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
             P     I A + ++   R   QP++  + GS FK P GH   QLI+++G +GL++GGA
Sbjct: 190 LTPGDGAAIQAQMDDLNARRAAKQPLELPSCGSVFKRPVGHYTGQLIQEAGLQGLKWGGA 249

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           ++S  H  F++N D+AT  D   L   ++  +  + G+ LE E++ +G+
Sbjct: 250 QVSTKHAGFIVNIDHATATDYLELIHHIQAVILEKDGVTLETEVRIIGE 298


>gi|159030201|emb|CAO91093.1| murB [Microcystis aeruginosa PCC 7806]
          Length = 292

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 92/283 (32%), Positives = 148/283 (52%), Gaps = 4/283 (1%)

Query: 27  LKQITWFRTGGNAEVMFQPQDIHDLK-YFLTLLPSDIPITIVGLGSNILVRDAGIRGVVL 85
           L   T +R GG A+   +P ++ +L+  F      D+P+T++G GSN+L+ D G+ G+VL
Sbjct: 8   LADFTSYRVGGRAQWYAEPVNLEELREVFAWWRAQDLPLTVLGAGSNLLISDRGLPGLVL 67

Query: 86  RLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAG 145
              +   S  +               K +A  A + G  G  +  GIPG++GGA  MNAG
Sbjct: 68  NTRHLRSSCFDAETATITAAAGEPLPK-IAWRAAKRGWRGLEWAVGIPGTVGGAVVMNAG 126

Query: 146 ANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD--LIITHVVLRGFPESQN 203
           A+    +  +V    ++  G    + +E L Y YRSS +  D  L+I         ++  
Sbjct: 127 AHTSCVADRLVRALVLNPDGQLETLSKEDLNYSYRSSSLQGDQRLVIEATFQLEATDNSE 186

Query: 204 IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHC 263
            I A  ++   HR++ QP    + GS F+NP    A  LIE+ G +G + GGA++SELH 
Sbjct: 187 EIMAITSHNLRHRKSTQPYDRPSCGSVFRNPKPQYAGALIEEMGLKGYQIGGAQVSELHA 246

Query: 264 NFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           NF++N  +A   D+  L   V+++VF++  + LE E+K LG+F
Sbjct: 247 NFILNIGSAKASDILRLIRHVQEQVFDRWSLWLEPEVKVLGEF 289


>gi|315303147|ref|ZP_07873818.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria ivanovii
           FSL F6-596]
 gi|313628478|gb|EFR96940.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria ivanovii
           FSL F6-596]
          Length = 298

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 98/285 (34%), Positives = 151/285 (52%), Gaps = 7/285 (2%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAGIRG 82
           N PL + T+ +TGGNA++   P+   + +  ++     +IP+TI+G GSN++++D GIRG
Sbjct: 16  NEPLSKYTYTKTGGNADIFVMPKTTQETQEIVSYCHLKNIPLTILGNGSNLIIKDGGIRG 75

Query: 83  VVLRLSNAGFSNIEVRN-HCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAY 141
           V++ L      ++E +N     + GA+      A  AL   + G  F  GIPGSIGGA +
Sbjct: 76  VIVHLDL--LQSMERKNTQVTAMSGAKLI--DTAKFALEESLSGLEFACGIPGSIGGALH 131

Query: 142 MNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLRGFPE 200
           MNAGA   E S  +     + + G    + R +LK  YR S I  K+ I+         +
Sbjct: 132 MNAGAYGGEISDCLEAATVLTQSGELKKLKRSELKAAYRFSTIAEKNYIVLDATFSLKLD 191

Query: 201 SQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISE 260
            +N I   +  +   RE  QP++  + GS FK P GH A +LI+ SG +G   GGA++S 
Sbjct: 192 DKNNIQTKMDELTAAREAKQPLEYPSCGSVFKRPPGHFAGKLIQDSGLQGHIIGGAQVSL 251

Query: 261 LHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            H  F++N   AT  D   L   V+K V  +  + LE E+K +G+
Sbjct: 252 KHAGFIVNIGGATATDYMNLIAYVQKTVREKFDVELETEVKIIGE 296


>gi|291542900|emb|CBL16010.1| UDP-N-acetylmuramate dehydrogenase [Ruminococcus bromii L2-63]
          Length = 301

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 99/279 (35%), Positives = 147/279 (52%), Gaps = 7/279 (2%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDI---PITIVGLGSNILVRDAGIRG 82
           P+ + T F+ GG A+V  +  ++  L   L     D+      ++G GSN+LV D GI G
Sbjct: 23  PMSRHTSFKIGGKADVYIKVTNLSQLMKILK--ECDVCKEKYILLGNGSNVLVPDEGIHG 80

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
            VLRL +  F NI + +   +  GA  +  SL   A + G+ G  F +GIPG++GGA +M
Sbjct: 81  TVLRL-DGDFRNISLIDDTTIYCGAGAALGSLCKFAQKCGLSGLEFAWGIPGTVGGALFM 139

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGFPES 201
           NAGA   E    V  V  I + G+      E L + YR+S   K+  IIT  V +   + 
Sbjct: 140 NAGAYGGEMKDVVYSVSHITQNGDIGRTEAENLDFGYRTSVYRKNGCIITGAVFKLKKDD 199

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
              I   + +  + R T QP++  + GS FK P G  A  LIE+ G +G   GGA++SE 
Sbjct: 200 PEEIQNRMNDYMNRRSTKQPLEYPSAGSVFKRPEGAFAGALIEQCGLKGKTVGGAQVSEK 259

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           H  F+IN   AT  D++ L  +++K V N++G  LE E+
Sbjct: 260 HAGFIINKSKATADDVKQLVSEIQKTVENETGYKLECEL 298


>gi|229019112|ref|ZP_04175947.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           AH1273]
 gi|229025356|ref|ZP_04181774.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           AH1272]
 gi|228735941|gb|EEL86518.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           AH1272]
 gi|228742212|gb|EEL92377.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           AH1273]
          Length = 301

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 97/303 (32%), Positives = 163/303 (53%), Gaps = 7/303 (2%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           + +L++E  +   G+   N PL + T  + GG A+++  P+ + D++  L L+       
Sbjct: 1   MEQLVKELLEANVGRVLVNEPLARYTTMKIGGPADILIVPKHVADIEKTLKLVKKYKAGW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T++G GSN+LV D GI GVV+RL   G  ++EV  H ++ VGA      L+    R G+ 
Sbjct: 61  TVIGRGSNLLVSDLGIEGVVIRLGE-GLDHLEVEKH-KVRVGAGYPLIKLSTLLSRQGLA 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA+  + S  + +   +   G  + +   ++ + YR+S +
Sbjct: 119 GLEFASGIPGSVGGAVYMNAGAHKSDISSVLTKARILFENGTINWLTNTEMGFSYRTSVL 178

Query: 185 TKD---LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
                 +++         E + I+ +   N  + RET QP      GS F+NP  + A  
Sbjct: 179 QTKRPGIVLEAEFQLEVGERKEIVRSMQKNKDYRRET-QPWNHPCAGSIFRNPVPYFAGD 237

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           LIEK+G RG   GGA+ISE+H NF++N   A+  D+  L   +++ + ++ G+ +  E++
Sbjct: 238 LIEKAGLRGYTIGGAQISEMHGNFIVNTGVASAQDVLDLIALIKRTIKDKFGVDMHTEVE 297

Query: 302 RLG 304
            +G
Sbjct: 298 IIG 300


>gi|315646033|ref|ZP_07899154.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Paenibacillus vortex
           V453]
 gi|315278794|gb|EFU42108.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Paenibacillus vortex
           V453]
          Length = 301

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 98/284 (34%), Positives = 150/284 (52%), Gaps = 4/284 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIRG 82
           N PL + T ++ GG A+ +  P++   LK  +TLL +  I  T +G GSN+LV D GIRG
Sbjct: 19  NEPLAKYTTWKIGGPADCLIIPENKEQLKELVTLLHAHRIHWTQLGRGSNMLVADKGIRG 78

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
            V++L   GF  +       +  G   S   L+  A + G+ G  F  GIPGS+GGA YM
Sbjct: 79  AVIKLGQ-GFEELHFDGET-VTAGGSLSFVKLSVLAGKQGLAGLEFAGGIPGSVGGAVYM 136

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLRGFPES 201
           NAGA+  + S+       +   G       + + + YR S +  +  I+T  V       
Sbjct: 137 NAGAHGSDVSRIFKSADIVLETGELVTYAAKDMAFDYRHSILHERKGIVTEAVFGLRQGD 196

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
           +  ISA +A+    R   QP++  T GS F+NP G  A +LIE +G +GL  GGA++S  
Sbjct: 197 RKEISAVMASYKDRRRRTQPLQSATAGSVFRNPPGDHAARLIEAAGLKGLRIGGAEVSLQ 256

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           H NF+ N   AT  D+  L E++++ +  ++GI +  E+  LG+
Sbjct: 257 HANFIENTGQATAEDVLALMERIKETISEKNGIHMVPEVYVLGE 300


>gi|258539214|ref|YP_003173713.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           rhamnosus Lc 705]
 gi|257150890|emb|CAR89862.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           rhamnosus Lc 705]
          Length = 299

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 94/284 (33%), Positives = 153/284 (53%), Gaps = 9/284 (3%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRGVV 84
           PL   T+ +TGG A+++  P+D+ +++  + +    D+P+T++G  SN++VRD GIRG+V
Sbjct: 18  PLSHYTFTKTGGPADLLAFPKDVAEVQALVEMARERDMPLTVIGNASNLIVRDGGIRGLV 77

Query: 85  LRLSNAGFSNIEVR-NHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMN 143
           L L+      I V  N      GAR    +   +A R G+ G  F  GIPGS+GGA +MN
Sbjct: 78  LILT--AMKKITVNGNDVTAQAGARLIDTT--EAAYRAGLTGLEFAAGIPGSVGGALFMN 133

Query: 144 AGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI--TKDLIITHVVLRGFPES 201
           AGA N E    + + H + R G        +L ++YR S +  T D++++      F + 
Sbjct: 134 AGAYNGEVCSVISQAHVLTRAGELKTYNHRELNFRYRHSVVQDTGDIVLSVTFSMKFGDK 193

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
             I  A +  +   R   QP++  + GS FK P  H    +I+K+G +G   GGA++S+ 
Sbjct: 194 PTI-RAKMDELNARRAAKQPLEYPSCGSVFKRPPDHFVGPMIQKAGLQGHIIGGAQVSKK 252

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           H  F+IN  NAT  D   +   ++K V  +  + LE E++ +G+
Sbjct: 253 HAGFIINLGNATATDYLDMIHLIQKTVKAKFDVDLEPEVRIIGE 296


>gi|312865349|ref|ZP_07725577.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus downei F0415]
 gi|311099460|gb|EFQ57676.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus downei F0415]
          Length = 300

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 96/287 (33%), Positives = 148/287 (51%), Gaps = 13/287 (4%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRGVV 84
           PL+  T+ R GG A+ +  P++ ++L + +     +DIP  ++G  SN++VR+ GIRG V
Sbjct: 19  PLRNYTYTRVGGPADYLAFPRNRYELAHIVKFANENDIPWMVLGNASNLIVREGGIRGFV 78

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR--HGIGGFHFFYGIPGSIGGAAYM 142
           +       S + V  +    + A      +  + +   H + GF F  GIPGSIGGA +M
Sbjct: 79  IMFDK--LSTVTVDGYT---IEAEAGANLIETTKIAEFHSLTGFEFAAGIPGSIGGAVFM 133

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD---LIITHVVLRGFP 199
           NAGA   E S  +V    + ++G+ H I    + + YR S I      +I     LR  P
Sbjct: 134 NAGAYGGEISHILVSATVLTKEGDIHTIEARDMAFGYRHSAIQTSGEVVISAKFALR--P 191

Query: 200 ESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKIS 259
              + I   +A + H R+  QP++  + GS FK P  H A QLI ++   G   GG ++S
Sbjct: 192 GIHSQIKNEMARLNHLRQLKQPLEYPSCGSVFKRPVDHFAGQLIMEADLMGYRIGGVEVS 251

Query: 260 ELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           + H  FM+N  N T  D E L   V +KV   SG+ LE E++ +GD+
Sbjct: 252 KKHAGFMVNVANGTADDYENLIAHVIEKVQEHSGVRLEPEVRIIGDY 298


>gi|229544112|ref|ZP_04433171.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus coagulans
           36D1]
 gi|229325251|gb|EEN90927.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus coagulans
           36D1]
          Length = 303

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 96/292 (32%), Positives = 155/292 (53%), Gaps = 19/292 (6%)

Query: 23  ENFPLKQITWFRTGGNAEVMFQPQDIHDLKY---FLTLLPSDIPITIVGLGSNILVRDAG 79
           E+ PL + T+ +TGG A+++  P+   +++    F +L  + +P TI+G GSN++++D G
Sbjct: 21  EDEPLSKYTFTKTGGKADILIFPETYEEVQKTVRFASL--NGVPYTILGNGSNLIIKDGG 78

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGK--SLANSALRHGIGGFHFFYGIPGSIG 137
           IRG+VL L+    + I   +H    + A+C      ++  AL+  + G  F  GIPGS+G
Sbjct: 79  IRGIVLILTK--LAKI---SHTGNDITAQCGAAIIDVSRYALKQKLTGLEFACGIPGSVG 133

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRG 197
           GA YMNAGA   E    +     + + G    + +  L +QYR S I ++     + L G
Sbjct: 134 GALYMNAGAYGGEVKDVLKSALVLTKTGEMKRLEKSDLSFQYRKSSIAEN---GEIALEG 190

Query: 198 F----PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEF 253
                P     I A +  +   RE+ QP++  + GS FK P G+ A +LI+ SG +G   
Sbjct: 191 TFSLEPGDAQEIKAKMDELTDLRESKQPLEYPSCGSVFKRPPGYFAGKLIQDSGLQGKRI 250

Query: 254 GGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           GG ++S  H  FM+N    T  D   L + V+K V  + G+ LE E+K +G+
Sbjct: 251 GGVEVSTKHAGFMVNVGGGTATDYMNLIKFVQKTVKEKFGVDLETEVKIIGE 302


>gi|157150747|ref|YP_001450103.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           gordonii str. Challis substr. CH1]
 gi|189028945|sp|A8AWE3|MURB_STRGC RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|157075541|gb|ABV10224.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           gordonii str. Challis substr. CH1]
          Length = 302

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 103/301 (34%), Positives = 158/301 (52%), Gaps = 11/301 (3%)

Query: 9   LLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIV 67
           LL+     +  +F E  PLK+ T+ + GG A+ +  P++ ++L   +     + IP  ++
Sbjct: 6   LLKSELAGIDIRFDE--PLKRYTYTKVGGPADYLAFPRNRYELVRLVKFANREQIPWMVL 63

Query: 68  GLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHC-EMIVGARCSGKSLANSALRHGIGGF 126
           G  SNI+VRD GIRG V+         I V  +  E   GA+    +  + AL H + GF
Sbjct: 64  GNASNIIVRDGGIRGFVIMFDQ--LHTIMVNGYTIEAEAGAKLIDTT--HVALHHSLTGF 119

Query: 127 HFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-- 184
            F  GIPGS+GGA +MNAGA   E +  +V    +  +G    I  E++K+ YRSS I  
Sbjct: 120 EFACGIPGSVGGAVFMNAGAYGGEIAHVLVSCKVLTPEGEIKTISAEEMKFGYRSSVIQE 179

Query: 185 TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIE 244
           T D++I+       P +   I   +  + H RE  QP++  + GS FK P GH A QLI 
Sbjct: 180 TGDIVISAKFALS-PGNYTAIQQEMKRLTHLRELKQPLEYPSCGSVFKRPLGHFAGQLIS 238

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           ++G +G   GG ++S  H  FM+N  +    + E L   V + V  +SGI LE E++ +G
Sbjct: 239 EAGLKGHRIGGVEVSTKHAGFMVNIADGNAQNYEDLIAHVIQTVEKESGIKLEREVRIIG 298

Query: 305 D 305
           +
Sbjct: 299 E 299


>gi|257063611|ref|YP_003143283.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Slackia
           heliotrinireducens DSM 20476]
 gi|256791264|gb|ACV21934.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Slackia
           heliotrinireducens DSM 20476]
          Length = 303

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 104/298 (34%), Positives = 148/298 (49%), Gaps = 5/298 (1%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLT-LLPSDIPITIVG 68
           +R  G+   G+  EN PL + T +R GG A +  + + +H L  F    +   IP  ++G
Sbjct: 6   IRLMGEDFEGEVLENEPLSRHTTYRIGGPARLYARVESLHALIAFSEYCVEQGIPWFVLG 65

Query: 69  LGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIV-GARCSGKSLANSALRHGIGGFH 127
            GSN+LV DAG  G V+ L   GFS+    +   +   GA C    + + A   G  G  
Sbjct: 66  RGSNLLVSDAGFPGAVIVLGQ-GFSSCSYDDAAHVFTAGASCPLSRVVHMAYERGRAGME 124

Query: 128 FFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPRE-QLKYQYRSSEITK 186
           F  G PGS+GGA  MNAG+ +      V+ V    R G   V  R   +++ YR S +  
Sbjct: 125 FAVGTPGSVGGALRMNAGSRHEYIGSRVLSVTSY-RPGEGLVRHRAADIEWGYRESTLPN 183

Query: 187 DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKS 246
           D I+    L  F     +I A + N    R   QP+   + GS FKNP G S  +LIE  
Sbjct: 184 DEIMLECELSSFDGDPEMIRARMDNAMSLRRKTQPLAAPSCGSVFKNPKGDSVGRLIENV 243

Query: 247 GCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           G +G   GGA+IS+LH NF++N  +A   D+  L  +V+  V    GI LE E++ LG
Sbjct: 244 GLKGARCGGAQISDLHANFIVNCGDARADDVLTLMHRVQDAVAEAYGIELEPEVRFLG 301


>gi|313895613|ref|ZP_07829169.1| UDP-N-acetylmuramate dehydrogenase [Selenomonas sp. oral taxon 137
           str. F0430]
 gi|312975739|gb|EFR41198.1| UDP-N-acetylmuramate dehydrogenase [Selenomonas sp. oral taxon 137
           str. F0430]
          Length = 303

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 100/284 (35%), Positives = 155/284 (54%), Gaps = 4/284 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIRG 82
           N P++  T F  GG A+++F P  I +++  +    S    IT++G GSNILVRD GIRG
Sbjct: 21  NAPMRFHTTFCIGGPADMLFYPASIDEVQKIIQAAKSYGELITLMGNGSNILVRDGGIRG 80

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           +V+R  N   S+I V +  ++ VGA    K  A  A R G+ G  F  GIPGSIGGA +M
Sbjct: 81  LVVRF-NHTMSSI-VASGSDITVGAGALLKDAAAFAQRQGLTGMEFAAGIPGSIGGAIFM 138

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLRGFPES 201
           NAGA + E    V +V  +   G        +L + YR S    ++  I  V L   P +
Sbjct: 139 NAGAYDGEMKSIVTQVKTVSAAGEIRSYAAHELNFDYRHSIFHEREEAICEVRLHLTPGN 198

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
              I   + ++   R++ QP++  + GSTFK P G+ A  LI+++G +G   GGA++S  
Sbjct: 199 PADILEKMTDLNGRRKSRQPLEYPSAGSTFKRPPGYFAGTLIDEAGLKGFTVGGAQVSRK 258

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           H  F++N   AT  D++ L   V++ V+ +  + L  E++ +G+
Sbjct: 259 HAGFIVNIGGATANDVQRLIAVVQECVYARHAVRLVPELRIIGE 302


>gi|261208806|ref|ZP_05923243.1| UDP-N-acetylmuramate dehydrogenase [Enterococcus faecium TC 6]
 gi|289566404|ref|ZP_06446831.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Enterococcus faecium
           D344SRF]
 gi|294614470|ref|ZP_06694386.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Enterococcus faecium
           E1636]
 gi|260077308|gb|EEW65028.1| UDP-N-acetylmuramate dehydrogenase [Enterococcus faecium TC 6]
 gi|289161779|gb|EFD09652.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Enterococcus faecium
           D344SRF]
 gi|291592778|gb|EFF24371.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Enterococcus faecium
           E1636]
          Length = 311

 Score =  153 bits (386), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 94/285 (32%), Positives = 154/285 (54%), Gaps = 11/285 (3%)

Query: 26  PLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAGIRGVV 84
           PL   T+ +TGG A+V+  P+   ++K  +      DIP  ++G  SN++V+D GIRGVV
Sbjct: 20  PLMNYTFTKTGGPADVLAFPKKQEEVKQIIDYCRIHDIPWMVLGNASNLIVQDGGIRGVV 79

Query: 85  LRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNA 144
           + L+      I V+    +I  A  S      +AL   + GF F  GIPGS+GGA YMNA
Sbjct: 80  IMLTE--MKQIHVKGTM-VIAEAGASLIDTTYAALAESLTGFEFACGIPGSVGGAVYMNA 136

Query: 145 GANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPESQN- 203
           GA   E      EV  +   G    + ++++ + YR S++ +   +  +VL      Q  
Sbjct: 137 GAYGGEIKDVFAEVDLLLEDGTLKTLTKDEMVFSYRHSKVQE---LRAIVLEARFSLQTG 193

Query: 204 ---IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISE 260
               I A +  +   R++ QP++  + GS FK P GH   QLI+++G +GL++GGA++SE
Sbjct: 194 DYEAIKARMDELTELRQSKQPLEYPSCGSVFKRPVGHYTGQLIQQAGLQGLKWGGAQVSE 253

Query: 261 LHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            H  F++N D+AT  D   L   +++ +  +  + LE E++ +G+
Sbjct: 254 KHAGFIVNIDHATATDYIELIAHIQEVIKEKFDVSLETEVRIIGE 298


>gi|302036134|ref|YP_003796456.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Candidatus
           Nitrospira defluvii]
 gi|300604198|emb|CBK40530.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Candidatus
           Nitrospira defluvii]
          Length = 310

 Score =  153 bits (386), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 92/290 (31%), Positives = 146/290 (50%), Gaps = 5/290 (1%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILV 75
           +RG       L+  T F  GG AEV+ +P D+ DL   +    ++ +P+ +VG G+N+LV
Sbjct: 24  VRGTVTYEASLQAYTSFHIGGPAEVLVEPADVEDLCRVVAQARAEHVPVFVVG-GTNVLV 82

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD GIRG+V+ L    F  I       +         +L   A+R  + G  +  GIPG+
Sbjct: 83  RDGGIRGIVVSLRQ--FKAIRQEPDHVLYAEGGVGMPTLIGYAIRRSLAGLEWGAGIPGT 140

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           + G   MNAG    E    V  V  +D +G    IP   + + YR + + +  I+  V +
Sbjct: 141 VAGCVVMNAGTRLGEMKDSVKAVRMVDPRGRVVDIPAADIPFSYRRAHLPRG-IVAGVWV 199

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255