BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781095|ref|YP_003065508.1|
UDP-N-acetylenolpyruvoylglucosamine reductase [Candidatus Liberibacter
asiaticus str. psy62]
         (318 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254781095|ref|YP_003065508.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040772|gb|ACT57568.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 318

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 318/318 (100%), Positives = 318/318 (100%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS
Sbjct: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR
Sbjct: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
           HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR
Sbjct: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
           SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW
Sbjct: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI
Sbjct: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300

Query: 301 KRLGDFFDHQIVDATKIF 318
           KRLGDFFDHQIVDATKIF
Sbjct: 301 KRLGDFFDHQIVDATKIF 318


>gi|323137891|ref|ZP_08072966.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylocystis sp.
           ATCC 49242]
 gi|322396894|gb|EFX99420.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylocystis sp.
           ATCC 49242]
          Length = 306

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 146/304 (48%), Positives = 191/304 (62%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  ++  +     QLRG+   N PL   TWFR GG A+++F P D  DL YFL  LP 
Sbjct: 1   MTFPDLTADIARLMPQLRGRVSANEPLAPYTWFRVGGPAQLLFMPADEGDLAYFLAHLPR 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           +IP+T++GLGSN++VRD G+ GVV+RLS  GF  I V +HC + +GA       A +A  
Sbjct: 61  EIPVTVIGLGSNLIVRDGGVAGVVIRLSAKGFGEIAVEDHCRLRIGAAVPDVKAARAAAD 120

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
            GI G  F+ GIPG+IGGA  MNAGA+  ET   ++E  G+DR G+  V     + Y YR
Sbjct: 121 AGIDGLAFYRGIPGAIGGALRMNAGAHGGETKDALIEARGVDRNGDIRVFANADMGYTYR 180

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
                 D+I T  + +G P     I A +  +   RE  QPIKEKTGGSTFKNP GH AW
Sbjct: 181 HCSAPDDVIFTSALYQGRPGDPKQILAEMDRITEAREASQPIKEKTGGSTFKNPDGHKAW 240

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           QLI+ +GCRGL  G A++SE+HCNF+IN   AT  D+E LGE VR++V   SG+ L+WEI
Sbjct: 241 QLIDAAGCRGLVVGDAQVSEMHCNFLINRGRATAADIETLGETVRRRVRETSGVELQWEI 300

Query: 301 KRLG 304
           KR+G
Sbjct: 301 KRIG 304


>gi|241762279|ref|ZP_04760360.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|241373182|gb|EER62812.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
          Length = 310

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 120/309 (38%), Positives = 184/309 (59%), Gaps = 1/309 (0%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD 61
           +    S  +  +   +RG+ + N PL  +TWFR GGNAE +  P D  DL  FL  +   
Sbjct: 1   MTTATSSNISSKLPSIRGEIEANAPLAPLTWFRVGGNAEWLVSPYDTEDLSDFLKKIDQS 60

Query: 62  IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRH 121
           +P+ ++G+GSN+++RD G+ GV++RL     S ++      +  G    G  ++  A   
Sbjct: 61  MPVRVLGIGSNVIIRDGGVSGVIIRLPRRF-SWVKREEGNRLRCGGSTLGMMISKVAAAE 119

Query: 122 GIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS 181
            +    F  GIPGSIGG   MNAGA   + S+ +++V  + R G+  + P E+L + YR 
Sbjct: 120 SLTNLEFMRGIPGSIGGMIRMNAGAYGGDISKILIQVTLVRRNGDIEIWPVEKLNFAYRY 179

Query: 182 SEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
           SE+ +D I+T  + +G P  ++ I A +  +   RE  QP++ +TGGSTFKNP G+ AW+
Sbjct: 180 SELPEDAIVTEALFQGQPGDKDKIEAQMNKIIAEREASQPVRSRTGGSTFKNPEGYKAWE 239

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           LI+++GCRGL+ G A++S  H NF++N  +AT  D+E LGE+VR +V  + GI LEWEIK
Sbjct: 240 LIDEAGCRGLKIGDAEVSTKHANFLLNLGDATAADIENLGEEVRARVKAKFGITLEWEIK 299

Query: 302 RLGDFFDHQ 310
           R+G   D  
Sbjct: 300 RIGHKLDGD 308


>gi|56551729|ref|YP_162568.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|29336989|sp|Q9RNM8|MURB_ZYMMO RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|5834368|gb|AAD53934.1|AF179611_18 UDP-N-acetylenolpyruvoylglucosamine reductase [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|56543303|gb|AAV89457.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Zymomonas mobilis
           subsp. mobilis ZM4]
          Length = 310

 Score =  249 bits (636), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 120/309 (38%), Positives = 184/309 (59%), Gaps = 1/309 (0%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD 61
           +    S  +  +   +RG+ + N PL  +TWFR GGNAE +  P D  DL  FL  +   
Sbjct: 1   MTTATSSNISSKLPSIRGEIEANAPLAPLTWFRVGGNAEWLVSPYDTEDLSDFLKKIDPS 60

Query: 62  IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRH 121
           +P+ ++G+GSN+++RD G+ GV++RL     S ++      +  G    G  ++  A   
Sbjct: 61  MPVRVLGIGSNVIIRDGGVSGVIIRLPRRF-SWVKREEGNRLRCGGSTLGMMISKVAAAE 119

Query: 122 GIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS 181
            +    F  GIPGSIGG   MNAGA   + S+ +++V  + R G+  + P E+L + YR 
Sbjct: 120 SLTNLEFMRGIPGSIGGMIRMNAGAYGGDISKILIQVTLVRRNGDIEIWPVEKLNFAYRY 179

Query: 182 SEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
           SE+ +D I+T  + +G P  ++ I A +  +   RE  QP++ +TGGSTFKNP G+ AW+
Sbjct: 180 SELPEDAIVTEALFQGQPGDKDKIEAQMNKIIAEREASQPVRSRTGGSTFKNPEGYKAWE 239

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           LI+++GCRGL+ G A++S  H NF++N  +AT  D+E LGE+VR +V  + GI LEWEIK
Sbjct: 240 LIDEAGCRGLKIGDAEVSTKHANFLLNLGDATAADIENLGEEVRARVKAKFGITLEWEIK 299

Query: 302 RLGDFFDHQ 310
           R+G   D  
Sbjct: 300 RIGHKLDGD 308


>gi|260752696|ref|YP_003225589.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
 gi|258552059|gb|ACV75005.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
          Length = 310

 Score =  249 bits (636), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 120/309 (38%), Positives = 184/309 (59%), Gaps = 1/309 (0%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD 61
           +    S  +  +   +RG+ + N PL  +TWFR GGNAE +  P D  DL  FL  +   
Sbjct: 1   MTTASSSNISSKLPSIRGEIEANAPLAPLTWFRVGGNAEWLVSPYDTEDLSDFLKKIDPS 60

Query: 62  IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRH 121
           +P+ ++G+GSN+++RD G+ GV++RL     S ++      +  G    G  ++  A   
Sbjct: 61  MPVRVLGIGSNVIIRDGGVSGVIIRLPRRF-SWVKREEGNRLRCGGSTLGMMISKVAAAE 119

Query: 122 GIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS 181
            +    F  GIPGSIGG   MNAGA   + S+ +++V  + R G+  + P E+L + YR 
Sbjct: 120 SLTNLEFMRGIPGSIGGMIRMNAGAYGGDISKILIQVTLVRRNGDIEIWPVEKLNFAYRY 179

Query: 182 SEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
           SE+ +D I+T  + +G P  ++ I A +  +   RE  QP++ +TGGSTFKNP G+ AW+
Sbjct: 180 SELPEDAIVTEALFQGQPGDKDKIEAQMNKIIAEREASQPVRSRTGGSTFKNPEGYKAWE 239

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           LI+++GCRGL+ G A++S  H NF++N  +AT  D+E LGE+VR +V  + GI LEWEIK
Sbjct: 240 LIDEAGCRGLKIGDAEVSTKHANFLLNLGDATAADIENLGEEVRARVKAKFGITLEWEIK 299

Query: 302 RLGDFFDHQ 310
           R+G   D  
Sbjct: 300 RIGHKLDGD 308


>gi|148257415|ref|YP_001242000.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bradyrhizobium sp.
           BTAi1]
 gi|166222824|sp|A5EPK0|MURB_BRASB RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|146409588|gb|ABQ38094.1| UDP-N-acetylmuramate dehydrogenase [Bradyrhizobium sp. BTAi1]
          Length = 307

 Score =  248 bits (633), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 144/304 (47%), Positives = 191/304 (62%), Gaps = 1/304 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  I+  L+    +LRG+   N  L  +TWFR GG A+V+F P D  DL YFL  LP+
Sbjct: 1   MSFADITPDLKAAMPELRGRLLANEGLAPLTWFRVGGPAQVLFTPADADDLAYFLKHLPA 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           ++P+ ++G+GSN++VRD G+ GVV+RL+   F  ++V         A    K +A  A  
Sbjct: 61  ELPVYVIGVGSNLIVRDGGVPGVVIRLAPRAFGEVKVDGDIVAAGTAAL-DKRVAEVAAS 119

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             + G  F +GIPG+IGGA  MNAGAN  ET   +VE   IDR+G  H      + + YR
Sbjct: 120 ANLTGLEFLFGIPGTIGGALRMNAGANGGETKDILVEATAIDRQGVTHHFTNADMNFTYR 179

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
           +S     LI T    RG P     I   +A V  HRET QPI+EKTGGSTFKNP GHSAW
Sbjct: 180 ASGADPSLIFTAARFRGKPSDAEAIRGRMAEVQAHRETAQPIREKTGGSTFKNPPGHSAW 239

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +L++ +GCRGL+ GGA++SE+HCNF+IN  NAT  D+E LGE VR++V   SGI L+WEI
Sbjct: 240 RLVDAAGCRGLKVGGAQVSEMHCNFLINTGNATADDIETLGETVRERVEATSGIALQWEI 299

Query: 301 KRLG 304
           KR+G
Sbjct: 300 KRIG 303


>gi|47605804|sp|P61616|MURB_RHOPA RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
          Length = 309

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 147/304 (48%), Positives = 193/304 (63%), Gaps = 1/304 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  I+  L+    +LRG+   N PL  +TWFR GG A+V+F P D  DL YFL  LP+
Sbjct: 1   MSFPDITPELKAAMPELRGRLLSNEPLAPLTWFRVGGPAQVLFTPADEDDLGYFLPRLPA 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           +IP+  +GLGSN++VRD G+ GV +RLS  GF    V     +  GA    K +A +A  
Sbjct: 61  EIPVMCLGLGSNLIVRDGGLPGVAIRLSPRGFGEHRVEGE-MVHAGAAALDKRVAETAAA 119

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             +GG  F+YGIPGSIGGA  MNAGAN  ET   +++    DR G + +     +++ YR
Sbjct: 120 AQLGGLEFYYGIPGSIGGALRMNAGANGRETKDVLIDATAYDRSGTRKLFDNAAMQFSYR 179

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
            S     LI T   LRG P + + I A +  V  HRE  QPI+EKTGGSTFKNP G SAW
Sbjct: 180 HSGADPALIFTSARLRGTPATPDHIRAKMNEVQAHRELAQPIREKTGGSTFKNPPGQSAW 239

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LI+ +GCRGL+ GGA++SE+HCNF+IN   AT  D+E LGE VR +V  QSG+ L+WEI
Sbjct: 240 RLIDAAGCRGLKIGGAQVSEMHCNFLINTGEATAADIETLGETVRARVKAQSGVELQWEI 299

Query: 301 KRLG 304
           KR+G
Sbjct: 300 KRIG 303


>gi|39936590|ref|NP_948866.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodopseudomonas
           palustris CGA009]
 gi|39650446|emb|CAE28969.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodopseudomonas
           palustris CGA009]
          Length = 324

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 147/304 (48%), Positives = 193/304 (63%), Gaps = 1/304 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  I+  L+    +LRG+   N PL  +TWFR GG A+V+F P D  DL YFL  LP+
Sbjct: 16  MSFPDITPELKAAMPELRGRLLSNEPLAPLTWFRVGGPAQVLFTPADEDDLGYFLPRLPA 75

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           +IP+  +GLGSN++VRD G+ GV +RLS  GF    V     +  GA    K +A +A  
Sbjct: 76  EIPVMCLGLGSNLIVRDGGLPGVAIRLSPRGFGEHRVEGE-MVHAGAAALDKRVAETAAA 134

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             +GG  F+YGIPGSIGGA  MNAGAN  ET   +++    DR G + +     +++ YR
Sbjct: 135 AQLGGLEFYYGIPGSIGGALRMNAGANGRETKDVLIDATAYDRSGTRKLFDNAAMQFSYR 194

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
            S     LI T   LRG P + + I A +  V  HRE  QPI+EKTGGSTFKNP G SAW
Sbjct: 195 HSGADPALIFTSARLRGTPATPDHIRAKMNEVQAHRELAQPIREKTGGSTFKNPPGQSAW 254

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LI+ +GCRGL+ GGA++SE+HCNF+IN   AT  D+E LGE VR +V  QSG+ L+WEI
Sbjct: 255 RLIDAAGCRGLKIGGAQVSEMHCNFLINTGEATAADIETLGETVRARVKAQSGVELQWEI 314

Query: 301 KRLG 304
           KR+G
Sbjct: 315 KRIG 318


>gi|192292412|ref|YP_001993017.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodopseudomonas
           palustris TIE-1]
 gi|254765554|sp|B3QFM9|MURB_RHOPT RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|192286161|gb|ACF02542.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodopseudomonas
           palustris TIE-1]
          Length = 309

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 147/304 (48%), Positives = 194/304 (63%), Gaps = 1/304 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  I+  L+    +LRG+   N PL  +TWFR GG A+V+F P D  DL YFL+ LP+
Sbjct: 1   MSFPDITPDLKAAMPELRGRLLGNEPLAPLTWFRVGGPAQVLFTPADEDDLGYFLSRLPA 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           +IP+  +GLGSN++VRD G+ GV +RLS  GF    V     +  GA    K +A +A  
Sbjct: 61  EIPVMCLGLGSNLIVRDGGLPGVAIRLSPRGFGEHRVEGEV-VHAGAAALDKRVAETAAA 119

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             +GG  F+YGIPGSIGGA  MNAGAN  ET   +++    DR G + +     +++ YR
Sbjct: 120 AQLGGLEFYYGIPGSIGGALRMNAGANGRETKDVLIDATAYDRSGTRKLFDNAAMQFSYR 179

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
            S     LI T   LRG P + + I A +  V  HRE  QPI+EKTGGSTFKNP G SAW
Sbjct: 180 HSGADPALIFTSARLRGTPATPDHIRAKMNEVQAHRELAQPIREKTGGSTFKNPPGQSAW 239

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LI+ +GCRGL+ GGA++SE+HCNF+IN   AT  D+E LGE VR +V  QSG+ L+WEI
Sbjct: 240 RLIDAAGCRGLKIGGAQVSEMHCNFLINTGEATAADIETLGETVRARVKAQSGVELQWEI 299

Query: 301 KRLG 304
           KR+G
Sbjct: 300 KRIG 303


>gi|92116838|ref|YP_576567.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrobacter
           hamburgensis X14]
 gi|122418257|sp|Q1QNU0|MURB_NITHX RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|91799732|gb|ABE62107.1| UDP-N-acetylmuramate dehydrogenase [Nitrobacter hamburgensis X14]
          Length = 305

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 142/303 (46%), Positives = 194/303 (64%), Gaps = 1/303 (0%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD 61
           ++  I+  L+ +  +LRG+   N PL  +TWFR GG A+V+F P D +DL YFL  LP +
Sbjct: 1   MFADITTKLKSQMPELRGRMLANEPLAPLTWFRVGGPAQVLFTPADENDLAYFLRHLPEE 60

Query: 62  IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRH 121
           IPI  +G+GSN++VRD G+ GVV+RL+  GF  +       +  GA    K +A +A   
Sbjct: 61  IPIYCIGVGSNLIVRDRGLPGVVIRLAPRGFGEVTTDGDT-VHAGAAALDKRVAEAAAAA 119

Query: 122 GIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS 181
            IGG  F++GIPG+IGGA  MNAGAN  ET   +VE   + R+G++  +    +K++YR+
Sbjct: 120 DIGGLEFYFGIPGTIGGALRMNAGANGSETKDVLVEARAVSRRGDKITVDNAGMKFEYRN 179

Query: 182 SEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
           S I   +I T    RG       I A +  V  HRETVQPI+EKTGGSTFKNP G SAW+
Sbjct: 180 SAIYPSVIFTGGTFRGRRAEPEAIRARMNEVQSHRETVQPIREKTGGSTFKNPPGQSAWK 239

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           LI+ +G RG   GGA++SE+HCNF+IN   AT  D+E LGE VR +V   +G+ L+WEIK
Sbjct: 240 LIDAAGMRGHRVGGAQVSEMHCNFLINTGEATARDIETLGETVRARVKEHAGVDLQWEIK 299

Query: 302 RLG 304
           R+G
Sbjct: 300 RIG 302


>gi|298293096|ref|YP_003695035.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Starkeya novella DSM
           506]
 gi|296929607|gb|ADH90416.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Starkeya novella DSM
           506]
          Length = 306

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 146/304 (48%), Positives = 192/304 (63%), Gaps = 1/304 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  I+  L  R  +LRG+   N  L ++TWFR GG A+V+F P D  DL YFL  LP+
Sbjct: 1   MTFPDITAELSARMPELRGRMIANQSLAELTWFRVGGPAQVLFTPADEDDLAYFLKNLPA 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           +IP+ +VGLGSN++VRD G+ GVV+RL     S I+V + C++ VGA       A +A  
Sbjct: 61  EIPVMVVGLGSNLIVRDGGVPGVVIRLGRGF-SEIKVEDGCKLRVGAAVPDVKAARAAAD 119

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
            GI G  F+ GIPG IGGA  MNAGA+  ET   ++E   +DR GN  +       + YR
Sbjct: 120 AGIDGLAFYRGIPGGIGGALRMNAGAHGGETKDCLIEARAVDRAGNIRLFSNGDFSFSYR 179

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
            S    D+I T  + +G P     I A +  +   RE  QPI+EKTGGSTFKNP GH AW
Sbjct: 180 HSGAPTDVIFTSALYQGRPGDSATILAEMDRITEAREASQPIREKTGGSTFKNPPGHKAW 239

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           QLI+ +GCRGL  G A++SE+HCNF+IN  +AT  D+E LGE+VR+ V  QSG+ LEWEI
Sbjct: 240 QLIDAAGCRGLTVGAAQVSEMHCNFLINTGSATAADIEGLGEEVRRSVKAQSGVELEWEI 299

Query: 301 KRLG 304
           KR+G
Sbjct: 300 KRIG 303


>gi|75675247|ref|YP_317668.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrobacter
           winogradskyi Nb-255]
 gi|90109780|sp|Q3STS5|MURB_NITWN RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|74420117|gb|ABA04316.1| UDP-N-acetylmuramate dehydrogenase [Nitrobacter winogradskyi
           Nb-255]
          Length = 305

 Score =  247 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 141/304 (46%), Positives = 187/304 (61%), Gaps = 1/304 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  I   L+ R   LRG+   N  L  +TWFR GG A+ +F P D  DL YFL+ LP 
Sbjct: 1   MTFPDIVPELKSRMPDLRGRLLANESLAPLTWFRVGGPAQALFTPADEDDLAYFLSHLPE 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           +IP+  +G+GSN++VRD G+ GVV+RL   GF  I +     +  GA    K +A +A  
Sbjct: 61  EIPVCCIGVGSNLIVRDRGLPGVVIRLPPRGFGEITIDG-DAVHAGAAALDKRVAEAAAA 119

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             I G  F++GIPG+IGGA  MNAGAN  ET   +VE   + R+G +       + + YR
Sbjct: 120 ASISGLEFYFGIPGTIGGALRMNAGANGSETRDVLVEARALSRRGERMTFDNFAMAFDYR 179

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
           SS I   +I T  + RG       I A +  V  HRETVQPI+EKTGGSTFKNP G SAW
Sbjct: 180 SSGIDPSVIFTGAMFRGRIAEPQAIRARMNEVQAHRETVQPIREKTGGSTFKNPPGQSAW 239

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LI+ +G RG   GGA++S++HCNF+IN   AT  D+E LGE VR++V   SG+ L+WEI
Sbjct: 240 KLIDAAGMRGHRVGGAQVSDMHCNFLINTGEATARDIETLGESVRERVKRHSGVDLQWEI 299

Query: 301 KRLG 304
           KR+G
Sbjct: 300 KRIG 303


>gi|154252865|ref|YP_001413689.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Parvibaculum
           lavamentivorans DS-1]
 gi|171769614|sp|A7HVU9|MURB_PARL1 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|154156815|gb|ABS64032.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Parvibaculum
           lavamentivorans DS-1]
          Length = 310

 Score =  247 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 135/304 (44%), Positives = 186/304 (61%), Gaps = 2/304 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M+    +  L +R  ++RG+   + PL  +TWFR GGNAEV+F+P D  DL  FL   P+
Sbjct: 1   MMAAEATAALIDRLPKVRGELVADAPLAPLTWFRAGGNAEVLFRPADADDLAAFLAGTPA 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           D+P+TI+G+GSN+LVR+ G+ GVV+RL     +         +  G      +++ +A  
Sbjct: 61  DVPVTIIGVGSNLLVREGGVPGVVIRLGRGFMNI--EIEGTCVRAGTAALDVAVSRAAQE 118

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
            G+ G  F+ GIPGSIGGA  MN GA   ET   +VE   IDR G +HV+    + Y YR
Sbjct: 119 AGLAGLEFYRGIPGSIGGALRMNGGAYGRETKDVLVEAVAIDRAGKRHVLTNADMHYTYR 178

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
                 DLI    + +G P +   I   +  +   RE  QPI+ +TGGSTFKNP GH +W
Sbjct: 179 HCGAPDDLIFVEALFQGTPGNAEDILRRMNEITSSREATQPIRTRTGGSTFKNPEGHKSW 238

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           QLI+ +GCRGL  GGA++SELHCNF+IN  +AT  D+E LGE+VR +V   SG+ LEWEI
Sbjct: 239 QLIDAAGCRGLRKGGAQVSELHCNFLINTGDATASDIEDLGEEVRARVKETSGVTLEWEI 298

Query: 301 KRLG 304
           +R+G
Sbjct: 299 RRIG 302


>gi|27381711|ref|NP_773240.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bradyrhizobium
           japonicum USDA 110]
 gi|47605875|sp|Q89FU9|MURB_BRAJA RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|27354880|dbj|BAC51865.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bradyrhizobium
           japonicum USDA 110]
          Length = 305

 Score =  247 bits (629), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 148/304 (48%), Positives = 195/304 (64%), Gaps = 1/304 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  I+  L+     LRG+   N  L ++TWFR GG A+V+F P D  DL YFL  L S
Sbjct: 1   MSFPDITPSLKATMPDLRGRLLANQSLAELTWFRVGGPAQVLFTPADEDDLAYFLAHLAS 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           DIP+ +VG+GSN++VRD GI GVV+RL+   F      +   +  GA    K +A  A  
Sbjct: 61  DIPVYVVGVGSNLIVRDGGIAGVVIRLAPRAF-GEASASGDIVTAGAAALDKRVAEVAAS 119

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             IGG  F++GIPG+IGGA  MNAGAN  ET   ++E  G+ R G +HV     +K+ YR
Sbjct: 120 ANIGGLEFYFGIPGTIGGALRMNAGANGGETKDVLIEARGVGRDGTKHVFSNADMKFVYR 179

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
           +S +   +I T    RG  +  + I A +A V  HRET QPI+EKTGGSTFKNP GHSAW
Sbjct: 180 NSGVDPSIIFTSARFRGEVKDADAIRARMAEVQSHRETAQPIREKTGGSTFKNPPGHSAW 239

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +L++ +GCRGL  GGA++SE+HCNF+IN  +AT +D+E LGE VR +V   SGI L WEI
Sbjct: 240 KLVDAAGCRGLRVGGAQVSEMHCNFLINTGDATAHDIETLGETVRARVKANSGIELHWEI 299

Query: 301 KRLG 304
           KR+G
Sbjct: 300 KRIG 303


>gi|315122421|ref|YP_004062910.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495823|gb|ADR52422.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 316

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 238/309 (77%), Positives = 273/309 (88%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
            R+R +QLRGKFQENFP+KQ+TWFRTGGNAE MFQP+DIHDLKYFLTLLP+DI ITIVGL
Sbjct: 8   FRKRVQQLRGKFQENFPMKQVTWFRTGGNAEFMFQPKDIHDLKYFLTLLPNDITITIVGL 67

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
           GSNILVRDAGI+GVVLRLS++GFS IE+++ CE++VGA CSGK LAN A+ HGIGG HFF
Sbjct: 68  GSNILVRDAGIKGVVLRLSHSGFSQIEMKSDCEIVVGASCSGKFLANWAMHHGIGGLHFF 127

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLI 189
           YGIPGSIGGA YMNAGANNCETSQ VVEVH +DR GNQH+IP+ ++ YQYR S + KD I
Sbjct: 128 YGIPGSIGGAVYMNAGANNCETSQCVVEVHAMDRMGNQHIIPQNKMGYQYRHSLLPKDYI 187

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
           ITHV L+GFPESQ++I +AI+ V  HR+TVQPIKEKTGGSTFKNP GHSAW+LIE+S CR
Sbjct: 188 ITHVFLKGFPESQDVIRSAISTVSVHRQTVQPIKEKTGGSTFKNPMGHSAWKLIEESQCR 247

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDH 309
           GLEFGGAKISELHCNFMIN  NATGYDLEYLGE VRKKV  ++GI+LEWEIKRLG+F DH
Sbjct: 248 GLEFGGAKISELHCNFMINTGNATGYDLEYLGELVRKKVLKKTGIVLEWEIKRLGEFVDH 307

Query: 310 QIVDATKIF 318
           +I+D T IF
Sbjct: 308 RIIDDTTIF 316


>gi|146342496|ref|YP_001207544.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bradyrhizobium sp.
           ORS278]
 gi|166222825|sp|A4YZK1|MURB_BRASO RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|146195302|emb|CAL79327.1| UDP-N-acetylenolpyruvoylglucosamine reductase (MurB-like)
           [Bradyrhizobium sp. ORS278]
          Length = 307

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 146/304 (48%), Positives = 193/304 (63%), Gaps = 1/304 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  I+  L+     LRG+   N  L  +TWFR GG A+V+F P D  DL YFL  LP+
Sbjct: 1   MSFPDITPDLKAAMPALRGRLLANESLAPLTWFRVGGPAQVLFTPADADDLAYFLKHLPA 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           ++P+ ++G+GSN++VRD G+ GVV+RL+   F  ++          A    K +A  A  
Sbjct: 61  ELPVYVIGVGSNMIVRDGGVPGVVIRLAPRAFGEVKAEGDIITAGTA-ARDKRVAEVAAS 119

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             + G  F +GIPG+IGGA  MNAGAN  ET   +VE   IDR+G  H +    +K+ YR
Sbjct: 120 ADLAGLEFLFGIPGTIGGALRMNAGANGGETKDILVEATAIDRRGETHRLSNADMKFTYR 179

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
           +S     LI T V  RG P     I A +A V  HRET QPI+EKTGGSTFKNP GHSAW
Sbjct: 180 ASGTDAALIFTAVRFRGTPSEPAAIRARMAEVQAHRETAQPIREKTGGSTFKNPPGHSAW 239

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +L++ +GCRGL+ GGA++SE+HCNF+IN  NAT  D+E LGE VR++V   SGI L+WEI
Sbjct: 240 KLVDAAGCRGLKVGGAQVSEMHCNFLINTGNATADDIETLGETVRERVKASSGIELQWEI 299

Query: 301 KRLG 304
           KR+G
Sbjct: 300 KRIG 303


>gi|209884385|ref|YP_002288242.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Oligotropha
           carboxidovorans OM5]
 gi|209872581|gb|ACI92377.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Oligotropha
           carboxidovorans OM5]
          Length = 307

 Score =  245 bits (626), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 144/302 (47%), Positives = 188/302 (62%), Gaps = 1/302 (0%)

Query: 3   YGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDI 62
           +  IS  L+    +LRG+   N PL  +TWFR GG A+V+F P D  DL YFL  LP+DI
Sbjct: 4   FPDISADLKSAMPELRGRVLANEPLGPLTWFRVGGPAQVLFTPVDEDDLAYFLAHLPADI 63

Query: 63  PITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHG 122
           P+ ++G+GSN++VRD G+ GVV+RLS  GF  I           A    K +A +A    
Sbjct: 64  PVYVIGVGSNLIVRDGGVEGVVIRLSPRGFGTIVAEGDTVRAGTAAL-DKRVAEAAAAAN 122

Query: 123 IGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS 182
           IGG  F++GIPGSIGGA  MNAGAN  ET   +VE  G+ R G        ++ + YRS 
Sbjct: 123 IGGLEFYFGIPGSIGGALRMNAGANGGETKDVLVEARGVTRAGETVTFTNAEMGFVYRSH 182

Query: 183 EITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
            +   +I T  + RG       I A +  V  HRET QPI+EKTGGSTFKNP GHS+W+L
Sbjct: 183 GVDPSIIFTSALYRGTLMEPEKIRARMNEVQQHRETAQPIREKTGGSTFKNPPGHSSWKL 242

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           ++ +G RG   GGA++SE+HCNF+IN  +AT  D+E LGE VR +V   SGI L+WEIKR
Sbjct: 243 VDAAGMRGFRVGGAQVSEMHCNFLINTGDATAADIETLGETVRDRVKAHSGIELQWEIKR 302

Query: 303 LG 304
           +G
Sbjct: 303 IG 304


>gi|85714978|ref|ZP_01045963.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrobacter sp.
           Nb-311A]
 gi|85698175|gb|EAQ36047.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrobacter sp.
           Nb-311A]
          Length = 317

 Score =  245 bits (626), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 141/304 (46%), Positives = 189/304 (62%), Gaps = 1/304 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  I+  L+ +  +LRG+   N PL  +TWFR GG A+V+F P D +DL YFL  LP 
Sbjct: 12  MTFPDITTKLKSQMPELRGRLLANEPLAPLTWFRVGGPAQVLFTPADENDLAYFLCHLPE 71

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           +IP+  +G+GSN++VRD G+ GVV+RLS  GF  +       +  GA    K +A  A  
Sbjct: 72  EIPVCCLGVGSNVVVRDRGLPGVVIRLSPRGFGEVTTDG-DIVRAGAAALDKRVAEVAAA 130

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             I G  F++GIPG+IGGA  MNAGAN  ET   +VE   + R+G++       + + YR
Sbjct: 131 VHISGLEFYFGIPGTIGGALRMNAGANGSETRDVLVEARAVGRRGDKMTFDNSGMAFDYR 190

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
            S +   +I T    RG       I A +  V  HRETVQPI+EKTGGSTFKNP G SAW
Sbjct: 191 KSGVDPSVIFTGATFRGRIAEPQTIRARMNEVQAHRETVQPIREKTGGSTFKNPPGQSAW 250

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LI+ +G RG   GGA++S++HCNF+IN   AT  D+E LGE VR++V   SGI L+WEI
Sbjct: 251 KLIDAAGMRGHRVGGAQVSDMHCNFLINTGEATARDIETLGETVRERVKRHSGIELQWEI 310

Query: 301 KRLG 304
           KR+G
Sbjct: 311 KRIG 314


>gi|86749121|ref|YP_485617.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodopseudomonas
           palustris HaA2]
 gi|123408334|sp|Q2IYK4|MURB_RHOP2 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|86572149|gb|ABD06706.1| UDP-N-acetylmuramate dehydrogenase [Rhodopseudomonas palustris
           HaA2]
          Length = 309

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 147/303 (48%), Positives = 199/303 (65%), Gaps = 1/303 (0%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD 61
           ++  ++  L+     LRG+   N PL  +TWFR GG A+V+F P D  DL YFL+LLP++
Sbjct: 1   MFPDLAADLKAAMPDLRGRLLGNEPLAPLTWFRVGGPAQVLFTPADEDDLGYFLSLLPAE 60

Query: 62  IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRH 121
           +P+  +G+GSN++VRD G+ GVV+RL+  GF          +  GA    K +A +A   
Sbjct: 61  VPVLCIGVGSNLIVRDGGLPGVVIRLAPRGFGEARSDGET-VHAGAAALDKRVAETAAAA 119

Query: 122 GIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS 181
            +GG  F++GIPG+IGGA  MNAGAN  ET   +++   +DR G +HVI    +++ YRS
Sbjct: 120 QLGGLEFYFGIPGTIGGALRMNAGANGRETRDVLIDATAVDRAGRRHVIDLAGMQFSYRS 179

Query: 182 SEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
           S     LI T    RG P S + I A +  V  HRE  QPI+EKTGGSTFKNP GHSAW+
Sbjct: 180 SGADPSLIFTSARFRGTPASPDAIRAKMNEVQAHRELAQPIREKTGGSTFKNPPGHSAWK 239

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           LI+ +GCRGL  GGA++SE+HCNF+IN  +AT  D+E LGE VR++V  QSGI L+WEIK
Sbjct: 240 LIDAAGCRGLRIGGAQVSEMHCNFLINIGDATAADIETLGETVRERVKAQSGIELQWEIK 299

Query: 302 RLG 304
           R+G
Sbjct: 300 RIG 302


>gi|299131923|ref|ZP_07025118.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Afipia sp. 1NLS2]
 gi|298592060|gb|EFI52260.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Afipia sp. 1NLS2]
          Length = 305

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 146/304 (48%), Positives = 194/304 (63%), Gaps = 1/304 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  IS  L+    QLRG+   N  L  +TWFR GG A+++F P D  DL YFL  LP+
Sbjct: 1   MNFPDISADLKAAMPQLRGRVLANELLGPLTWFRVGGPAQILFTPADEDDLAYFLKHLPT 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           DIP+ ++G+GSN++VRD G+ GVV+RLS  GF ++           A    K +A +A  
Sbjct: 61  DIPVYVIGVGSNLIVRDGGVEGVVIRLSPRGFGSVVAEGDTVRAGTAAL-DKRVAEAAAA 119

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             IGG  F++GIPGSIGGA  MNAGAN  ET   +VE  G+ R G++      ++K+ YR
Sbjct: 120 ANIGGLEFYFGIPGSIGGALRMNAGANGGETKDVLVEARGVTRNGDKVTFSNAEMKFVYR 179

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
           S  +   +I T  + RG       I A +  V  HRET QPI+EKTGGSTFKNP GHS+W
Sbjct: 180 SHGVDPSIIFTSALYRGVVTETEKIRARMNEVQQHRETAQPIREKTGGSTFKNPPGHSSW 239

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LI+ +G RG   GGA++SE+HCNF+IN  +AT +D+E LGE VR++V  QSGI L WEI
Sbjct: 240 KLIDAAGLRGFRVGGAQVSEMHCNFLINTGDATAHDIETLGETVRERVKAQSGIELHWEI 299

Query: 301 KRLG 304
           KR+G
Sbjct: 300 KRIG 303


>gi|154503791|ref|ZP_02040851.1| hypothetical protein RUMGNA_01615 [Ruminococcus gnavus ATCC 29149]
 gi|153795891|gb|EDN78311.1| hypothetical protein RUMGNA_01615 [Ruminococcus gnavus ATCC 29149]
          Length = 354

 Score =  243 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 98/295 (33%), Positives = 153/295 (51%), Gaps = 6/295 (2%)

Query: 16  QLRGK--FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSN 72
           ++ G+     + P+K+ T FR GG A+     Q   +++  L L   + IP  I+G GSN
Sbjct: 62  KISGEENVLRDEPMKKHTTFRIGGPADYFVTVQSKDEIREILLLCKREQIPYYILGNGSN 121

Query: 73  ILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGI 132
           +LV D G RGVV+++              ++   A      +A  AL + + GF F  GI
Sbjct: 122 LLVGDKGYRGVVIQICKRMNEI--RTEENKIYAQAGALLSKIAAQALSNSLTGFEFASGI 179

Query: 133 PGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIIT 191
           PG++GGA  MNAGA   E    +     +  +G    +  E+L+  YR+S + TK   + 
Sbjct: 180 PGTLGGAVMMNAGAYGGEMKHVLESADVLTPEGEFLTLSLEELELGYRTSVVATKGYTVL 239

Query: 192 HVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGL 251
              +     +   I A + ++   R T QP++  + GSTFK P G+ A +LI+ SG +G 
Sbjct: 240 GATIALEKGNPEEIKAYMDDLKERRITKQPLEYASAGSTFKRPEGYFAGKLIQDSGLKGY 299

Query: 252 EFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
             G A+ISE H  F+IN  NA+  D+  L E V++ V  + G+ LE E+KR+G+F
Sbjct: 300 SVGDAQISEKHSGFVINRGNASAKDVLSLIEHVQETVKEKFGVHLETEVKRIGEF 354


>gi|20808252|ref|NP_623423.1| UDP-N-acetylmuramate dehydrogenase [Thermoanaerobacter
           tengcongensis MB4]
 gi|29336806|sp|Q8R8Z6|MURB_THETN RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|20516850|gb|AAM25027.1| UDP-N-acetylmuramate dehydrogenase [Thermoanaerobacter
           tengcongensis MB4]
          Length = 302

 Score =  243 bits (619), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 109/306 (35%), Positives = 165/306 (53%), Gaps = 7/306 (2%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-S 60
           +   +   L+E  K+  GK   N P+K+ T F+ GG A+V+  P    +L   +  L   
Sbjct: 1   MAEILVDKLKEILKE--GKLYLNEPMKRHTSFKIGGPADVLAVPGSRDELINLIAYLRQE 58

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
            IP  I+G G+N+LV + GIRGVV++LS+     +      ++I  A  S   +AN AL 
Sbjct: 59  KIPFFILGNGTNLLVSEKGIRGVVVKLSSLRNVIV---EGTKIIAEAGASLSYIANVALV 115

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
           H + GF F  GIPG++GGA  MNAGA   E    V +V  +D   N  ++  +++K+ YR
Sbjct: 116 HELTGFEFASGIPGTLGGAIVMNAGAYGSEMKDVVEKVEVLDENNNILILSNQEMKFSYR 175

Query: 181 SSEIT-KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
            S +  K+ I+    +     +   I   +  +   R+  QP+   + GSTFK P G+ A
Sbjct: 176 YSILQEKEWIVLRAWISLERGNYEEIKKKMEELNQRRKEKQPLDYPSAGSTFKRPPGYYA 235

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LIE +G +G   GGAK+SE H  F+IN  NAT YD+  L E ++K V  + G+ L  E
Sbjct: 236 GKLIEDAGLKGYSIGGAKVSEKHSGFIINTGNATFYDVLNLIEYIQKVVKEKFGVELMPE 295

Query: 300 IKRLGD 305
           IK +G+
Sbjct: 296 IKIVGE 301


>gi|307265907|ref|ZP_07547456.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           wiegelii Rt8.B1]
 gi|326390954|ref|ZP_08212504.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           ethanolicus JW 200]
 gi|306919076|gb|EFN49301.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           wiegelii Rt8.B1]
 gi|325992996|gb|EGD51438.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           ethanolicus JW 200]
          Length = 301

 Score =  242 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 113/307 (36%), Positives = 171/307 (55%), Gaps = 9/307 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP- 59
           MI   I   L++  ++  GK   N P+K+ T F+ GG A+V+  P +  +L   ++LL  
Sbjct: 1   MI--EIVDKLKDILRE--GKLYLNEPMKRHTSFKIGGPADVLVVPNNRKELLEAISLLKR 56

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +IP  I+G G+N+LV + GIRGVV++LS+     +       +I  A      +AN AL
Sbjct: 57  ENIPFFILGNGTNLLVSEKGIRGVVIKLSSLRNVIV---EGNRIIAEAGAPLSYIANVAL 113

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            H + GF F  GIPG++GGA  MNAGA   E    V +V  +D +GN  ++  E++ + Y
Sbjct: 114 VHELAGFEFASGIPGTLGGAIVMNAGAYGPEMKDVVEKVEVLDGEGNILILSNEEMNFSY 173

Query: 180 RSSEIT-KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S I  KD I+    L         I + +  +   R+  QP++  + GSTFK P G+ 
Sbjct: 174 RHSIIQEKDWIVLRAWLSLTKGKYEEIKSKMEELNAKRKEKQPLEYPSAGSTFKRPPGYY 233

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LIE++G +G   GGAK+SE H  F+IN  NAT YD+  L E ++K V  + G+ L  
Sbjct: 234 AGKLIEEAGLKGYSIGGAKVSEKHSGFIINTGNATFYDVLNLIEHIQKVVKEKFGVELVP 293

Query: 299 EIKRLGD 305
           EI+ +G+
Sbjct: 294 EIRIIGE 300


>gi|289578834|ref|YP_003477461.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           italicus Ab9]
 gi|289528547|gb|ADD02899.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           italicus Ab9]
          Length = 301

 Score =  242 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 111/303 (36%), Positives = 169/303 (55%), Gaps = 6/303 (1%)

Query: 6   ISRLLRERGKQLR-GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIP 63
           ++ ++ +    LR GK   N P+K+ T F+ GG A+V+  P +  +L   ++LL   +IP
Sbjct: 1   MNEIIDKLKDILREGKLYLNEPMKRHTSFKIGGPADVLVVPNNRKELLEAISLLKRENIP 60

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
             I+G G+N+LV + GIRGVV++LS+     +       +I  A      +AN AL H +
Sbjct: 61  FFILGNGTNLLVSEKGIRGVVIKLSSLRNVVV---EGNRIIAEAGAPLSYIANVALVHEL 117

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            GF F  GIPG++GGA  MNAGA   E    + +V  +D +GN  ++  E++ + YR S 
Sbjct: 118 AGFEFASGIPGTLGGAIVMNAGAYGSEMKDVIEKVEVLDGEGNILILSNEEMNFSYRYSI 177

Query: 184 IT-KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
           I  KD I+    L         I + +  +   R   QP++  + GSTFK P G+ A +L
Sbjct: 178 IHEKDWIVLRAWLSLAKGKYEEIKSKMEELNAKRREKQPLEYPSAGSTFKRPPGYYAGKL 237

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IE++G +G   GGAK+SE H  F+IN  NAT YD+  L E ++K V  + G+ L  EIK 
Sbjct: 238 IEEAGLKGYSIGGAKVSEKHSGFIINTGNATFYDVLNLIEHIQKVVKEKFGVELVPEIKI 297

Query: 303 LGD 305
           +G+
Sbjct: 298 IGE 300


>gi|187609777|sp|Q07PT0|MURB_RHOP5 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
          Length = 306

 Score =  242 bits (617), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 150/304 (49%), Positives = 192/304 (63%), Gaps = 1/304 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  +   L+    +LRG+   N PL  +TWFR GG A+++F P D +DL YFL  LP 
Sbjct: 1   MNFPDLIPDLKPAMPELRGRLLANAPLAPLTWFRVGGPAQLLFTPADENDLAYFLARLPK 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           +IP++IVG+GSN++VRD G+ G V+RL+  GF    V        GA    K +A +A  
Sbjct: 61  EIPVSIVGVGSNLIVRDGGLPGAVIRLAARGFGETRVDGDVI-HAGAAALDKRVAETAAA 119

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
            GIGG  F YGIPG+IGGA  MNAGAN  E    + E  GI R G+ HV     ++  YR
Sbjct: 120 AGIGGLEFLYGIPGTIGGALRMNAGANGGEIKDVLEEATGIGRDGSLHVFRNAGMRLSYR 179

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
            S +   +I T V LRG       I A +  V  HRET QPI+EKTGGSTFKNP G SAW
Sbjct: 180 KSGVDASVIFTSVRLRGAIAPPETIRAKMDEVQKHRETAQPIREKTGGSTFKNPPGQSAW 239

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LI+++GCRGL  GGA++SELHCNF+IN  +AT  D+E LGE VR +V   SGI L+WEI
Sbjct: 240 KLIDEAGCRGLRVGGAQVSELHCNFLINTGDATAADIETLGETVRDRVKTHSGIELQWEI 299

Query: 301 KRLG 304
           KR+G
Sbjct: 300 KRIG 303


>gi|115524123|ref|YP_781034.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodopseudomonas
           palustris BisA53]
 gi|115518070|gb|ABJ06054.1| UDP-N-acetylmuramate dehydrogenase [Rhodopseudomonas palustris
           BisA53]
          Length = 321

 Score =  242 bits (617), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 150/304 (49%), Positives = 192/304 (63%), Gaps = 1/304 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  +   L+    +LRG+   N PL  +TWFR GG A+++F P D +DL YFL  LP 
Sbjct: 16  MNFPDLIPDLKPAMPELRGRLLANAPLAPLTWFRVGGPAQLLFTPADENDLAYFLARLPK 75

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           +IP++IVG+GSN++VRD G+ G V+RL+  GF    V        GA    K +A +A  
Sbjct: 76  EIPVSIVGVGSNLIVRDGGLPGAVIRLAARGFGETRVDGDVI-HAGAAALDKRVAETAAA 134

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
            GIGG  F YGIPG+IGGA  MNAGAN  E    + E  GI R G+ HV     ++  YR
Sbjct: 135 AGIGGLEFLYGIPGTIGGALRMNAGANGGEIKDVLEEATGIGRDGSLHVFRNAGMRLSYR 194

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
            S +   +I T V LRG       I A +  V  HRET QPI+EKTGGSTFKNP G SAW
Sbjct: 195 KSGVDASVIFTSVRLRGAIAPPETIRAKMDEVQKHRETAQPIREKTGGSTFKNPPGQSAW 254

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LI+++GCRGL  GGA++SELHCNF+IN  +AT  D+E LGE VR +V   SGI L+WEI
Sbjct: 255 KLIDEAGCRGLRVGGAQVSELHCNFLINTGDATAADIETLGETVRDRVKTHSGIELQWEI 314

Query: 301 KRLG 304
           KR+G
Sbjct: 315 KRIG 318


>gi|300021780|ref|YP_003754391.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299523601|gb|ADJ22070.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 326

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 143/318 (44%), Positives = 189/318 (59%), Gaps = 2/318 (0%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD 61
           ++  I+  LR    +LRG+   N  L  ITWFR GG A+V+F P D  DL YFL   P D
Sbjct: 1   MFDDITSELRALMPELRGRLIANASLADITWFRVGGPAQVLFTPADEADLAYFLKRKPRD 60

Query: 62  IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRH 121
           +P+ ++GLGSN+LVRD G+ GVV+RL       I++     +  G       +A +A   
Sbjct: 61  LPVFVMGLGSNLLVRDGGVAGVVIRLGRGFGE-IKIEEGGRLRAGTAVPDVKVARAAAEA 119

Query: 122 GIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS 181
           GI G  F+ GIPGSIGGA  MNAGA+  ET   ++    +D +GN HV+    + + YR 
Sbjct: 120 GISGLAFYRGIPGSIGGALRMNAGAHGRETKDCLIGARAVDPEGNVHVLSLADMGFTYRH 179

Query: 182 SEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
           S I +  I T    +G P     I   +  V  +RE  QPIKE+TGGSTFKNP GHSAW+
Sbjct: 180 SAIPETWIFTEATYQGAPGDPAEILKEMDAVAEYREQNQPIKERTGGSTFKNPPGHSAWK 239

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           L++ +GCRGL  GGAK+SE+HCNF+IN   A+G D+E LGE VR +V  +SG+ L WEI 
Sbjct: 240 LVDDAGCRGLRVGGAKVSEMHCNFLINDRQASGEDVERLGETVRARVKAKSGVTLNWEII 299

Query: 302 RLGDFFDHQIV-DATKIF 318
           RLG       V +A  I 
Sbjct: 300 RLGSPRPGAAVGEALAIL 317


>gi|316933189|ref|YP_004108171.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodopseudomonas
           palustris DX-1]
 gi|315600903|gb|ADU43438.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodopseudomonas
           palustris DX-1]
          Length = 312

 Score =  242 bits (616), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 146/302 (48%), Positives = 192/302 (63%), Gaps = 1/302 (0%)

Query: 3   YGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDI 62
           +  I+  L+    +LRG+   N PL  +TWFR GG A+V++ P D  DL YFL+ LP +I
Sbjct: 6   FPDITPELKTAMPELRGRLLGNEPLAPLTWFRVGGPAQVLYTPADEDDLGYFLSRLPPEI 65

Query: 63  PITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHG 122
           P+  +GLGSN++VRD G+ GV +RLS  GF    V     +  GA    K +A +A    
Sbjct: 66  PLMCLGLGSNLIVRDGGLPGVAIRLSPRGFGEHRVEGEV-VHAGAAALDKRVAETAAAAQ 124

Query: 123 IGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS 182
           +GG  F+YGIPGSIGGA  MNAGAN  ET   +++    DR G + +     +++ YR S
Sbjct: 125 LGGLEFYYGIPGSIGGALRMNAGANGRETKDVLIDATAYDRSGTRRLFDNTAMQFSYRHS 184

Query: 183 EITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
                LI T   LRG P + + I A +  V  HRE  QPI+EKTGGSTFKNP GHSAW+L
Sbjct: 185 GADPALIFTSARLRGTPATPDHIRAKMNEVQAHRELAQPIREKTGGSTFKNPAGHSAWRL 244

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           I+ +GCRGL  GGA++SE+HCNF+IN   AT  D+E LGE VR +V  QSG+ L+WEIKR
Sbjct: 245 IDAAGCRGLRIGGAQVSEMHCNFLINTGEATASDIETLGETVRARVKAQSGVELQWEIKR 304

Query: 303 LG 304
           +G
Sbjct: 305 IG 306


>gi|297545054|ref|YP_003677356.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
 gi|296842829|gb|ADH61345.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
          Length = 301

 Score =  242 bits (616), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 112/303 (36%), Positives = 168/303 (55%), Gaps = 6/303 (1%)

Query: 6   ISRLLRERGKQLR-GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIP 63
           ++ ++ +    LR GK   N P+K+ T F+ GG A+V+  P +  +L   + LL   +IP
Sbjct: 1   MNEIIDKLKDILREGKLYLNEPMKRHTSFKIGGPADVLVVPNNRKELLEIIPLLKQENIP 60

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
             I+G G+N+LV + GIRGVV++LS+     +       +I  A      +AN AL H +
Sbjct: 61  FFILGNGTNLLVSEKGIRGVVIKLSSLRNVIV---EGNRIIAEAGAPLSYIANVALVHEL 117

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            GF F  GIPG++GGA  MNAGA   E    V +V  +D +GN  ++  E++ + YR S 
Sbjct: 118 AGFEFASGIPGTLGGAIVMNAGAYGSEMKDVVEKVEVLDGEGNILILSNEEMNFSYRYSI 177

Query: 184 IT-KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
           I  KD I+    L         I + +  +   R   QP++  + GSTFK P G+ A +L
Sbjct: 178 IHEKDWIVLRAWLSLAKGKYEEIKSKMEELNAKRREKQPLEYPSAGSTFKRPPGYYAGKL 237

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IE++G +G   GGAK+SE H  F+IN  NAT YD+  L E ++K V  + G+ L  EIK 
Sbjct: 238 IEEAGLKGYSIGGAKVSEKHSGFIINTGNATFYDVLNLIEHIQKVVKEKFGVELVPEIKI 297

Query: 303 LGD 305
           +G+
Sbjct: 298 IGE 300


>gi|167037085|ref|YP_001664663.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|167039821|ref|YP_001662806.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           sp. X514]
 gi|300915395|ref|ZP_07132709.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           sp. X561]
 gi|307724855|ref|YP_003904606.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           sp. X513]
 gi|320115500|ref|YP_004185659.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
 gi|166854061|gb|ABY92470.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           sp. X514]
 gi|166855919|gb|ABY94327.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|300888671|gb|EFK83819.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           sp. X561]
 gi|307581916|gb|ADN55315.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           sp. X513]
 gi|319928591|gb|ADV79276.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           brockii subsp. finnii Ako-1]
          Length = 301

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 115/307 (37%), Positives = 170/307 (55%), Gaps = 9/307 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP- 59
           MI   I   L++  ++  GK   N P+K+ T F+ GG A+V+  P +  +L   + LL  
Sbjct: 1   MI--EIVDKLKDILRE--GKLYLNEPMKRHTSFKIGGPADVLVVPNNRKELLEVIFLLKG 56

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +IP  I+G G+N+LV + GIRGVV++LS+     +       +I  A      +AN AL
Sbjct: 57  ENIPFFILGNGTNLLVSEKGIRGVVIKLSSLRNVMV---EGNSIIAEAGAPLSYIANVAL 113

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            H + GF F  GIPG++GGA  MNAGA   E    V +V  +D KGN  ++  E++ + Y
Sbjct: 114 VHELAGFEFASGIPGTLGGAIVMNAGAYGPEMKDVVEKVEVLDEKGNILILSNEEMNFSY 173

Query: 180 RSSEIT-KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S I  KD I+    L         I + +  +   R+  QP++  + GSTFK P G+ 
Sbjct: 174 RHSIIQEKDWIVLRAWLSLTKGKYEEIKSKMEELNAKRKEKQPLEYPSAGSTFKRPPGYY 233

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LIE++G +G   GGAK+SE H  F+IN  NAT YD+  L E ++K V  + G+ L  
Sbjct: 234 AGKLIEEAGLKGYSIGGAKVSEKHSGFIINTGNATFYDVLNLIEHIQKVVKEKFGVELVP 293

Query: 299 EIKRLGD 305
           EIK +G+
Sbjct: 294 EIKIVGE 300


>gi|188582369|ref|YP_001925814.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacterium
           populi BJ001]
 gi|254764213|sp|B1ZGP6|MURB_METPB RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|179345867|gb|ACB81279.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacterium
           populi BJ001]
          Length = 309

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 138/304 (45%), Positives = 180/304 (59%), Gaps = 1/304 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    +   +R     LRG+  EN  L  +TWFR GG A+V+F P D  DL  FL  L  
Sbjct: 1   MTAHSLIDDIRAAAPDLRGRLLENQSLSDLTWFRVGGPAQVLFSPADEEDLAAFLAALDP 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
            +P+T++GLGSN++VRD GI GV +RL    F ++E+         A      LA +A  
Sbjct: 61  SVPVTVIGLGSNLIVRDGGIPGVTIRLGGKAFGSVEIDGETIRAGTA-VPDMRLAKAAAE 119

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             + G  FF GIPGS+GGA  MNAGA+  ET+  + E  GIDR G        ++ ++YR
Sbjct: 120 ASLDGLAFFRGIPGSVGGALRMNAGAHGGETTDVLTEARGIDRNGAVRSFTHAEMGFRYR 179

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
            S    D+I T    RG P  +  I A +  V   RE  QPI+E+TGGSTFKNP G  AW
Sbjct: 180 HSSAPDDVIFTSATFRGRPGDREGIEAEMERVTAAREAAQPIRERTGGSTFKNPKGGKAW 239

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           QLI+ +GCRGL  GGA++SE+HCNF+IN   AT  D+E LGE+VR++V   SG  L WEI
Sbjct: 240 QLIDAAGCRGLIRGGAQVSEMHCNFLINRGGATAADIEGLGEEVRRRVREHSGFELHWEI 299

Query: 301 KRLG 304
           KR+G
Sbjct: 300 KRIG 303


>gi|254500893|ref|ZP_05113044.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Labrenzia alexandrii
           DFL-11]
 gi|222436964|gb|EEE43643.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Labrenzia alexandrii
           DFL-11]
          Length = 319

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 158/313 (50%), Positives = 207/313 (66%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  +   + +    +RGK   N PL  +TWFRTGG A++MFQP D  DL  FL  LP 
Sbjct: 1   MSFPDLLEEVPDLSDGIRGKLTPNQPLSAVTWFRTGGPAQLMFQPADEDDLAVFLKKLPK 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           DIP+  VGLGSN+L+RD G++GVV+RLS  GF  IE   +  +  GA    K LA +A +
Sbjct: 61  DIPVLSVGLGSNLLIRDGGLKGVVVRLSAKGFGQIEELGNNRLRAGAAVPDKRLAEAAAK 120

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
            G+GGF F+ GIPG +GGA  MNAGA+  ET   ++E+  IDR GN+HV+    ++Y+YR
Sbjct: 121 AGLGGFAFYTGIPGGLGGALRMNAGAHGTETRDRMIELTAIDRDGNRHVLTNSDMEYRYR 180

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
            S  + DLI T  V  G P+ +  I   +A V  HRE  QPI+EKTGGSTFKNP G+SAW
Sbjct: 181 HSGASSDLIFTTAVFEGVPQDEMTIREEMAAVVEHRENAQPIREKTGGSTFKNPDGNSAW 240

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           ++++ +GCRGL  GGA++SE+HCNFMIN   ATG+DLE LGE VR K    +GI LEWEI
Sbjct: 241 KVVDAAGCRGLMVGGAQMSEMHCNFMINTGGATGHDLELLGETVRAKALEVTGIRLEWEI 300

Query: 301 KRLGDFFDHQIVD 313
           KRLG+F     ++
Sbjct: 301 KRLGEFGPKGAIE 313


>gi|256752809|ref|ZP_05493652.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           ethanolicus CCSD1]
 gi|256748313|gb|EEU61374.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermoanaerobacter
           ethanolicus CCSD1]
          Length = 301

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 115/307 (37%), Positives = 170/307 (55%), Gaps = 9/307 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP- 59
           MI   I   L++  ++  GK   N P+K+ T F+ GG A+V+  P +  +L   + LL  
Sbjct: 1   MI--EIVDKLKDILRE--GKLYLNEPMKRHTSFKIGGPADVLVVPNNRKELLEVIFLLKG 56

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +IP  I+G G+N+LV + GIRGVV++LS+     +       +I  A      +AN AL
Sbjct: 57  ENIPFFILGNGTNLLVSEKGIRGVVIKLSSLRNVIV---EGNRIIAEAGAPLSYIANVAL 113

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            H + GF F  GIPG++GGA  MNAGA   E    V +V  +D KGN  ++  E++ + Y
Sbjct: 114 VHELAGFEFASGIPGTLGGAIVMNAGAYGPEMKDVVEKVEVLDEKGNILILSNEEMNFSY 173

Query: 180 RSSEIT-KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S I  KD I+    L         I + +  +   R+  QP++  + GSTFK P G+ 
Sbjct: 174 RHSIIQEKDWIVLRAWLSLTKGKYEEIKSKMEELNAKRKEKQPLEYPSAGSTFKRPPGYY 233

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LIE++G +G   GGAK+SE H  F+IN  NAT YD+  L E ++K V  + G+ L  
Sbjct: 234 AGKLIEEAGLKGYSIGGAKVSEKHSGFIINTGNATFYDVLNLIEHIQKVVKEKFGVELVP 293

Query: 299 EIKRLGD 305
           EIK +G+
Sbjct: 294 EIKIVGE 300


>gi|254479442|ref|ZP_05092771.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Carboxydibrachium
           pacificum DSM 12653]
 gi|214034627|gb|EEB75372.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Carboxydibrachium
           pacificum DSM 12653]
          Length = 294

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 108/302 (35%), Positives = 163/302 (53%), Gaps = 11/302 (3%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPI 64
           +  +L+E      GK   N P+K+ T F+ GG A+V+  P    +L   +  L    IP 
Sbjct: 1   MKEILKE------GKLYLNEPMKRHTSFKIGGPADVLAVPGSRDELINLIAYLRQEKIPF 54

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            I+G G+N+LV + GIRGVV++LS+     +      ++I  A  S   +AN AL H + 
Sbjct: 55  FILGNGTNLLVSEKGIRGVVVKLSSLRNVIV---EGTKIIAEAGASLSYIANVALVHELT 111

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           GF F  GIPG++GGA  MNAGA   E    V +V  +D   N  ++  +++K+ YR S +
Sbjct: 112 GFEFASGIPGTLGGAIVMNAGAYGSEMKDVVEKVEVLDENNNILILSNQEMKFSYRYSIL 171

Query: 185 T-KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
             K+ I+    +     +   I   +  +   R+  QP+   + GSTFK P G+ A +LI
Sbjct: 172 QEKEWIVLRAWISLERGNYEEIKKKMEELNQRRKEKQPLDYPSAGSTFKRPPGYYAGKLI 231

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           E +G +G   GGAK+SE H  F+IN  NAT YD+  L E ++K V  + G+ L  EIK +
Sbjct: 232 EDAGLKGYSIGGAKVSEKHSGFIINTGNATFYDVLNLIEYIQKVVKEKFGVELMPEIKIV 291

Query: 304 GD 305
           G+
Sbjct: 292 GE 293


>gi|312114842|ref|YP_004012438.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311219971|gb|ADP71339.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 315

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 140/303 (46%), Positives = 189/303 (62%), Gaps = 1/303 (0%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD 61
           ++  I+  L     +LRGK   N  + ++TW R GG A+V+F+P D  DL YFL   P+D
Sbjct: 1   MFQDIAAALLADAPELRGKLLPNASMSELTWLRVGGPAQVLFKPADEEDLAYFLARCPAD 60

Query: 62  IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRH 121
           IP+  VG+GSN+LVRD G+ GVV+RL     ++IE  +   + VGA      LA +A + 
Sbjct: 61  IPVMAVGVGSNLLVRDGGVPGVVIRLGRGF-NDIEPLDGARIRVGAAVPDVRLAQAAAQA 119

Query: 122 GIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS 181
           GI    F+ GIPG++GGA  MNAGA+  ET   +V+   +DR G  HV     + + YR 
Sbjct: 120 GIAKLAFYRGIPGTVGGALRMNAGAHGGETKDVLVQARAVDRSGAVHVYDNAGMGFTYRH 179

Query: 182 SEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
             +  D I T  V  G P     I   +  V  +RE  QPIK +TGGSTFKNP G SAW+
Sbjct: 180 CGVPDDQIFTRAVFEGVPGDPAEIEREMQGVAEYREANQPIKSRTGGSTFKNPPGKSAWR 239

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           LI+++GCRG   GGA +SE+HCNF+IN  NAT  D+E LGE VRK+VF ++GI+L+WEIK
Sbjct: 240 LIDEAGCRGFRVGGAHMSEMHCNFLINDQNATATDIETLGETVRKRVFEKTGIMLDWEIK 299

Query: 302 RLG 304
           R+G
Sbjct: 300 RIG 302


>gi|218531122|ref|YP_002421938.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacterium
           chloromethanicum CM4]
 gi|254764209|sp|B7KSC5|MURB_METC4 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|218523425|gb|ACK84010.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacterium
           chloromethanicum CM4]
          Length = 309

 Score =  238 bits (608), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 142/304 (46%), Positives = 184/304 (60%), Gaps = 1/304 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    +   +R     LRG+  EN  L  +TWFR GG A+V+F P D  DL  FL  L  
Sbjct: 1   MTAHSLIDAIRAAAPDLRGRLLENQSLADLTWFRVGGPAQVLFSPADEADLSAFLAALDP 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
            +P+T++GLGSN++VRD GI GV +RL    F ++E+         A      LA +A  
Sbjct: 61  SVPVTVIGLGSNLIVRDGGIPGVTIRLGGKAFGSVEIDGETIRSGTA-VPDMRLAKAAAE 119

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             + G  FF GIPGS+GGA  MNAGA+  ET+  +VEV GIDRKG  H     ++ ++YR
Sbjct: 120 ASLDGLAFFRGIPGSVGGALRMNAGAHGGETTDVLVEVRGIDRKGEVHRFTHAEMGFRYR 179

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
            S    D+I T    RG P  +  I A +  V   RE  QPI+E+TGGSTFKNP G  AW
Sbjct: 180 HSSAPDDVIFTGATFRGRPGDREAIEAEMERVTAAREAAQPIRERTGGSTFKNPEGGKAW 239

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           QLI+ +GCRGL  GGA++SE+HCNF+IN   AT  D+E LGE+VR++V   SG  L WEI
Sbjct: 240 QLIDAAGCRGLIRGGAQVSEMHCNFLINRGGATAADIEGLGEEVRRRVREHSGFELHWEI 299

Query: 301 KRLG 304
           KR+G
Sbjct: 300 KRIG 303


>gi|170748772|ref|YP_001755032.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacterium
           radiotolerans JCM 2831]
 gi|170655294|gb|ACB24349.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacterium
           radiotolerans JCM 2831]
          Length = 308

 Score =  238 bits (608), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 137/303 (45%), Positives = 185/303 (61%), Gaps = 1/303 (0%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD 61
           +   +   +R     LRG+   + PL  +TWFR GG AEV+F P D  DL   L  L  D
Sbjct: 1   MTASLHDRIRAAAPDLRGRLLADQPLADLTWFRVGGPAEVLFTPADEEDLARLLASLDPD 60

Query: 62  IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRH 121
           +P+T++GLGSN++VRD G+ GVV+RL    F +I +      +  A      LA +A   
Sbjct: 61  VPVTVIGLGSNLIVRDGGVPGVVVRLGGKAFGSIAIDGDALTVGTA-VPDMRLAKAAAEA 119

Query: 122 GIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS 181
           G+ G  F+ GIPGSIGGA  MNAGA+  ET+  +VE  GIDR G         + + YR 
Sbjct: 120 GLDGLAFYRGIPGSIGGALRMNAGAHGGETTDVLVEARGIDRGGALRTFSHADMGFSYRH 179

Query: 182 SEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
           S+  +D+I T  V RG    +  I A +  V   RE  QPI+E+TGGSTF NP G  AWQ
Sbjct: 180 SDAPEDVIFTRAVFRGRTGDRGAIEAEMERVTAAREAAQPIRERTGGSTFANPDGGKAWQ 239

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           LI+ +GCRGL  GGA++SE+HCNF+IN  +AT  D+E LGE+VR++V + SG+ L WEI+
Sbjct: 240 LIDAAGCRGLRRGGAQVSEMHCNFLINTGDATAADIEGLGEEVRRRVRDTSGVELRWEIR 299

Query: 302 RLG 304
           R+G
Sbjct: 300 RIG 302


>gi|254562110|ref|YP_003069205.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacterium
           extorquens DM4]
 gi|254269388|emb|CAX25354.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacterium
           extorquens DM4]
          Length = 309

 Score =  238 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 141/304 (46%), Positives = 183/304 (60%), Gaps = 1/304 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    +   +R     LRG+  EN  L  +TWFR GG A+V+F P D  DL  FL  L  
Sbjct: 1   MTAHSLIDAIRAAAPDLRGRLLENQSLADLTWFRVGGPAQVLFSPADEADLSAFLAALDP 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
            +P+T++GLGSN++VRD GI GV +RL    F ++E+         A      LA +A  
Sbjct: 61  AVPVTVIGLGSNLIVRDGGIPGVTIRLGGKAFGSVEIDGETIRSGTA-VPDMRLAKAAAE 119

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             + G  FF GIPGS+GGA  MNAGA+  ET+  +VEV GIDRKG        ++ ++YR
Sbjct: 120 ASLDGLAFFRGIPGSVGGALRMNAGAHGGETTDVLVEVRGIDRKGEVRRFTHAEMGFRYR 179

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
            S    D+I T    RG P  +  I A +  V   RE  QPI+E+TGGSTFKNP G  AW
Sbjct: 180 HSSAPDDVIFTGATFRGRPGDREAIEAEMDRVTAAREAAQPIRERTGGSTFKNPEGGKAW 239

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           QLI+ +GCRGL  GGA++SE+HCNF+IN   AT  D+E LGE+VR++V   SG  L WEI
Sbjct: 240 QLIDAAGCRGLIRGGAQVSEMHCNFLINRGGATAADIEGLGEEVRRRVREHSGFELHWEI 299

Query: 301 KRLG 304
           KR+G
Sbjct: 300 KRIG 303


>gi|91977858|ref|YP_570517.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodopseudomonas
           palustris BisB5]
 gi|123735247|sp|Q133X3|MURB_RHOPS RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|91684314|gb|ABE40616.1| UDP-N-acetylmuramate dehydrogenase [Rhodopseudomonas palustris
           BisB5]
          Length = 310

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 141/304 (46%), Positives = 195/304 (64%), Gaps = 1/304 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  I+  L+     LRG+   N PL  +TWFR GG A+ +F P D  DL YFL+ LP+
Sbjct: 1   MSFPDITPDLKAAMPSLRGRLLGNEPLAPLTWFRVGGPAQALFTPADEDDLGYFLSRLPT 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           ++P+  +G+GSN++VRD G+ GVV+RL+  GF +        +  GA    K +A +A  
Sbjct: 61  EVPMLCIGVGSNLIVRDGGLPGVVIRLAPRGFGDTRADGE-IVYAGAAALDKRVAETAAA 119

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             +GG  F++GIPG++GGA  MNAGAN  ET   +++    DR GN+ V+    +++ YR
Sbjct: 120 AKLGGLEFYFGIPGTVGGALRMNAGANGRETKDALIDATAFDRSGNRRVLGNADMQFSYR 179

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
            S     LI T    RG P S + I A +  V  HRE  QP++EKTGGSTFKNP  +SAW
Sbjct: 180 HSGADPALIFTSARFRGTPASPDAIRAKMNEVQAHRELAQPVREKTGGSTFKNPPDNSAW 239

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LI+ +GCRGL  GGA++SE+HCNF+IN  +AT  D+E LGE VR++V  QSGI L+WEI
Sbjct: 240 KLIDAAGCRGLRVGGAQVSEMHCNFLINTSDATAADIETLGETVRERVKAQSGIELQWEI 299

Query: 301 KRLG 304
           KR+G
Sbjct: 300 KRIG 303


>gi|90424795|ref|YP_533165.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodopseudomonas
           palustris BisB18]
 gi|122475815|sp|Q211U0|MURB_RHOPB RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|90106809|gb|ABD88846.1| UDP-N-acetylmuramate dehydrogenase [Rhodopseudomonas palustris
           BisB18]
          Length = 308

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 144/306 (47%), Positives = 188/306 (61%), Gaps = 1/306 (0%)

Query: 3   YGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDI 62
           +  +   L+    QLRG+   N PL  +TWFR GG A+V+F P D  DL YFL  LP DI
Sbjct: 4   FPDLVPELKAAMPQLRGRLLGNEPLAPLTWFRVGGPAQVLFTPADADDLGYFLAALPRDI 63

Query: 63  PITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHG 122
            +T+VG+GSN++VRD G+ GVV+RL   GF              A    K +A +A   G
Sbjct: 64  DVTVVGVGSNLIVRDGGLPGVVIRLGGRGFGETGTDGDVVSAGSAAL-DKRVAEAAAAAG 122

Query: 123 IGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS 182
           +GG  F++GIPG+IGGA  MNAGAN  ET   +++   I R G  H +   ++ + YR S
Sbjct: 123 LGGLEFYHGIPGTIGGALRMNAGANGRETKDVLIDASAIARDGTLHRLSNAEMGFSYRHS 182

Query: 183 EITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
                LI T    RG P  +  I A +  V  HRET QP++EKTGGSTFKNP GHSAW+L
Sbjct: 183 GADPALIFTSARFRGEPMDRAAIRARMDEVQRHRETAQPVREKTGGSTFKNPPGHSAWKL 242

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           I+ +GCRGL  GGA++SE+HCNF+IN  +AT  D+E LG+ VR +V    GI L+WEIKR
Sbjct: 243 IDAAGCRGLRVGGAQVSEMHCNFLINTGSATAQDIETLGDTVRARVKEHCGIELQWEIKR 302

Query: 303 LGDFFD 308
           +G   D
Sbjct: 303 IGRALD 308


>gi|240139698|ref|YP_002964175.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacterium
           extorquens AM1]
 gi|240009672|gb|ACS40898.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacterium
           extorquens AM1]
          Length = 309

 Score =  237 bits (604), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 141/304 (46%), Positives = 184/304 (60%), Gaps = 1/304 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    +   +R     LRG+  EN  L  +TWFR GG A+V+F P D  DL  FL  L  
Sbjct: 1   MTEHSLIDAIRAAAPDLRGRLLENQSLADLTWFRVGGPAQVLFSPADEADLSAFLAALDP 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
            +P+T++GLGSN++VRD GI GV +RL    F ++E+         A      LA +A  
Sbjct: 61  AVPVTVIGLGSNLIVRDGGIPGVTIRLGGKAFGSVEIDGETIRSGTA-VPDMRLAKAAAE 119

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             + G  FF GIPGS+GGA  MNAGA+  ET+  +VEV GIDRKG        ++ ++YR
Sbjct: 120 ASLDGLAFFRGIPGSVGGALRMNAGAHGGETTDVLVEVRGIDRKGEVRRFSHAEMGFRYR 179

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
            S    D+I T    RG P ++  I A +  V   RE  QPI+E+TGGSTFKNP G  AW
Sbjct: 180 HSSAPDDVIFTGATFRGRPGNREAIEAEMDRVTAAREAAQPIRERTGGSTFKNPEGGKAW 239

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           QLI+ +GCRGL  GGA++SE+HCNF+IN   AT  D+E LGE+VR++V   SG  L WEI
Sbjct: 240 QLIDAAGCRGLIRGGAQVSEMHCNFLINRGGATAADIEGLGEEVRRRVREHSGFELHWEI 299

Query: 301 KRLG 304
           KR+G
Sbjct: 300 KRIG 303


>gi|220933951|ref|YP_002512850.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219995261|gb|ACL71863.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 303

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 107/311 (34%), Positives = 163/311 (52%), Gaps = 8/311 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M+         E  + LRG+ + + PL + T +R GG A+ +++P D+ DL +FL+ LP 
Sbjct: 1   MMTA-------ENLQMLRGELRHHEPLARYTSWRVGGTADQLYKPADLDDLAFFLSTLPP 53

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
             P+  +GLGSN+LVRD G+RG V+ LS A  + + +     +   A  +   LA  A  
Sbjct: 54  KEPLLWLGLGSNLLVRDGGVRGTVIALSGAL-NEMTLLPDNRIRAEAGVACAKLARFAAD 112

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             + G  F  GIPG++GGA  MNAGA   ET   V  V  +DR+G +H+   ++ +  YR
Sbjct: 113 ANLTGCEFLAGIPGTLGGALAMNAGAWGGETWTCVETVETLDRRGRRHLREADEYQVAYR 172

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
           S     +   T    R  P       A I  +   R   QP    + GS F+NP G  A 
Sbjct: 173 SVITPVEEWFTAATFRLTPGDGQAGKARIRELLAERAERQPTGVASCGSVFRNPPGDHAG 232

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +L+E +G +G   GGA++SE H NF++N  +AT  DLE L   V+  V  + G+ LE E+
Sbjct: 233 RLVEAAGLKGHRIGGAQVSEKHANFILNTGDATAADLEALIHHVQATVEARFGVHLEPEV 292

Query: 301 KRLGDFFDHQI 311
           + +G+  + + 
Sbjct: 293 RMVGEPLEGRA 303


>gi|23014454|ref|ZP_00054269.1| COG0812: UDP-N-acetylmuramate dehydrogenase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 305

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 127/304 (41%), Positives = 182/304 (59%), Gaps = 2/304 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M+  R     R+   +++G+   + P+   TWFR GGNAE MF+P D+ DL   L +LP+
Sbjct: 1   MMTARKYSDWRDALPEVQGRMSFDAPMAPFTWFRVGGNAEAMFRPADLDDLIAVLEVLPA 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           D+P+T+VG+GSN+LVRD G+ G+V+RL+    +         +  GA     ++A  A  
Sbjct: 61  DVPVTVVGVGSNLLVRDGGVPGMVIRLAGPFATI--DVAGDIITAGAGALDLTVARVAEE 118

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
            G+ G  F  G+PG+IGG   MNAGA   E     V    +DR GN H++  E+L + YR
Sbjct: 119 AGLAGLEFLSGVPGTIGGGLRMNAGAFGTEMKDVTVSAQALDRAGNLHILGPEELGFTYR 178

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
            S + +  I     L+G       I   +A +   RE  QP+K +TGGSTF NP G SAW
Sbjct: 179 RSAVPEGWIFLSASLQGRAGKPAEIGQRMAEIAKAREDSQPVKVRTGGSTFANPEGMSAW 238

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LI+ +GCRGL  GGA++SE HCNF++N  +AT  D+E LGE+VR++V   SG+ L WEI
Sbjct: 239 KLIDAAGCRGLVMGGAQVSEKHCNFLLNTGDATAADIEDLGEEVRRRVLETSGVDLHWEI 298

Query: 301 KRLG 304
           +R+G
Sbjct: 299 RRIG 302


>gi|163852362|ref|YP_001640405.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacterium
           extorquens PA1]
 gi|254764210|sp|A9VWV7|MURB_METEP RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|163663967|gb|ABY31334.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacterium
           extorquens PA1]
          Length = 309

 Score =  236 bits (603), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 141/304 (46%), Positives = 185/304 (60%), Gaps = 1/304 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    +   +R     LRG+  EN  L  +TWFR GG A+V+F P D  DL  FL  L  
Sbjct: 1   MTAHSLIDAIRAAAPDLRGRLLENQSLADLTWFRVGGPAQVLFSPADEADLSAFLAALDP 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
            +P+T++GLGSN++VRD GI GV +RL    F ++E+         A      LA +A  
Sbjct: 61  AVPVTVIGLGSNLIVRDGGIPGVAIRLGGKAFGSVEIDGETIRSGTA-VPDMRLAKAAAE 119

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             + G  FF GIPGS+GGA  MNAGA+  ET+  +VEV GIDRKG        ++ ++YR
Sbjct: 120 ASLDGLAFFRGIPGSVGGALRMNAGAHGGETTDVLVEVRGIDRKGEVRRFTHAEMGFRYR 179

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
            S    D+I T    RG P ++  I A +  V   RE  QPI+E+TGGSTFKNP G  AW
Sbjct: 180 HSSAPDDVIFTGATFRGRPGNREAIEAEMERVTAAREAAQPIRERTGGSTFKNPEGGKAW 239

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           QLI+ +GCRGL  GGA++SE+HCNF+IN   AT  D+E LGE+VR++V + SG  L WEI
Sbjct: 240 QLIDAAGCRGLIRGGAQVSEMHCNFLINRGGATAADIEGLGEEVRRRVRDHSGFELHWEI 299

Query: 301 KRLG 304
           KR+G
Sbjct: 300 KRIG 303


>gi|118590890|ref|ZP_01548290.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Stappia aggregata
           IAM 12614]
 gi|118436412|gb|EAV43053.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Stappia aggregata
           IAM 12614]
          Length = 323

 Score =  236 bits (601), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 160/313 (51%), Positives = 205/313 (65%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  +     E  + +RGK   N  L  +TWFRTGG A++MFQP D  DL  FL  LP 
Sbjct: 1   MAFADLLEQYPELAEGIRGKLTANQALSAVTWFRTGGPAQLMFQPADEDDLAAFLKKLPR 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           D+P+  VGLGSN+L+RD G++GVV+RLS  GF  IE      +  G     K LA +A +
Sbjct: 61  DVPVLPVGLGSNLLIRDGGLKGVVVRLSAKGFGAIEDIGGNRLKAGTAVPDKRLAEAAAK 120

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
            G+GGF F+ GIPG +GGA  MNAGA+  ET + +VE+  IDR GN+HV+    + Y YR
Sbjct: 121 AGLGGFAFYTGIPGGLGGALRMNAGAHGTETRERMVELTAIDRDGNRHVLANADMGYAYR 180

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
            S+ +KDLI T  V  G P+ +  I   +A+V  HRE  QPI+EKTGGSTFKNP G SAW
Sbjct: 181 HSDASKDLIFTSAVFEGVPQDEASIRQEMADVVAHRERAQPIREKTGGSTFKNPPGTSAW 240

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           + ++ +GCRGL  GGA++SELHCNFMIN   A+G+DLE LGE VR +V   SGI LEWEI
Sbjct: 241 KEVDAAGCRGLTIGGAQMSELHCNFMINTGTASGHDLELLGETVRSRVLAHSGIRLEWEI 300

Query: 301 KRLGDFFDHQIVD 313
           KRLG+F     V+
Sbjct: 301 KRLGEFGAEGAVE 313


>gi|83312949|ref|YP_423213.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Magnetospirillum
           magneticum AMB-1]
 gi|123540759|sp|Q2W0H1|MURB_MAGMM RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|82947790|dbj|BAE52654.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Magnetospirillum
           magneticum AMB-1]
          Length = 307

 Score =  235 bits (600), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 128/303 (42%), Positives = 183/303 (60%), Gaps = 2/303 (0%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD 61
           +  R     R+   +++G+   + P+   TWFR GGNAE +F+P D+ DL   L +LP  
Sbjct: 1   MTARKDSDWRDMLPRVQGRMSFDAPMAPFTWFRVGGNAEALFRPADLDDLIAVLEVLPPQ 60

Query: 62  IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRH 121
           +P+T+VG+GSN+LVRD G+ G+V+RL+    +         +  GA     ++A +A   
Sbjct: 61  VPVTVVGVGSNLLVRDGGVPGMVIRLAGPFATI--DVMGDTITAGAGALDLTVARTAEEA 118

Query: 122 GIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS 181
           G+ G  F  G+PG+IGGA  MNAGA   E     V    +DR GN  ++  E+L + YR 
Sbjct: 119 GLAGLEFLSGVPGTIGGALRMNAGAFGAEMKDVTVSAQALDRAGNLQILGPEELGFSYRR 178

Query: 182 SEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
           S + +  I     L+G P     I A +A +   RE  QP+K +TGGSTF NP GHSAW+
Sbjct: 179 SAVPEGWIFLSASLKGRPGKPADIGARMAEIARVREESQPVKVRTGGSTFANPEGHSAWK 238

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           LI+ +GCRGL  GGA++SE HCNF++N  +AT  D+E LGE+VR++V   SGI L WEI+
Sbjct: 239 LIDAAGCRGLVMGGAQVSEKHCNFLLNTGDATAADIEDLGEEVRRRVLETSGIDLHWEIR 298

Query: 302 RLG 304
           R+G
Sbjct: 299 RIG 301


>gi|257063611|ref|YP_003143283.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Slackia
           heliotrinireducens DSM 20476]
 gi|256791264|gb|ACV21934.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Slackia
           heliotrinireducens DSM 20476]
          Length = 303

 Score =  235 bits (599), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 98/299 (32%), Positives = 138/299 (46%), Gaps = 1/299 (0%)

Query: 7   SRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPIT 65
              +R  G+   G+  EN PL + T +R GG A +  + + +H L  F        IP  
Sbjct: 3   RNAIRLMGEDFEGEVLENEPLSRHTTYRIGGPARLYARVESLHALIAFSEYCVEQGIPWF 62

Query: 66  IVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGG 125
           ++G GSN+LV DAG  G V+ L     S            GA C    + + A   G  G
Sbjct: 63  VLGRGSNLLVSDAGFPGAVIVLGQGFSSCSYDDAAHVFTAGASCPLSRVVHMAYERGRAG 122

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT 185
             F  G PGS+GGA  MNAG+ +      V+ V                +++ YR S + 
Sbjct: 123 MEFAVGTPGSVGGALRMNAGSRHEYIGSRVLSVTSYRPGEGLVRHRAADIEWGYRESTLP 182

Query: 186 KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEK 245
            D I+    L  F     +I A + N    R   QP+   + GS FKNP G S  +LIE 
Sbjct: 183 NDEIMLECELSSFDGDPEMIRARMDNAMSLRRKTQPLAAPSCGSVFKNPKGDSVGRLIEN 242

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            G +G   GGA+IS+LH NF++N  +A   D+  L  +V+  V    GI LE E++ LG
Sbjct: 243 VGLKGARCGGAQISDLHANFIVNCGDARADDVLTLMHRVQDAVAEAYGIELEPEVRFLG 301


>gi|86358448|ref|YP_470340.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobium etli CFN
           42]
 gi|123511378|sp|Q2K6C3|MURB_RHIEC RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|37544105|gb|AAQ93038.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobium etli]
 gi|86282550|gb|ABC91613.1| UDP-N-acetylenolpyruvoylglucosamine reductase protein [Rhizobium
           etli CFN 42]
          Length = 324

 Score =  235 bits (599), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 173/309 (55%), Positives = 225/309 (72%)

Query: 4   GRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIP 63
            ++   L +  K +RG+   + P+ ++TWFR GG AE+MFQP DI DL  FL +LP ++P
Sbjct: 7   EKLLASLGDGVKDIRGRITPDAPMDRVTWFRAGGLAELMFQPHDIDDLIAFLKILPEEVP 66

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           +T++G+GSNILVRD GI GVVLRLS  GF  +E+     ++ GA C  K +A  A+ +GI
Sbjct: 67  LTVIGVGSNILVRDGGIPGVVLRLSAKGFGFVELAGENRILAGAICPDKHVAAMAMDNGI 126

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
           GG HF+YGIPG+IGGAA MNAGAN  ET + ++EV+ +DRKGN+HV+   ++ Y YR S 
Sbjct: 127 GGLHFYYGIPGAIGGAARMNAGANGVETRERLIEVNAVDRKGNKHVLSNAEMGYSYRHSA 186

Query: 184 ITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
              DLI T V+  G+PE +  I A +  V +HRETVQP++EKTGGSTFKNP GHSAW+LI
Sbjct: 187 APTDLIFTSVLFEGYPEDRAQIRAEMDAVRNHRETVQPVREKTGGSTFKNPPGHSAWKLI 246

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           +++GCRGL  GGA++S LHCNFMIN   ATGYDLEYLGEQVR++VF + GI LEWEIKRL
Sbjct: 247 DEAGCRGLVIGGAQMSSLHCNFMINMGQATGYDLEYLGEQVRREVFEKEGIKLEWEIKRL 306

Query: 304 GDFFDHQIV 312
           G F   + V
Sbjct: 307 GVFMPGREV 315


>gi|325293463|ref|YP_004279327.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Agrobacterium sp.
           H13-3]
 gi|325061316|gb|ADY65007.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Agrobacterium sp.
           H13-3]
          Length = 321

 Score =  235 bits (599), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 175/309 (56%), Positives = 223/309 (72%)

Query: 5   RISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPI 64
           ++   L +  K+LRG+   + P+ ++TWFR GG AEVMFQP D  DL  FL +LP D+P+
Sbjct: 8   KLLGRLGDGVKELRGRLTPDAPMDRVTWFRAGGLAEVMFQPHDTDDLVTFLKILPEDVPL 67

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T+VG+GSN+LVRD GI GVV+RLS  GF ++E+     +  GA C  K +A  A+ +GIG
Sbjct: 68  TVVGVGSNLLVRDGGIPGVVVRLSAKGFGSVELSGENRIKAGAICPDKHIAAMAMDNGIG 127

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           GFHF+YGIPGSIGGA  MNAGAN  ET + VVEV+ +DR+GNQHV+    + Y YR S  
Sbjct: 128 GFHFYYGIPGSIGGALRMNAGANGGETRERVVEVYAVDRQGNQHVLSNADMDYSYRHSGA 187

Query: 185 TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIE 244
              LI T  +  G+PE +  I A +  V HHRETVQPI+E+TGGSTFKNP GHSAW+LI+
Sbjct: 188 DAGLIFTGALFEGYPEDRAKIRADMDAVRHHRETVQPIREQTGGSTFKNPEGHSAWELID 247

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           ++G RGL  GGA++S LHCNFMIN  +ATGYDLEYLGE +RK+VF +SGI LEWEIKRLG
Sbjct: 248 EAGGRGLVIGGAQMSSLHCNFMINTGHATGYDLEYLGETIRKRVFEKSGIRLEWEIKRLG 307

Query: 305 DFFDHQIVD 313
            F   + V+
Sbjct: 308 LFMPGREVE 316


>gi|307944892|ref|ZP_07660229.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Roseibium sp.
           TrichSKD4]
 gi|307771816|gb|EFO31040.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Roseibium sp.
           TrichSKD4]
          Length = 323

 Score =  235 bits (599), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 159/313 (50%), Positives = 210/313 (67%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  +  +  +  +  RGK   N PL  ITWFRTGG A+++FQP D  DL  FL+ LP 
Sbjct: 1   MSFPDLLEIHPDLAEATRGKLTSNQPLASITWFRTGGPAQLLFQPADEADLAQFLSKLPK 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           DIP+  VGLGSN+L+RD G+ GVV+RLS  GF  IE   +  +  GA    K LA +A +
Sbjct: 61  DIPVLPVGLGSNLLIRDGGLAGVVVRLSAKGFGAIEELANNRLRAGAAVPDKRLAEAAAK 120

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
            G+GGF F+ GIPG++GGA  MNAGA+  ET + +VE+  +DR G +HV+   ++ Y YR
Sbjct: 121 AGLGGFSFYAGIPGALGGALRMNAGAHGTETRERMVELTALDRDGARHVLTNAEMAYAYR 180

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
            S  +KDLI T  V  G P ++  I   +A+V  HRE  QPI+EKTGGSTFKNP G+SAW
Sbjct: 181 HSGASKDLIFTSAVFEGLPMNEETIRQEMADVQEHREKAQPIREKTGGSTFKNPPGNSAW 240

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           ++++ +GCRGL  GGA++SE+HCNFMIN   ATG+DLE LGE VR +V   SG+ LEWEI
Sbjct: 241 KVVDAAGCRGLMVGGAQMSEMHCNFMINTGTATGHDLELLGETVRARVLKDSGVRLEWEI 300

Query: 301 KRLGDFFDHQIVD 313
           KRLGDF     ++
Sbjct: 301 KRLGDFGPEGPIE 313


>gi|304392254|ref|ZP_07374196.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Ahrensia sp. R2A130]
 gi|303296483|gb|EFL90841.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Ahrensia sp. R2A130]
          Length = 315

 Score =  235 bits (598), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 160/296 (54%), Positives = 207/296 (69%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RG+   + P+ +ITWF+ GG A+++FQP D  DL  FL +LP+D+P+ +VG+GSN+LVR
Sbjct: 15  IRGRLTADAPMSKITWFQVGGPADLLFQPADEDDLSTFLKMLPADVPVMVVGIGSNLLVR 74

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GI GVV+RLS  GF  IE     ++  GA    K +A +AL  G+GGF F++GIPG+I
Sbjct: 75  DGGIDGVVIRLSGKGFGGIECVGDTQLRAGAAAPDKRVAAAALDAGLGGFAFYHGIPGAI 134

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET+  VVEV  IDR+G +H +    + Y YR S   KD+I T  +L 
Sbjct: 135 GGALRMNAGANGTETTNRVVEVSAIDRQGERHTLSHADMGYAYRHSGAAKDIIFTSALLE 194

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G P     I AA+  V HHRETVQPI+EKTGGSTFKNP GHS+W+L++ +G RG   GGA
Sbjct: 195 GEPADAADIRAAMDEVQHHRETVQPIREKTGGSTFKNPDGHSSWKLVDAAGLRGFSIGGA 254

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIV 312
           ++SE+HCNFMIN   ATG+DLE LGE VR++VF  SG+LL WEIKRLG F   + V
Sbjct: 255 QMSEMHCNFMINTGGATGHDLETLGETVRERVFADSGVLLNWEIKRLGRFESGREV 310


>gi|190892581|ref|YP_001979123.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobium etli CIAT
           652]
 gi|218509397|ref|ZP_03507275.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobium etli
           Brasil 5]
 gi|254765528|sp|B3PTV8|MURB_RHIE6 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|190697860|gb|ACE91945.1| UDP-N-acetylenolpyruvoylglucosamine reductase protein [Rhizobium
           etli CIAT 652]
 gi|327194620|gb|EGE61470.1| UDP-N-acetylenolpyruvoylglucosamine reductase protein [Rhizobium
           etli CNPAF512]
          Length = 324

 Score =  235 bits (598), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 174/309 (56%), Positives = 227/309 (73%)

Query: 4   GRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIP 63
            ++   L +  K +RG+   + P+ ++TWFR GG AE+MFQP D+ DL  FL +LP ++P
Sbjct: 7   EKLLASLGDGVKDIRGRITPDAPMDRVTWFRAGGLAELMFQPHDVDDLIAFLKILPEEVP 66

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           +T++G+GSNILVRD GI GVVLRLS  GF  +E+     ++ GA C  K +A  A+ +GI
Sbjct: 67  LTVIGVGSNILVRDGGIPGVVLRLSAKGFGFVELAGENRILAGAICPDKHVAAMAMDNGI 126

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
           GGFHF+YGIPG+IGGAA MNAGAN  ET + +VEV+ +DRKGN+HV+   ++ Y YR S 
Sbjct: 127 GGFHFYYGIPGAIGGAARMNAGANGVETRERLVEVNAVDRKGNKHVLSNAEMGYSYRHSA 186

Query: 184 ITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            + DLI T V+  G+PE +  I A +  V +HRETVQP++EKTGGSTFKNP GHSAW+LI
Sbjct: 187 ASADLIFTSVLFEGYPEDRAQIRAEMDAVRNHRETVQPVREKTGGSTFKNPPGHSAWKLI 246

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           +++GCRGL  GGA++S LHCNFMIN   ATGYDLEYLGEQVR++VF + GI LEWEIKRL
Sbjct: 247 DEAGCRGLVIGGAQMSSLHCNFMINMGQATGYDLEYLGEQVRREVFEKDGIKLEWEIKRL 306

Query: 304 GDFFDHQIV 312
           G F   + V
Sbjct: 307 GVFMPGREV 315


>gi|296448762|ref|ZP_06890616.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylosinus
           trichosporium OB3b]
 gi|296253736|gb|EFH00909.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylosinus
           trichosporium OB3b]
          Length = 302

 Score =  235 bits (598), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 139/297 (46%), Positives = 184/297 (61%)

Query: 8   RLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIV 67
             L      LRG+   N PL   TWFR GG A+ +F P D  DL YFL  LP DI +T +
Sbjct: 4   SELSALVPDLRGRLSANEPLAPFTWFRVGGPAQFLFSPADEADLSYFLERLPRDIAVTTI 63

Query: 68  GLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFH 127
           GLGSN+++RD G+ GVV+RL   GF  I++     + VGA      +A +A   GI G  
Sbjct: 64  GLGSNLIIRDGGVAGVVIRLGAKGFGEIKIEAGERLRVGAAVPDVKVARAAADGGIDGLA 123

Query: 128 FFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD 187
           F+ GIPG +GGA  MNAGA+  ET   ++E  G+DR G  HV    ++ + YR SE  +D
Sbjct: 124 FYRGIPGGVGGALRMNAGAHGGETKDALLEARGVDRSGKIHVFSTAEMGFSYRHSEAPED 183

Query: 188 LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSG 247
           +I T  + +G       I A +  +   RE  QPI+EKTGGSTF+NP GH AWQLI+ +G
Sbjct: 184 VIFTEALFQGRKGDPKTILAEMERITQAREASQPIREKTGGSTFQNPPGHKAWQLIDAAG 243

Query: 248 CRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           CRGL  G A++SE+HCNF++N   AT  ++E LGE+VR++V   SGILL WEIKR+G
Sbjct: 244 CRGLTLGDAQVSEMHCNFLVNRGKATAAEIEALGEEVRRRVQAASGILLHWEIKRIG 300


>gi|163760788|ref|ZP_02167868.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Hoeflea
           phototrophica DFL-43]
 gi|162282110|gb|EDQ32401.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Hoeflea
           phototrophica DFL-43]
          Length = 325

 Score =  234 bits (597), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 167/309 (54%), Positives = 214/309 (69%)

Query: 4   GRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIP 63
            ++   L  +   +RG+   N  + ++TWFRTGG AE++FQP D  DL  FLT+LP ++P
Sbjct: 9   EKLLASLSGKLDDVRGRLTPNAEMSKVTWFRTGGPAELLFQPLDEDDLSAFLTVLPEEVP 68

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           +  VG+GSN+LVRD GI GVV+RLS  GF   E  +   ++ GA C  K LA  AL  G+
Sbjct: 69  VLPVGIGSNLLVRDGGIPGVVIRLSAKGFGRAEQVSDTRLMAGAVCPDKHLAALALETGL 128

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
           GGFHF++GIPG+IGGA  MNAGAN  ET + VVEVH +DRKG +HV+    + Y YR S 
Sbjct: 129 GGFHFYHGIPGAIGGALRMNAGANGVETRERVVEVHAVDRKGERHVLSNADMGYAYRHSS 188

Query: 184 ITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
             KDLI T  +  G P  ++ I  A+  V HHRETVQPI+EKTGGSTFKNP GHSAW++I
Sbjct: 189 APKDLIFTRAIFEGAPADKDEIRQAMDAVQHHRETVQPIREKTGGSTFKNPEGHSAWKVI 248

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           +++GCRGL  GGA++S +HCNFMIN  +A+GY+LE LGE VR +V   SG+ LEWEIKRL
Sbjct: 249 DEAGCRGLTVGGAQMSPMHCNFMINTGSASGYELENLGETVRARVLENSGVRLEWEIKRL 308

Query: 304 GDFFDHQIV 312
           G F   Q V
Sbjct: 309 GLFDPEQTV 317


>gi|260589286|ref|ZP_05855199.1| UDP-N-acetylmuramate dehydrogenase [Blautia hansenii DSM 20583]
 gi|331082693|ref|ZP_08331816.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lachnospiraceae
           bacterium 6_1_63FAA]
 gi|260540367|gb|EEX20936.1| UDP-N-acetylmuramate dehydrogenase [Blautia hansenii DSM 20583]
 gi|330400312|gb|EGG79954.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lachnospiraceae
           bacterium 6_1_63FAA]
          Length = 304

 Score =  234 bits (596), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 92/289 (31%), Positives = 145/289 (50%), Gaps = 4/289 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDA 78
             + + P+K+ T FR GG A+    P    +L+  L +   + +   I+G GSN+LV D 
Sbjct: 18  NVRLHEPMKKHTTFRIGGPADYYLCPHSTEELQKILQICRENKLEFFILGNGSNLLVSDK 77

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           G R   + +      +        + V A      +A  AL   + G  F  GIPG++GG
Sbjct: 78  GYR--GVVIQLWKNFSDIETEDNTITVKAGALLSKVAAEALEESLTGMEFASGIPGTMGG 135

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL-RG 197
           A  MNAGA   E    + EV  + R+G    + +E++ + YR+S + +   +      + 
Sbjct: 136 AVMMNAGAYGGEMKDIIREVTVLTREGELLTLSKEEMNFGYRTSVVKEKGYVVISAELQL 195

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
               +  I   +  +   R T QP+   + GSTFK P G+ A +LI  +G RG   GGA+
Sbjct: 196 RKGDREEIRKVMDELKERRVTKQPLDMPSAGSTFKRPEGYFAGKLIMDAGLRGFSVGGAQ 255

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           ISE HC F++N  +AT  D+  L  +V+K+V  + G+ LE E+K LG+F
Sbjct: 256 ISEKHCGFVVNKGDATAADVLGLIGEVQKRVQEKFGVALEPEVKFLGEF 304


>gi|15889376|ref|NP_355057.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Agrobacterium
           tumefaciens str. C58]
 gi|30316075|sp|Q8UDN0|MURB_AGRT5 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|15157226|gb|AAK87842.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Agrobacterium
           tumefaciens str. C58]
          Length = 321

 Score =  234 bits (596), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 173/309 (55%), Positives = 223/309 (72%)

Query: 5   RISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPI 64
           ++   L +   +LRG+   + P+ ++TWFR GG AEVMFQP D  DL  FL +LP D+P+
Sbjct: 8   KLLGRLGDGVNELRGRLTPDAPMDRVTWFRAGGLAEVMFQPHDTDDLIAFLKILPEDVPL 67

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T+VG+GSN+LVRD GI GVV+RLS  GF ++E+ +   +  GA C  K +A  A+ +GIG
Sbjct: 68  TVVGVGSNLLVRDGGIPGVVVRLSAKGFGSVELADENRIKAGAICPDKHIAAMAMDNGIG 127

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           GFHF+YGIPGSIGGA  MNAGAN  ET + VVEV+ +DR+GNQHV+    + Y YR S  
Sbjct: 128 GFHFYYGIPGSIGGALRMNAGANGGETRERVVEVYAVDRQGNQHVLSNADMGYSYRHSGA 187

Query: 185 TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIE 244
              LI T  +  G+PE +  I A +  V HHRETVQPI+E+TGGSTFKNP GHSAW+LI+
Sbjct: 188 DAGLIFTGALFEGYPEDKAKIRADMDAVRHHRETVQPIREQTGGSTFKNPEGHSAWELID 247

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           ++G RGL  GGA++S LHCNFMIN  +ATGYDLEYLGE +R++VF +SGI LEWEIKRLG
Sbjct: 248 EAGGRGLVIGGAQMSSLHCNFMINTGHATGYDLEYLGETIRRRVFEKSGIRLEWEIKRLG 307

Query: 305 DFFDHQIVD 313
            F   + V+
Sbjct: 308 LFMPGREVE 316


>gi|144897249|emb|CAM74113.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 308

 Score =  234 bits (596), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 128/310 (41%), Positives = 180/310 (58%), Gaps = 2/310 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M+     +   +   + RG+   + PL  +TWFR GGNAEV+F+P D+ DL  FL  LP 
Sbjct: 1   MMNAAARKAWIKSLPKTRGRLTVDAPLGGLTWFRVGGNAEVLFRPADVDDLAEFLMQLPL 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           DIP+T++G+GSN+LVRD G+ GVV+RL+ +            +  GA     ++A +A  
Sbjct: 61  DIPVTVIGVGSNLLVRDGGVSGVVVRLAGSFG--HIDVMGDIITAGAAALDMTVALTAEE 118

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
            G+ G  F  G+PG+IGGA  MNAGA   E     +    IDR G   ++    L   YR
Sbjct: 119 AGLTGMEFLSGVPGTIGGALRMNAGAFGGEMKDITLSATAIDRAGTTQLLTLPDLDMSYR 178

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
                 + I     L+G       I+A +A +   RE  QP + +TGGSTF NP G  AW
Sbjct: 179 HCGCPDEYIFLSATLQGKRGQPAAIAAKMAEIKTAREDSQPTRVRTGGSTFANPPGQKAW 238

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LI+K+GCRGL  GGA++SE HCNF++N   A+  D+E LG++VR++V   SGI LEWEI
Sbjct: 239 ELIDKAGCRGLVMGGAQVSEKHCNFLLNLGEASAADIENLGDEVRRRVLETSGIELEWEI 298

Query: 301 KRLGDFFDHQ 310
           +R+GD  +H 
Sbjct: 299 RRIGDKGEHA 308


>gi|161619377|ref|YP_001593264.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella canis ATCC
           23365]
 gi|260566066|ref|ZP_05836536.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella suis bv. 4
           str. 40]
 gi|189028917|sp|A9M688|MURB_BRUC2 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|161336188|gb|ABX62493.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella canis ATCC
           23365]
 gi|260155584|gb|EEW90664.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella suis bv. 4
           str. 40]
          Length = 322

 Score =  234 bits (596), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 162/315 (51%), Positives = 210/315 (66%), Gaps = 2/315 (0%)

Query: 1   MIYG--RISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL 58
           M+     + + L  R   LRG+   +  + +ITWFR GG A+V+FQP D  DL  FL  +
Sbjct: 1   MMESGEALLKKLDGRLSGLRGRLTPDTGMDKITWFRAGGPAQVLFQPSDEEDLSAFLKAV 60

Query: 59  PSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSA 118
           P +IP+ +VG+GSN+LVRD G+ G V+RLS  GF  +E     ++  GA    K +A +A
Sbjct: 61  PEEIPLLVVGIGSNLLVRDGGVPGFVVRLSAKGFGEVEQVCDTQLRAGAAAPDKRVAAAA 120

Query: 119 LRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQ 178
           L  G+  FHF++GIPG IGGA  MNAGAN  ET + VVEV  +DRKG  HV+    + Y 
Sbjct: 121 LEAGLADFHFYHGIPGGIGGALRMNAGANGVETRERVVEVRALDRKGEVHVLSNADMGYA 180

Query: 179 YRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           YR S  + DLI T V+  G P  ++ I  A+  V HHRETVQP++EKTGGSTFKNP G S
Sbjct: 181 YRHSSASPDLIFTSVLFEGVPGERDDIRRAMDEVQHHRETVQPVREKTGGSTFKNPEGTS 240

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           AW+ I+K+GCRGL  GGA++SE+HCNFMIN  NATG+DLE LGE VR +VF  SGI L W
Sbjct: 241 AWKEIDKAGCRGLRVGGAQMSEMHCNFMINTGNATGHDLETLGETVRARVFENSGIRLHW 300

Query: 299 EIKRLGDFFDHQIVD 313
           EIKRLG F + + ++
Sbjct: 301 EIKRLGLFREGEQIE 315


>gi|317129297|ref|YP_004095579.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           cellulosilyticus DSM 2522]
 gi|315474245|gb|ADU30848.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           cellulosilyticus DSM 2522]
          Length = 301

 Score =  233 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 96/302 (31%), Positives = 161/302 (53%), Gaps = 5/302 (1%)

Query: 7   SRLLRERGKQLR-GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
            +LL+E+ + L+ GK   N PLK+ T ++ GG A +  +P  +  L+  +  +   +IP 
Sbjct: 1   MQLLKEKLEALQVGKILINEPLKKHTTWKIGGPASIFIEPSSVEALQIAIEEIKKQEIPW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G GSN+LV D GI GVV++L          +    + VGA  S   L+    + G  
Sbjct: 61  FVIGRGSNLLVSDEGITGVVIKLGEDLAKF--QQKDDRIKVGAGYSLIKLSTMMSKKGYS 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA +MNAGA+  + S  +++ H +   G    +  +++ + YR+S +
Sbjct: 119 GLEFASGIPGSVGGAVFMNAGAHGSDISNILIKAHVLFSDGTFKWLENKEMDFSYRTSRL 178

Query: 185 TKDL-IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
             D  I      +     +  I+A +     +R   QP      GS F+NP  H A +LI
Sbjct: 179 QSDEAICVEAEFQLKEGDKKEITAEMQKNKDYRRDTQPWNYPCCGSVFRNPLPHHAGKLI 238

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           E++G +G   GGA+ISE+H NF++N  +AT  D+  L +  +  ++N+ G+ +E E++ +
Sbjct: 239 EEAGLKGYSIGGAQISEMHANFIVNKGDATANDVLELIQFAKNTIYNKFGVKMETEVELV 298

Query: 304 GD 305
           G 
Sbjct: 299 GK 300


>gi|306843224|ref|ZP_07475835.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella sp. BO2]
 gi|306286589|gb|EFM58166.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella sp. BO2]
          Length = 322

 Score =  233 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 163/315 (51%), Positives = 211/315 (66%), Gaps = 2/315 (0%)

Query: 1   MIYG--RISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL 58
           M+     + + L  R   LRG+   +  + +ITWFR GG A+V+FQP D  DL  FL  +
Sbjct: 1   MMESGEALLKKLDGRLSGLRGRLTPDTGMDKITWFRAGGPAQVLFQPSDEEDLSAFLKAV 60

Query: 59  PSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSA 118
           P +IP+ +VG+GSN+LVRD G+ G V+RLS  GF  +E     ++  GA    K +A +A
Sbjct: 61  PEEIPLLVVGIGSNLLVRDGGVPGFVVRLSAKGFGEVEQVCDTQLRAGAAVPDKRVAAAA 120

Query: 119 LRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQ 178
           L  G+ GFHF++GIPG IGGA  MNAGAN  ET + VVEV  +DRKG  HV+    + Y 
Sbjct: 121 LEAGLAGFHFYHGIPGGIGGALRMNAGANGVETRERVVEVRALDRKGEVHVLSNADMGYA 180

Query: 179 YRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           YR S  + DLI T V+  G P  ++ I  A+  V HHRETVQP++EKTGGSTFKNP G S
Sbjct: 181 YRHSSASPDLIFTSVLFEGVPGERDDIRRAMDEVQHHRETVQPVREKTGGSTFKNPEGTS 240

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           AW+ I+K+GCRGL  GGA++SE+HCNFMIN  NATG+DLE LGE VR +VF  SGI L W
Sbjct: 241 AWKEIDKAGCRGLRVGGAQMSEMHCNFMINTGNATGHDLETLGETVRARVFENSGIRLHW 300

Query: 299 EIKRLGDFFDHQIVD 313
           EIKRLG F + + ++
Sbjct: 301 EIKRLGLFREGERIE 315


>gi|328542968|ref|YP_004303077.1| UDP-N-acetylenolpyruvoylglucosamine reductase [polymorphum gilvum
           SL003B-26A1]
 gi|326412714|gb|ADZ69777.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Polymorphum gilvum
           SL003B-26A1]
          Length = 317

 Score =  233 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 158/310 (50%), Positives = 207/310 (66%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  +   L +    +RGK   N PL  +TW R GG A+++FQP D  DL  FL  LP 
Sbjct: 1   MSFPDLLATLGDWLAGVRGKLTANQPLAAVTWLRVGGPAQLLFQPADEDDLALFLAALPE 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           +IP+  +GLGSN+LVRD GI GVV+RL+  GF  +EV +   + +GA    K +A +A  
Sbjct: 61  EIPVLPIGLGSNLLVRDGGIEGVVVRLTGKGFGTVEVLDGARLRIGAAVPDKRVAEAAAE 120

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
            GIGGF F+ GIPG++GGA  MNAGA+  ET Q +VE+  +DR+GN+ V+    + Y YR
Sbjct: 121 AGIGGFSFYAGIPGALGGALRMNAGAHGTETCQRLVELAALDRRGNRIVLSNADMGYSYR 180

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
            S +  DLI T  VL G P+++  I A +A V  HRE  QPI+EKTGGSTFKNP G SAW
Sbjct: 181 HSAVPADLIFTGAVLAGTPQAEVEIRAEMAEVAAHRERAQPIREKTGGSTFKNPPGTSAW 240

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           + I+ +GCRGL+ GGA++S++HCNFMIN  +AT +DLE LGE VR++V   SGI LEWEI
Sbjct: 241 KEIDAAGCRGLQIGGARMSDMHCNFMINTGDATAFDLELLGETVRRRVRAHSGICLEWEI 300

Query: 301 KRLGDFFDHQ 310
           KRLG F   Q
Sbjct: 301 KRLGRFLPGQ 310


>gi|163843685|ref|YP_001628089.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella suis ATCC
           23445]
 gi|189028918|sp|B0CHL8|MURB_BRUSI RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|163674408|gb|ABY38519.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella suis ATCC
           23445]
          Length = 322

 Score =  233 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 163/315 (51%), Positives = 211/315 (66%), Gaps = 2/315 (0%)

Query: 1   MIYG--RISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL 58
           M+     + + L  R   LRG+   +  + +ITWFR GG A+V+FQP D  DL  FL  +
Sbjct: 1   MMESGEALLKKLDGRLSGLRGRLTPDTGMDKITWFRAGGPAQVLFQPSDEEDLSAFLKAV 60

Query: 59  PSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSA 118
           P +IP+ +VG+GSN+LVRD G+ G V+RLS  GF  +E     ++  GA    K +A +A
Sbjct: 61  PEEIPLLVVGIGSNLLVRDGGVPGFVVRLSAKGFGEVEQVCDTQLRAGAAAPDKRVAAAA 120

Query: 119 LRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQ 178
           L  G+ GFHF++GIPG IGGA  MNAGAN  ET + VVEV  +DRKG  HV+    + Y 
Sbjct: 121 LEAGLAGFHFYHGIPGGIGGALRMNAGANGVETRERVVEVRALDRKGEVHVLSNADMGYA 180

Query: 179 YRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           YR S  + DLI T V+  G P  ++ I  A+  V HHRETVQP++EKTGGSTFKNP G S
Sbjct: 181 YRHSSASPDLIFTSVLFEGVPGERDDIRRAMDEVQHHRETVQPVREKTGGSTFKNPEGTS 240

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           AW+ I+K+GCRGL  GGA++SE+HCNFMIN  NATG+DLE LGE VR +VF  SGI L W
Sbjct: 241 AWKEIDKAGCRGLRVGGAQMSEMHCNFMINTGNATGHDLETLGETVRARVFENSGIRLHW 300

Query: 299 EIKRLGDFFDHQIVD 313
           EIKRLG F + + ++
Sbjct: 301 EIKRLGLFREGEQLE 315


>gi|153875389|ref|ZP_02003214.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Beggiatoa sp. PS]
 gi|152068147|gb|EDN66786.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Beggiatoa sp. PS]
          Length = 322

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 109/306 (35%), Positives = 158/306 (51%), Gaps = 5/306 (1%)

Query: 4   GRISRLLRER--GKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD 61
            R+  LL        LRGK ++N P+   T +R GG A+  ++P DI DL  FL  LP++
Sbjct: 17  ERMENLLTNSYHFNNLRGKLRQNEPMSAHTSWRVGGPAQWFYEPADIADLAQFLQQLPAN 76

Query: 62  IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRH 121
           IP+  +GLGSN+LVRD GI G+V+  +    + I +  +  + V    S   +A  A R 
Sbjct: 77  IPVFWLGLGSNLLVRDGGIPGIVILTAGLL-NKIHLLENKILYVEVGVSSAKVARFATRS 135

Query: 122 GIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS 181
           G+ G  F  GIPG+ GGA  MNAGA   ET   V  V  +D++G +H       +  YRS
Sbjct: 136 GLTGTEFLAGIPGTFGGALAMNAGAWGQETWPLVQSVETLDQQGQRHQRQVADYEIGYRS 195

Query: 182 SEITKDLIITHVVLRG--FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
            +  K+       L+     +        I  +   R   QPI   + GS F+NP G  A
Sbjct: 196 VKGKKNEWFIAAKLQLAKSEDDDKNSKEKIQALLKQRNEKQPIGLPSCGSVFRNPPGDYA 255

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LIE++G +G   GGA +SE H NF+IN+  AT  D+E L EQ++  +  +  I L  E
Sbjct: 256 ARLIEQAGWKGRCIGGACVSEKHANFIINSHAATAADIENLIEQIKHSIKQKYQISLIPE 315

Query: 300 IKRLGD 305
           +  +G 
Sbjct: 316 VHIVGK 321


>gi|323705031|ref|ZP_08116607.1| UDP-N-acetylenolpyruvoylglucosamine reductase
           [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323535457|gb|EGB25232.1| UDP-N-acetylenolpyruvoylglucosamine reductase
           [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 301

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 104/305 (34%), Positives = 164/305 (53%), Gaps = 7/305 (2%)

Query: 3   YGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SD 61
             +I+ +L++           N P+ + T FR GG A+V+  PQ + +L   + L+   +
Sbjct: 1   MEKIAEMLKKVVSD--EDIYINEPMSRHTSFRIGGPADVLVIPQSVDELIKVMGLIKAEN 58

Query: 62  IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRH 121
           IP  I+G G+NI+V D GIRGVV++L+     +++          A     S+AN+AL +
Sbjct: 59  IPYFILGNGTNIIVSDKGIRGVVIKLTAIRKISVDGEMIV---SEAGALLSSIANTALDN 115

Query: 122 GIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS 181
            + GF F  GIPG++GGA  MNAGA   E    V +V  ID  G+ + +    +++ YRS
Sbjct: 116 ELTGFEFASGIPGTLGGAITMNAGAYGPEIKDVVEKVEVIDEDGSIYEVKNGNMRFGYRS 175

Query: 182 SEIT-KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
           S I   +LI     +     +   I A +  +   R+  QP++  + GS FK P G  A 
Sbjct: 176 SLIQLDNLIAIRAWIHLKKGNYKDIKAKMDELNGLRKMKQPLEYPSAGSVFKRPEGFYAG 235

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LI+ +G  G   GGA++SE HC F+IN  NAT  D+  L   ++K V ++ G+ LE E+
Sbjct: 236 KLIQDAGLSGYTIGGAQVSEKHCGFIINKGNATADDVLNLIAYIKKTVKDKFGVDLETEV 295

Query: 301 KRLGD 305
           K +G+
Sbjct: 296 KIIGE 300


>gi|148560533|ref|YP_001259322.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ovis ATCC
           25840]
 gi|225627880|ref|ZP_03785916.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ceti str.
           Cudo]
 gi|225852911|ref|YP_002733144.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           ATCC 23457]
 gi|254702150|ref|ZP_05163978.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella suis bv. 5
           str. 513]
 gi|254708101|ref|ZP_05169929.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella
           pinnipedialis M163/99/10]
 gi|254710470|ref|ZP_05172281.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella
           pinnipedialis B2/94]
 gi|254714463|ref|ZP_05176274.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ceti
           M644/93/1]
 gi|254717361|ref|ZP_05179172.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ceti
           M13/05/1]
 gi|256031964|ref|ZP_05445578.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella
           pinnipedialis M292/94/1]
 gi|256045059|ref|ZP_05447960.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|256113982|ref|ZP_05454765.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           bv. 3 str. Ether]
 gi|256263608|ref|ZP_05466140.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           bv. 2 str. 63/9]
 gi|256369845|ref|YP_003107356.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella microti CCM
           4915]
 gi|260169101|ref|ZP_05755912.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella sp. F5/99]
 gi|260565342|ref|ZP_05835826.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           bv. 1 str. 16M]
 gi|261219192|ref|ZP_05933473.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ceti
           M13/05/1]
 gi|261315604|ref|ZP_05954801.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella
           pinnipedialis M163/99/10]
 gi|261318042|ref|ZP_05957239.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella
           pinnipedialis B2/94]
 gi|261322253|ref|ZP_05961450.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ceti
           M644/93/1]
 gi|261758608|ref|ZP_06002317.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella sp. F5/99]
 gi|265989073|ref|ZP_06101630.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella
           pinnipedialis M292/94/1]
 gi|265991486|ref|ZP_06104043.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|265995324|ref|ZP_06107881.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           bv. 3 str. Ether]
 gi|294852755|ref|ZP_06793428.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella sp. NVSL
           07-0026]
 gi|30316085|sp|Q8YI64|MURB_BRUME RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|166222826|sp|A5VRH5|MURB_BRUO2 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|254764135|sp|C0RE68|MURB_BRUMB RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|148371790|gb|ABQ61769.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ovis ATCC
           25840]
 gi|225617043|gb|EEH14089.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ceti str.
           Cudo]
 gi|225641276|gb|ACO01190.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           ATCC 23457]
 gi|256000008|gb|ACU48407.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella microti CCM
           4915]
 gi|260151410|gb|EEW86504.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           bv. 1 str. 16M]
 gi|260924281|gb|EEX90849.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ceti
           M13/05/1]
 gi|261294943|gb|EEX98439.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ceti
           M644/93/1]
 gi|261297265|gb|EEY00762.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella
           pinnipedialis B2/94]
 gi|261304630|gb|EEY08127.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella
           pinnipedialis M163/99/10]
 gi|261738592|gb|EEY26588.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella sp. F5/99]
 gi|262766437|gb|EEZ12226.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           bv. 3 str. Ether]
 gi|263002270|gb|EEZ14845.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|263093659|gb|EEZ17664.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           bv. 2 str. 63/9]
 gi|264661270|gb|EEZ31531.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella
           pinnipedialis M292/94/1]
 gi|294821344|gb|EFG38343.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella sp. NVSL
           07-0026]
 gi|326409453|gb|ADZ66518.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           M28]
          Length = 322

 Score =  233 bits (594), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 163/315 (51%), Positives = 211/315 (66%), Gaps = 2/315 (0%)

Query: 1   MIYG--RISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL 58
           M+     + + L  R   LRG+   +  + +ITWFR GG A+V+FQP D  DL  FL  +
Sbjct: 1   MMESGEALLKKLDGRLSGLRGRLTPDTGMDKITWFRAGGPAQVLFQPSDEEDLSAFLKAV 60

Query: 59  PSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSA 118
           P +IP+ +VG+GSN+LVRD G+ G V+RLS  GF  +E     ++  GA    K +A +A
Sbjct: 61  PEEIPLLVVGIGSNLLVRDGGVPGFVVRLSAKGFGEVEQVCDTQLRAGAAAPDKRVAAAA 120

Query: 119 LRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQ 178
           L  G+ GFHF++GIPG IGGA  MNAGAN  ET + VVEV  +DRKG  HV+    + Y 
Sbjct: 121 LEAGLAGFHFYHGIPGGIGGALRMNAGANGVETRERVVEVRALDRKGEVHVLSNADMGYA 180

Query: 179 YRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           YR S  + DLI T V+  G P  ++ I  A+  V HHRETVQP++EKTGGSTFKNP G S
Sbjct: 181 YRHSSASPDLIFTSVLFEGVPGERDDIRRAMDEVQHHRETVQPVREKTGGSTFKNPEGTS 240

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           AW+ I+K+GCRGL  GGA++SE+HCNFMIN  NATG+DLE LGE VR +VF  SGI L W
Sbjct: 241 AWKEIDKAGCRGLRVGGAQMSEMHCNFMINTGNATGHDLETLGETVRARVFENSGIRLHW 300

Query: 299 EIKRLGDFFDHQIVD 313
           EIKRLG F + + ++
Sbjct: 301 EIKRLGLFREGEQIE 315


>gi|306844328|ref|ZP_07476920.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella sp. BO1]
 gi|306275400|gb|EFM57141.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella sp. BO1]
          Length = 322

 Score =  233 bits (594), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 163/315 (51%), Positives = 211/315 (66%), Gaps = 2/315 (0%)

Query: 1   MIYG--RISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL 58
           M+     + + L  R   LRG+   +  + +ITWFR GG A+V+FQP D  DL  FL  +
Sbjct: 1   MMESGEALLKKLDGRLSGLRGRLTPDTGMDKITWFRAGGPAQVLFQPSDEEDLSAFLKAV 60

Query: 59  PSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSA 118
           P +IP+ +VG+GSN+LVRD G+ G V+RLS  GF  +E     ++  GA    K +A +A
Sbjct: 61  PEEIPLLVVGIGSNLLVRDGGVPGFVVRLSAKGFGEVEQVCDTQLRAGAAAPDKRVAAAA 120

Query: 119 LRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQ 178
           L  G+ GFHF++GIPG IGGA  MNAGAN  ET + VVEV  +DRKG  HV+    + Y 
Sbjct: 121 LEAGLAGFHFYHGIPGGIGGALRMNAGANGVETRERVVEVRALDRKGEVHVLSNADMGYT 180

Query: 179 YRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           YR S  + DLI T V+  G P  ++ I  A+  V HHRETVQP++EKTGGSTFKNP G S
Sbjct: 181 YRHSSASPDLIFTSVLFEGVPGERDDIRRAMDEVQHHRETVQPVREKTGGSTFKNPEGTS 240

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           AW+ I+K+GCRGL  GGA++SE+HCNFMIN  NATG+DLE LGE VR +VF  SGI L W
Sbjct: 241 AWKEIDKAGCRGLRVGGAQMSEMHCNFMINTGNATGHDLETLGETVRARVFENSGIRLHW 300

Query: 299 EIKRLGDFFDHQIVD 313
           EIKRLG F + + ++
Sbjct: 301 EIKRLGLFREGERIE 315


>gi|23502300|ref|NP_698427.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella suis 1330]
 gi|30316053|sp|Q8FZP4|MURB_BRUSU RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|23348276|gb|AAN30342.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella suis 1330]
          Length = 322

 Score =  233 bits (594), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 162/315 (51%), Positives = 211/315 (66%), Gaps = 2/315 (0%)

Query: 1   MIYG--RISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL 58
           M+     + + L  R   LRG+   +  + +ITWFR GG A+V+FQP D  DL  FL  +
Sbjct: 1   MMESGEALLKKLDGRLSGLRGRLTPDTGMDKITWFRAGGPAQVLFQPSDEEDLSAFLKAV 60

Query: 59  PSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSA 118
           P +IP+ +VG+GSN+LVRD G+ G V+RLS  GF  +E     ++  GA    K +A +A
Sbjct: 61  PEEIPLLVVGIGSNLLVRDGGVPGFVVRLSAKGFGEVEQVCDTQLRAGAAAPDKRVAAAA 120

Query: 119 LRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQ 178
           L  G+ GFHF++GIPG +GGA  MNAGAN  ET + VVEV  +DRKG  HV+    + Y 
Sbjct: 121 LEAGLAGFHFYHGIPGGVGGALRMNAGANGVETRERVVEVRALDRKGEVHVLSNADMGYA 180

Query: 179 YRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           YR S  + DLI T V+  G P  ++ I  A+  V HHRETVQP++EKTGGSTFKNP G S
Sbjct: 181 YRHSSASPDLIFTSVLFEGVPGERDDIRRAMDEVQHHRETVQPVREKTGGSTFKNPEGTS 240

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           AW+ I+K+GCRGL  GGA++SE+HCNFMIN  NATG+DLE LGE VR +VF  SGI L W
Sbjct: 241 AWKEIDKAGCRGLRVGGAQMSEMHCNFMINTGNATGHDLETLGETVRARVFENSGIRLHW 300

Query: 299 EIKRLGDFFDHQIVD 313
           EIKRLG F + + ++
Sbjct: 301 EIKRLGLFREGEQIE 315


>gi|256160163|ref|ZP_05457857.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ceti
           M490/95/1]
 gi|256255369|ref|ZP_05460905.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ceti B1/94]
 gi|261222571|ref|ZP_05936852.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ceti B1/94]
 gi|265998536|ref|ZP_06111093.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ceti
           M490/95/1]
 gi|260921155|gb|EEX87808.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ceti B1/94]
 gi|262553160|gb|EEZ08994.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella ceti
           M490/95/1]
          Length = 322

 Score =  233 bits (594), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 163/315 (51%), Positives = 211/315 (66%), Gaps = 2/315 (0%)

Query: 1   MIYG--RISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL 58
           M+     + + L  R   LRG+   +  + +ITWFR GG A+V+FQP D  DL  FL  +
Sbjct: 1   MMESGEALLKKLDGRLSGLRGRLTPDTGMDKITWFRAGGPAQVLFQPSDEEDLSAFLKAV 60

Query: 59  PSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSA 118
           P +IP+ +VG+GSN+LVRD G+ G V+RLS  GF  +E     ++  GA    K +A +A
Sbjct: 61  PEEIPLLVVGIGSNLLVRDGGVPGFVVRLSAKGFGEVEQVCDTQLRAGAAAPDKRVAAAA 120

Query: 119 LRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQ 178
           L  G+ GFHF++GIPG IGGA  MNAGAN  ET + VVEV  +DRKG  HV+    + Y 
Sbjct: 121 LEAGLAGFHFYHGIPGGIGGALRMNAGANGVETRERVVEVRALDRKGEVHVLSNADMGYA 180

Query: 179 YRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           YR S  + DLI T V+  G P  ++ I  A+  V HHRETVQP++EKTGGSTFKNP G S
Sbjct: 181 YRHSSASPDLIFTSVLFEGVPGERDDIRRAMDEVQHHRETVQPVREKTGGSTFKNPEGTS 240

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           AW+ I+K+GCRGL  GGA++SE+HCNFMIN  NATG+DLE LGE VR +VF  SGI L W
Sbjct: 241 AWKEIDKAGCRGLRVGGAQMSEMHCNFMINTGNATGHDLETLGETVRARVFENSGIRLHW 300

Query: 299 EIKRLGDFFDHQIVD 313
           EIKRLG F + + ++
Sbjct: 301 EIKRLGLFCEGEQIE 315


>gi|282850621|ref|ZP_06260000.1| UDP-N-acetylmuramate dehydrogenase [Veillonella parvula ATCC 17745]
 gi|282580114|gb|EFB85518.1| UDP-N-acetylmuramate dehydrogenase [Veillonella parvula ATCC 17745]
          Length = 309

 Score =  233 bits (594), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 99/302 (32%), Positives = 162/302 (53%), Gaps = 6/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           +   L E+    R   +E   L   T F+ GG A++  +P  + +L + L ++   D+P+
Sbjct: 11  LQTALLEKLPSTR--VREQELLSHHTTFKIGGPADLFIEPTTMAELSFTLRIIHELDVPV 68

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           TI+G GSNILV+D GIR     +S    + I   N   + +G+    K  +  A  + + 
Sbjct: 69  TIIGCGSNILVKDGGIR--GAVVSVRHMTQIMDCNENTLCIGSGYMLKDASEFAWENSLS 126

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPG++GGA +MNAGA + E S  V  V  +D +GN        L + YR S  
Sbjct: 127 GLEFAIGIPGTLGGAVFMNAGAYDGEMSHVVTAVRAVDFQGNIKEYDASHLDFAYRHSVF 186

Query: 185 TKDLIITHVVLR-GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
             +  +   V+    P  ++ I A +  +   RE+ QP++  + GSTFK P G+ A  LI
Sbjct: 187 HDNHEVIGEVIMTLKPGDKDAIKARMDELTEKRESKQPLEYASAGSTFKRPPGYFAGTLI 246

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           E++G +GL  G A++S  H  F+IN  +A+  D+  L  +V+++V++Q G+ LE E++ +
Sbjct: 247 EQTGLKGLSVGDAQVSHKHAGFVINTGSASAKDVLDLISEVQRRVYDQHGVHLEPEVRMI 306

Query: 304 GD 305
           G+
Sbjct: 307 GE 308


>gi|62290322|ref|YP_222115.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus bv.
           1 str. 9-941]
 gi|82700246|ref|YP_414820.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           biovar Abortus 2308]
 gi|189024555|ref|YP_001935323.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus
           S19]
 gi|237815829|ref|ZP_04594826.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus
           str. 2308 A]
 gi|254689623|ref|ZP_05152877.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus bv.
           6 str. 870]
 gi|254694113|ref|ZP_05155941.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus bv.
           3 str. Tulya]
 gi|254697765|ref|ZP_05159593.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus bv.
           2 str. 86/8/59]
 gi|254730654|ref|ZP_05189232.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus bv.
           4 str. 292]
 gi|256257873|ref|ZP_05463409.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus bv.
           9 str. C68]
 gi|260546864|ref|ZP_05822603.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus
           NCTC 8038]
 gi|260758370|ref|ZP_05870718.1| UDP-N-acetylmuramate dehydrogenase [Brucella abortus bv. 4 str.
           292]
 gi|260884164|ref|ZP_05895778.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus bv.
           9 str. C68]
 gi|297248709|ref|ZP_06932427.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus bv.
           5 str. B3196]
 gi|75496537|sp|Q57C80|MURB_BRUAB RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|123546261|sp|Q2YLY7|MURB_BRUA2 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|254764134|sp|B2S6Q2|MURB_BRUA1 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|62196454|gb|AAX74754.1| MurB, UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella
           abortus bv. 1 str. 9-941]
 gi|82616347|emb|CAJ11404.1| Helix-turn-helix, AraC type:UDP-N-acetylenolpyruvoylglucosamine
           reductase:FAD linked oxidase, N-terminal [Brucella
           melitensis biovar Abortus 2308]
 gi|189020127|gb|ACD72849.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus
           S19]
 gi|237789127|gb|EEP63338.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus
           str. 2308 A]
 gi|260095914|gb|EEW79791.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus
           NCTC 8038]
 gi|260668688|gb|EEX55628.1| UDP-N-acetylmuramate dehydrogenase [Brucella abortus bv. 4 str.
           292]
 gi|260873692|gb|EEX80761.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus bv.
           9 str. C68]
 gi|297175878|gb|EFH35225.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella abortus bv.
           5 str. B3196]
          Length = 322

 Score =  233 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 162/315 (51%), Positives = 210/315 (66%), Gaps = 2/315 (0%)

Query: 1   MIYG--RISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL 58
           M+     + + L  R   LRG+   +  + +ITWFR GG A+V+FQP D  DL  FL  +
Sbjct: 1   MMESGEALLKKLDGRLSGLRGRLTPDTGMDKITWFRAGGPAQVLFQPSDEEDLSAFLKAV 60

Query: 59  PSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSA 118
           P +IP+ +VG+GSN+LVRD G+ G V+RLS  GF  +E     ++  GA    K +A +A
Sbjct: 61  PEEIPLLVVGIGSNLLVRDGGVPGFVVRLSAKGFGEVEQVCDTQLRAGAAAPDKRVAAAA 120

Query: 119 LRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQ 178
           L  G+ GFHF++GIPG IGGA  MNAGAN  ET + VVEV  +DRKG  HV+    + Y 
Sbjct: 121 LEAGLAGFHFYHGIPGGIGGALRMNAGANGVETRERVVEVRALDRKGEVHVLSNADMGYA 180

Query: 179 YRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           YR S  + DLI T V+  G P  ++ I  A+  V HHRETVQP++EKTGGSTFKN  G S
Sbjct: 181 YRHSSASPDLIFTSVLFEGVPGERDDIRRAMDEVQHHRETVQPVREKTGGSTFKNSEGTS 240

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           AW+ I+K+GCRGL  GGA++SE+HCNFMIN  NATG+DLE LGE VR +VF  SGI L W
Sbjct: 241 AWKEIDKAGCRGLRVGGAQMSEMHCNFMINTGNATGHDLETLGETVRARVFENSGIRLHW 300

Query: 299 EIKRLGDFFDHQIVD 313
           EIKRLG F + + ++
Sbjct: 301 EIKRLGLFREGEQIE 315


>gi|167745940|ref|ZP_02418067.1| hypothetical protein ANACAC_00635 [Anaerostipes caccae DSM 14662]
 gi|167654455|gb|EDR98584.1| hypothetical protein ANACAC_00635 [Anaerostipes caccae DSM 14662]
          Length = 302

 Score =  233 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 104/304 (34%), Positives = 163/304 (53%), Gaps = 5/304 (1%)

Query: 6   ISRLLRERGKQL-RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIP 63
           ++ +L E  +++   +     P+K+ T FR GG AE+   P+ I ++++ +      +IP
Sbjct: 1   MNTILEELRQKIAPERVLTKEPMKKHTTFRIGGEAELYIIPETIEEVQWTVKTARKHEIP 60

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           + I+G GSN+LV D GI G+VL++           N  E+   A     S+A  A    +
Sbjct: 61  MFILGNGSNLLVGDRGIDGIVLQIYKNMNEI--TVNGTEITAQAGALLSSIAREAQNRSL 118

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            GF F  GIPG+ GGA  MNAGA   E  Q + E   + ++G    +  E+L+  YR+S 
Sbjct: 119 TGFEFAGGIPGTFGGAITMNAGAYGGEMIQVLKEATVLTKEGEILTLSAEELELGYRTSN 178

Query: 184 -ITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
            IT    +    L       + I   +      R+T QP++  + GSTFK P G+ A +L
Sbjct: 179 VITCGYTVLSGTLSLKEGDPSEIKKQMDEYSMARKTKQPLELPSAGSTFKRPEGYFAGKL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           I+ +G RG + GGA++S+ HC F++N +NAT  D+  L E V+K V  + G+ LE E+KR
Sbjct: 239 IDDAGLRGYQVGGARVSDKHCGFVVNQENATAKDVLQLIEDVQKTVKEKFGVDLEPEVKR 298

Query: 303 LGDF 306
           +G F
Sbjct: 299 VGKF 302


>gi|163794529|ref|ZP_02188500.1| UDP-N-acetylenolpyruvoylglucosamine reductase [alpha
           proteobacterium BAL199]
 gi|159180253|gb|EDP64776.1| UDP-N-acetylenolpyruvoylglucosamine reductase [alpha
           proteobacterium BAL199]
          Length = 318

 Score =  233 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 125/295 (42%), Positives = 177/295 (60%), Gaps = 2/295 (0%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           L ER   +RG+++ +  + Q+TWFR GG AEV+F+P D  DL  FL   P D+P+T++G+
Sbjct: 16  LIERLPPVRGEYRVDASIAQLTWFRVGGPAEVLFRPADEADLIDFLAGRPGDVPVTVLGV 75

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
           GSN L+RD GI GVV+RL  A  S +       ++ GA     ++A +A R G+ G  F 
Sbjct: 76  GSNTLIRDGGIPGVVIRLGKAFASAMVD--GERIMAGAGALDVTVAATAQRAGLTGLEFL 133

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLI 189
            GIPG+IGG   MNAGA   E    ++    ID  G+ H +    +   YR   + ++ I
Sbjct: 134 SGIPGTIGGGLRMNAGAYGSEIRDVLISARAIDPLGHVHTLAPADMGLSYRHCGVPEEWI 193

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
            T  V +        I+ A+ ++   RE  QP + +TGGSTF NP G  AWQLI+ +GCR
Sbjct: 194 FTSAVFQARTGDSATIAQAMTDIRDAREDTQPRRVRTGGSTFANPEGRKAWQLIDAAGCR 253

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           GL  G A++SE HCNF++N  +AT  D+E LGE+VR++V   SGI L WEI+R+G
Sbjct: 254 GLRIGDAQVSEKHCNFLLNIGDATAEDIESLGEEVRRRVRESSGITLRWEIRRIG 308


>gi|85707768|ref|ZP_01038834.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Erythrobacter sp.
           NAP1]
 gi|85689302|gb|EAQ29305.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Erythrobacter sp.
           NAP1]
          Length = 324

 Score =  233 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 120/288 (41%), Positives = 173/288 (60%), Gaps = 1/288 (0%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RG+  +N PL +  WF++GGNA+ +F+P D+ DL+ FL  L   +P+  +G+GSN+++R
Sbjct: 36  IRGELTQNAPLAKHVWFQSGGNADWLFEPADLEDLRTFLDRLDGRMPVMALGVGSNMIIR 95

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ GVV++L       IE+     +  GA      +A  A + GI G  F+ GIPGS+
Sbjct: 96  DGGVPGVVIKLGKPFMD-IEITGDTTLKAGAAVPVSMVARRAAKAGIDGLSFYVGIPGSV 154

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GG   MN G    ET Q + +   +   G    +    L+Y YR S +    ++  V   
Sbjct: 155 GGVTRMNGGCYGRETCQVLTDCDVLMPNGELVTLSNADLQYSYRHSALPDGAVVVEVRFE 214

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           GFP   + I   +  +   R+  QPI  +TGGSTFKNP GHS+W+LI+ +G RG + GGA
Sbjct: 215 GFPGDPDTIKEEMDRISSQRKDSQPIGSRTGGSTFKNPDGHSSWKLIDDAGLRGFKHGGA 274

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           ++SE HCNF+IN  +AT  D+E LGE VR+KV+  SGI LEWEIKR+G
Sbjct: 275 QVSEKHCNFLINTGDATSSDIEGLGELVREKVYANSGIQLEWEIKRVG 322


>gi|261752720|ref|ZP_05996429.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella suis bv. 5
           str. 513]
 gi|261742473|gb|EEY30399.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella suis bv. 5
           str. 513]
 gi|326539159|gb|ADZ87374.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           M5-90]
          Length = 321

 Score =  233 bits (593), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 162/310 (52%), Positives = 209/310 (67%)

Query: 4   GRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIP 63
             + + L  R   LRG+   +  + +ITWFR GG A+V+FQP D  DL  FL  +P +IP
Sbjct: 5   EALLKKLDGRLSGLRGRLTPDTGMDKITWFRAGGPAQVLFQPSDEEDLSAFLKAVPEEIP 64

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           + +VG+GSN+LVRD G+ G V+RLS  GF  +E     ++  GA    K +A +AL  G+
Sbjct: 65  LLVVGIGSNLLVRDGGVPGFVVRLSAKGFGEVEQVCDTQLRAGAAAPDKRVAAAALEAGL 124

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            GFHF++GIPG IGGA  MNAGAN  ET + VVEV  +DRKG  HV+    + Y YR S 
Sbjct: 125 AGFHFYHGIPGGIGGALRMNAGANGVETRERVVEVRALDRKGEVHVLSNADMGYAYRHSS 184

Query: 184 ITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            + DLI T V+  G P  ++ I  A+  V HHRETVQP++EKTGGSTFKNP G SAW+ I
Sbjct: 185 ASPDLIFTSVLFEGVPGERDDIRRAMDEVQHHRETVQPVREKTGGSTFKNPEGTSAWKEI 244

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           +K+GCRGL  GGA++SE+HCNFMIN  NATG+DLE LGE VR +VF  SGI L WEIKRL
Sbjct: 245 DKAGCRGLRVGGAQMSEMHCNFMINTGNATGHDLETLGETVRARVFENSGIRLHWEIKRL 304

Query: 304 GDFFDHQIVD 313
           G F + + ++
Sbjct: 305 GLFREGEQIE 314


>gi|254719460|ref|ZP_05181271.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella sp. 83/13]
 gi|265984466|ref|ZP_06097201.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella sp. 83/13]
 gi|306839239|ref|ZP_07472056.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella sp. NF
           2653]
 gi|264663058|gb|EEZ33319.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella sp. 83/13]
 gi|306405786|gb|EFM62048.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella sp. NF
           2653]
          Length = 322

 Score =  233 bits (593), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 163/315 (51%), Positives = 211/315 (66%), Gaps = 2/315 (0%)

Query: 1   MIYGR--ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL 58
           M+     + + L  R   LRG+   +  + +ITWFR GG A+V+FQP D  DL  FL  +
Sbjct: 1   MMESGEVLLKKLDGRLSGLRGRLTPDTGMDKITWFRAGGPAQVLFQPSDEEDLSAFLKAV 60

Query: 59  PSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSA 118
           P +IP+ +VG+GSN+LVRD G+ G V+RLS  GF  +E     ++  GA    K +A +A
Sbjct: 61  PEEIPLLVVGIGSNLLVRDGGVPGFVVRLSAKGFGEVEQVCDTQLRAGAAAPDKRVAAAA 120

Query: 119 LRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQ 178
           L  G+ GFHF++GIPG IGGA  MNAGAN  ET + VVEV  +DRKG  HV+    + Y 
Sbjct: 121 LEAGLVGFHFYHGIPGGIGGALRMNAGANGVETRERVVEVRALDRKGEVHVLSNADMGYA 180

Query: 179 YRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           YR S  + DLI T V+  G P  ++ I  A+  V HHRETVQP++EKTGGSTFKNP G S
Sbjct: 181 YRHSSASPDLIFTSVLFEGVPGERDDIRRAMDEVQHHRETVQPVREKTGGSTFKNPEGTS 240

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           AW+ I+K+GCRGL  GGA++SE+HCNFMIN  NATG+DLE LGE VR +VF  SGI L W
Sbjct: 241 AWKEIDKAGCRGLRVGGAQMSEMHCNFMINTGNATGHDLETLGETVRARVFENSGIRLHW 300

Query: 299 EIKRLGDFFDHQIVD 313
           EIKRLG F + + ++
Sbjct: 301 EIKRLGLFREGERIE 315


>gi|197105783|ref|YP_002131160.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Phenylobacterium
           zucineum HLK1]
 gi|254765517|sp|B4RFG1|MURB_PHEZH RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|196479203|gb|ACG78731.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Phenylobacterium
           zucineum HLK1]
          Length = 300

 Score =  233 bits (593), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 133/296 (44%), Positives = 179/296 (60%), Gaps = 3/296 (1%)

Query: 11  RERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLG 70
           ++R   +RGK   + PL   TWFR GG A+V+F P+D  DL  FL  LP+++P+T++G+G
Sbjct: 4   KDRLPAVRGKLLRDEPLAPFTWFRVGGPADVIFLPEDEDDLAAFLKALPAEVPVTVLGVG 63

Query: 71  SNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFY 130
           SN LVRD G+ GVV+RL  A  + +E R    +  GA      +A  A + GI G  F+ 
Sbjct: 64  SNTLVRDGGVDGVVIRLGKAF-AKVEPRGEGRLYAGAAALDAVVAREAGKAGIAGLEFYR 122

Query: 131 GIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE--ITKDL 188
           G+PG+IGGA  MNAG    ET   +VE + + R G +  +    L Y YR S     + L
Sbjct: 123 GVPGTIGGALVMNAGCYGAETKDVLVEAYALTRAGERLTLSNADLGYSYRKSARAAAEPL 182

Query: 189 IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGC 248
           I    +  G P+    I A +A +   RE  QPI+EKTGGSTFKNP GHS+W+L++++G 
Sbjct: 183 IFLGALFEGRPDDPAAIEARMAEITERREKTQPIREKTGGSTFKNPPGHSSWKLVDEAGW 242

Query: 249 RGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           RG  FGGA  S LH NF+IN   AT  DLE LGE VR  V  + G+ L+WEIKR+G
Sbjct: 243 RGKLFGGAMFSPLHSNFLINTGEATAADLEGLGEAVRADVKAKFGVDLDWEIKRIG 298


>gi|317473375|ref|ZP_07932670.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Anaerostipes sp.
           3_2_56FAA]
 gi|316899211|gb|EFV21230.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Anaerostipes sp.
           3_2_56FAA]
          Length = 302

 Score =  232 bits (592), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 103/304 (33%), Positives = 162/304 (53%), Gaps = 5/304 (1%)

Query: 6   ISRLLRERGKQL-RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIP 63
           ++ +L E  +++   +     P+K+ T FR GG AE+   P+ I ++++ +      +IP
Sbjct: 1   MNTILEELRQKIAPERVLTKEPMKKHTTFRIGGEAELYIIPETIEEVQWTVKTARKHEIP 60

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           + I+G GSN+LV D GI G+VL++           N  E+   A     S+A  A    +
Sbjct: 61  MFILGNGSNLLVGDRGIDGIVLQIYKNMNEI--TVNGTEITAQAGALLSSIAREAQNRSL 118

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            GF F  GIPG+ GGA  MNAGA   E  Q + E   + ++G    +  E+L+  YR+S 
Sbjct: 119 TGFEFAGGIPGTFGGAITMNAGAYGGEMIQVLKEATALTKEGEILTLSAEELELGYRTSN 178

Query: 184 -ITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
            I     +    L       + I   +      R+T QP++  + GSTFK P G+ A +L
Sbjct: 179 VIKCGYTVLSGTLSLKEGDPSEIKKQMDEYSMARKTKQPLELPSAGSTFKRPKGYFAGKL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           I+ +G RG + GGA++S+ HC F++N +NAT  D+  L E V+K V  + G+ LE E+KR
Sbjct: 239 IDDAGLRGYQVGGARVSDKHCGFVVNQENATAKDVLQLIEDVQKTVKEKFGVDLEPEVKR 298

Query: 303 LGDF 306
           +G F
Sbjct: 299 VGKF 302


>gi|260755151|ref|ZP_05867499.1| UDP-N-acetylmuramate dehydrogenase [Brucella abortus bv. 6 str.
           870]
 gi|260762196|ref|ZP_05874539.1| UDP-N-acetylmuramate dehydrogenase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|261214413|ref|ZP_05928694.1| UDP-N-acetylmuramate dehydrogenase [Brucella abortus bv. 3 str.
           Tulya]
 gi|260672628|gb|EEX59449.1| UDP-N-acetylmuramate dehydrogenase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675259|gb|EEX62080.1| UDP-N-acetylmuramate dehydrogenase [Brucella abortus bv. 6 str.
           870]
 gi|260916020|gb|EEX82881.1| UDP-N-acetylmuramate dehydrogenase [Brucella abortus bv. 3 str.
           Tulya]
          Length = 321

 Score =  232 bits (592), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 161/310 (51%), Positives = 208/310 (67%)

Query: 4   GRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIP 63
             + + L  R   LRG+   +  + +ITWFR GG A+V+FQP D  DL  FL  +P +IP
Sbjct: 5   EALLKKLDGRLSGLRGRLTPDTGMDKITWFRAGGPAQVLFQPSDEEDLSAFLKAVPEEIP 64

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           + +VG+GSN+LVRD G+ G V+RLS  GF  +E     ++  GA    K +A +AL  G+
Sbjct: 65  LLVVGIGSNLLVRDGGVPGFVVRLSAKGFGEVEQVCDTQLRAGAAAPDKRVAAAALEAGL 124

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            GFHF++GIPG IGGA  MNAGAN  ET + VVEV  +DRKG  HV+    + Y YR S 
Sbjct: 125 AGFHFYHGIPGGIGGALRMNAGANGVETRERVVEVRALDRKGEVHVLSNADMGYAYRHSS 184

Query: 184 ITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            + DLI T V+  G P  ++ I  A+  V HHRETVQP++EKTGGSTFKN  G SAW+ I
Sbjct: 185 ASPDLIFTSVLFEGVPGERDDIRRAMDEVQHHRETVQPVREKTGGSTFKNSEGTSAWKEI 244

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           +K+GCRGL  GGA++SE+HCNFMIN  NATG+DLE LGE VR +VF  SGI L WEIKRL
Sbjct: 245 DKAGCRGLRVGGAQMSEMHCNFMINTGNATGHDLETLGETVRARVFENSGIRLHWEIKRL 304

Query: 304 GDFFDHQIVD 313
           G F + + ++
Sbjct: 305 GLFREGEQIE 314


>gi|258511262|ref|YP_003184696.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
 gi|257477988|gb|ACV58307.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
          Length = 316

 Score =  232 bits (592), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 103/296 (34%), Positives = 152/296 (51%), Gaps = 2/296 (0%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKY-FLTLLPSDIPITIVGLGSNILVRDA 78
           K     P+K+ T +R GG A+   +P  +  L+          +PIT++G GSN LV D 
Sbjct: 16  KVIRGEPMKRHTTWRIGGPADYFVEPDSVDALRASVCAARDHGLPITVIGRGSNTLVLDG 75

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIRG+V++L +A  S     + C +   A  S  +LAN A+RHG+ G  F  GIPGS+GG
Sbjct: 76  GIRGLVIKLHDAFASCEVREDECAVYAMAGRSYVALANLAIRHGLSGLEFATGIPGSVGG 135

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL-IITHVVLRG 197
           A  MNAGA   ET + +     +D  G    +  E L++ YR S +     I+T    + 
Sbjct: 136 AVMMNAGAYGRETCEVLAWAEVMDETGAIARLSNEDLRFGYRYSVLKDRFGIVTWAKFQL 195

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P  ++ +   +      R   QP+     GS F+NP G  A +LIE++G +GL  G A 
Sbjct: 196 KPGDRDEMRRVVREWSQRRIATQPLSFPNCGSVFRNPEGTHAARLIEEAGLKGLRRGQAM 255

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVD 313
           IS+ H NF+IN  NA+  D+ +L    +  V  + GI LE E++ LG+       D
Sbjct: 256 ISDKHANFIINLGNASASDVLWLIRHAQSVVRERFGIALETEVRVLGEPLLGGADD 311


>gi|291549785|emb|CBL26047.1| UDP-N-acetylmuramate dehydrogenase [Ruminococcus torques L2-14]
          Length = 301

 Score =  232 bits (591), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 100/289 (34%), Positives = 155/289 (53%), Gaps = 4/289 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDA 78
              ++ P+K+ T FR GG A+    P+   +++  + L    +IP +++G GSN+LV D 
Sbjct: 15  NVMKDEPMKKHTTFRIGGPADYFVTPESKEEIQAIVELCKKEEIPYSVIGNGSNLLVGDK 74

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           G RGV+L++              ++  GA      +A +AL   + GF F  GIPG++GG
Sbjct: 75  GYRGVILQIFKKMNQIRVEE--NKIYAGAGALLSKIAATALSESLTGFEFAAGIPGTLGG 132

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLRG 197
           A  MNAGA   E  Q +  V  +   G    IP E++   YR+S +  K+ I+   V+  
Sbjct: 133 AVRMNAGAYGGEMKQVLESVEVMTVDGEFLTIPVEEMGLAYRTSVVEQKNYIVLEAVISL 192

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
              +   I   + ++   R T QP++  + GSTFK P G+ A +LIE +G RG   G A+
Sbjct: 193 EKGNPEKIKEVMDDLKEKRVTKQPLEYASAGSTFKRPEGYFAGKLIEDAGLRGFRVGDAQ 252

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           +SE HC F+IN  NA+  ++  L  QV  KV   SG+ LE E++R+G+F
Sbjct: 253 VSEKHCGFVINRGNASAAEVMELMRQVEDKVEENSGVRLEAEVRRIGEF 301


>gi|238018787|ref|ZP_04599213.1| hypothetical protein VEIDISOL_00645 [Veillonella dispar ATCC 17748]
 gi|237864553|gb|EEP65843.1| hypothetical protein VEIDISOL_00645 [Veillonella dispar ATCC 17748]
          Length = 309

 Score =  232 bits (591), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 101/304 (33%), Positives = 162/304 (53%), Gaps = 5/304 (1%)

Query: 5   RISRLLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DI 62
            I  L     K+L   + +E   L   T F+ GG A++  +P  + +L + L  +    +
Sbjct: 7   NIEALKTALLKELPSTRVREQELLCNHTTFKIGGPADLFIEPTTMAELSFTLRTIHELKV 66

Query: 63  PITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHG 122
           P+T++G GSNILV+D GIR     +S    + I   N   + +G+    K  +  A  +G
Sbjct: 67  PVTVIGCGSNILVKDGGIR--GAVVSVRHMTQIMDCNDNVLCIGSGYMLKDASEFAWENG 124

Query: 123 IGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS 182
           + G  F  GIPG++GGA +MNAGA + E S  V  V  +D +GN        L + YR S
Sbjct: 125 LSGLEFAIGIPGTLGGAVFMNAGAYDGEMSHVVTSVLAVDFEGNIKEYDASHLDFAYRHS 184

Query: 183 EITKDLIITHVVLR-GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
               +  +   V+    P  ++ I A +  +   RE+ QP++  + GSTFK P G+ A  
Sbjct: 185 VFHDNHEVIGEVVMTLKPGDKDAIKARMDELTEKRESKQPLEYASAGSTFKRPPGYFAGT 244

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           LIE++G +GL  G A++S  H  F+IN  NA   D+  L ++V+K+V++Q G+ LE E++
Sbjct: 245 LIEQTGLKGLSVGDAQVSHKHAGFVINTGNAKAKDVLDLIKEVQKRVYDQHGVHLEPEVR 304

Query: 302 RLGD 305
            +G+
Sbjct: 305 MIGE 308


>gi|297617273|ref|YP_003702432.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Syntrophothermus
           lipocalidus DSM 12680]
 gi|297145110|gb|ADI01867.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Syntrophothermus
           lipocalidus DSM 12680]
          Length = 299

 Score =  231 bits (590), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 98/306 (32%), Positives = 153/306 (50%), Gaps = 10/306 (3%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS- 60
           +Y  I +++ E         + + P+K  T FR GG A+ M  P  +  +   ++   + 
Sbjct: 1   MYEDIKQVIPEAY------VRWDEPMKNHTSFRIGGPADCMVFPSSVEQVNQVISWCRNR 54

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           D+P  ++G G+NILVRD GIRGVV++L+              +   A      ++  A  
Sbjct: 55  DVPFLVIGSGTNILVRDKGIRGVVIKLAERLSGLAVEGQS--IYAEAGVLLSHVSQLAAE 112

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
            G+ G  F  GIPGS+GGA YMNAGA + E    + EV  +D +GN  V+   +  + YR
Sbjct: 113 KGLSGLEFAEGIPGSVGGAVYMNAGAYDGEMKNVIYEVTALDSEGNLAVLTSGECDFDYR 172

Query: 181 SSEITKD-LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
            S   ++  +I    +   P     I+A +      R   QP++  + GS F+ P G+  
Sbjct: 173 KSIFQRNGYVILAARMLLKPGDTREITAKMNEFAERRRQKQPLEFPSAGSVFRRPEGYFV 232

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
             LIE+ G +G   GGA+IS  H  F+IN   AT  D+  L E V+ +V   +G+ LE E
Sbjct: 233 GPLIEELGLKGYHIGGAEISTKHAGFIINTGGATAEDVLALIELVQARVRESTGLNLEPE 292

Query: 300 IKRLGD 305
           I+ +G+
Sbjct: 293 IRIVGE 298


>gi|114704919|ref|ZP_01437827.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Fulvimarina pelagi
           HTCC2506]
 gi|114539704|gb|EAU42824.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Fulvimarina pelagi
           HTCC2506]
          Length = 320

 Score =  231 bits (590), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 160/310 (51%), Positives = 209/310 (67%)

Query: 4   GRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIP 63
             +   LR R K  RG+   N  + ++TWFR GG AEV+  P D  DL   +  +P+++P
Sbjct: 5   EALLEDLRGRAKNFRGRLSANAGMDKVTWFRVGGPAEVLAMPADEDDLGLLMAAIPAEVP 64

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           + +VG+GSN+LVRD GI GVV+RLS  GF   E  +   +I G  C  K +A +AL+ G+
Sbjct: 65  VRVVGIGSNLLVRDGGIPGVVIRLSAKGFGMAEQVSETRLIAGTACPDKRVAATALQAGL 124

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            GFHF++GIPGSIGGA  MNAGAN  ET + VVEVH IDR+G +HV+  +++ Y YR S 
Sbjct: 125 DGFHFYHGIPGSIGGALRMNAGANGVETRERVVEVHAIDRRGGKHVLSNDEMGYAYRHSS 184

Query: 184 ITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            ++DL+ T  +  G       I   +  V HHRETVQP+KEKTGGSTFKNP G SAW+ +
Sbjct: 185 ASEDLVFTRALFEGPRGDAAEIQRKMDEVQHHRETVQPVKEKTGGSTFKNPEGTSAWKEV 244

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           +K+GCRGL+ G A++SE+HCNFMIN   ATGYDLE LGE VR +V   SGI LEWEIKR+
Sbjct: 245 DKAGCRGLKVGEAQMSEMHCNFMINTGEATGYDLETLGETVRDRVRKTSGITLEWEIKRI 304

Query: 304 GDFFDHQIVD 313
           G+F D + V 
Sbjct: 305 GEFIDGRTVK 314


>gi|254419085|ref|ZP_05032809.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brevundimonas sp.
           BAL3]
 gi|196185262|gb|EDX80238.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brevundimonas sp.
           BAL3]
          Length = 304

 Score =  231 bits (589), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 127/298 (42%), Positives = 174/298 (58%), Gaps = 5/298 (1%)

Query: 11  RERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLG 70
           R++   +RGK   + PL   TWFR GG AE +F P D  DL  FL  L   +P+T++G+G
Sbjct: 4   RDKLPTVRGKLLRDEPLAPFTWFRVGGTAEALFIPADAEDLADFLKALDEAVPVTVLGVG 63

Query: 71  SNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFY 130
           SN++VRD G+ GVV+RL+   ++ +                  +A ++ + GI G  F+ 
Sbjct: 64  SNVIVRDGGVEGVVIRLAGRPWAQVTTDGDAITAGT-GVLDSMVAKASAKAGIAGLEFYA 122

Query: 131 GIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLII 190
           GIPG++GGA  MNAG    ET   +V   G++RKG +         Y YR SE   D+I 
Sbjct: 123 GIPGTVGGALTMNAGCYGAETKDVLVSAWGLNRKGERVDYALADFGYTYRHSEAPADIIW 182

Query: 191 THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRG 250
              V RG P+    + A I  +   RET QPI+EKTGGSTFKNP GHS+W+L++++G RG
Sbjct: 183 VEAVYRGTPDEPAAVQARIDEITSRRETTQPIREKTGGSTFKNPPGHSSWKLVDEAGWRG 242

Query: 251 L----EFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
                  GGA  S+LH NFMIN   AT  D+E LGE VR  V  ++G+ L+WEIKR+G
Sbjct: 243 KLHAETGGGAMFSDLHSNFMINPGEATAADIEGLGEAVRADVLAKTGVQLDWEIKRIG 300


>gi|163815356|ref|ZP_02206731.1| hypothetical protein COPEUT_01520 [Coprococcus eutactus ATCC 27759]
 gi|158449330|gb|EDP26325.1| hypothetical protein COPEUT_01520 [Coprococcus eutactus ATCC 27759]
          Length = 307

 Score =  231 bits (589), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 95/289 (32%), Positives = 148/289 (51%), Gaps = 4/289 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDA 78
               + P+ + T FR GGNA+   +P +  ++   + +    +IP  I+G GSN+LV D 
Sbjct: 21  NVHTDEPMSRHTTFRIGGNADYFVKPGNADEVAAVIVVCREYNIPYFILGNGSNLLVSDD 80

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           G RG+++ + +   S         +   A      ++  A  + + G  F  GIPG+IGG
Sbjct: 81  GYRGMIINIMDNMDSVTVDGR--IITAQAGAMLVRVSVMARDNALTGLEFASGIPGTIGG 138

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL-IITHVVLRG 197
           A YMNAGA   E    V  V  ID  G  + +  E++ + YR S + +   I+  V L  
Sbjct: 139 AVYMNAGAYGGEMKNVVKTVRAIDEYGRIYELDSEKMDFSYRHSIVEERKLIVLEVTLEL 198

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
              S+  I   +  +   R + QP++  + GSTFK P G+ A +LI  +G RG   GGA+
Sbjct: 199 EHGSREAIDDRMKELAEARRSKQPLEYPSAGSTFKRPEGYFAGKLIMDAGLRGYSVGGAQ 258

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           ++E HC F+IN   AT  D+  L   V+  V ++ G+ LE E+K LG+F
Sbjct: 259 VAEKHCGFVINKGGATASDVVELIRDVQHDVDDKFGVTLEPEVKMLGEF 307


>gi|153816327|ref|ZP_01968995.1| hypothetical protein RUMTOR_02579 [Ruminococcus torques ATCC 27756]
 gi|317500790|ref|ZP_07959004.1| UDP-N-acetylmuramate dehydrogenase [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|145846380|gb|EDK23298.1| hypothetical protein RUMTOR_02579 [Ruminococcus torques ATCC 27756]
 gi|316897799|gb|EFV19856.1| UDP-N-acetylmuramate dehydrogenase [Lachnospiraceae bacterium
           8_1_57FAA]
          Length = 305

 Score =  231 bits (589), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 99/307 (32%), Positives = 153/307 (49%), Gaps = 6/307 (1%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS- 60
           I+  + + L E   +  G   ++ P+K  T FR GG A+   QP  I +++  + +    
Sbjct: 3   IFMELYKALCEISGE--GNVLKDEPMKMHTTFRIGGPADYFIQPSKIEEIRRIVAVCREC 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
             P  I+G GSN+LV D G RGV++++                   A       A  A  
Sbjct: 61  STPYYIMGNGSNLLVGDKGFRGVIVQVFKQMSDVYADGERVY--AQAGALLSKTAAVACE 118

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             + G  F  GIPG++GGA  MNAGA   E  Q V     +  +G    +  E+L   YR
Sbjct: 119 ASLTGMEFASGIPGTLGGALRMNAGAYGGEMKQIVESAEVLTSEGEVLNLTNEELGMGYR 178

Query: 181 SSEITKDLII-THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
           +S I K+  +    VL+     +  I A + ++   R T QP++  + GSTFK P G+ A
Sbjct: 179 TSVIAKNDYVALSAVLKLEKGDRQEIRAYMEDLKERRVTKQPLEFGSAGSTFKRPEGYFA 238

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LI+ SG +G   G A++SE HC F+IN  NAT  ++  L + V  +V  + G+ LE E
Sbjct: 239 GKLIQDSGMQGYRVGDAQVSEKHCGFVINRGNATAAEVMQLMKDVADRVEEKFGVRLEPE 298

Query: 300 IKRLGDF 306
           ++R+G+F
Sbjct: 299 VRRIGEF 305


>gi|253580613|ref|ZP_04857877.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251847984|gb|EES75950.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 306

 Score =  231 bits (588), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 108/308 (35%), Positives = 162/308 (52%), Gaps = 6/308 (1%)

Query: 3   YGRISRLLRERGKQLRG--KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
              +++ + E+   L G  K + + P+K+ T FR GG A+    P    +L   L +  +
Sbjct: 1   MKSVNQNIIEKFNDLLGEEKVKVDEPMKRHTTFRIGGPADYFLLPSSEEELSGILKICKN 60

Query: 61  D-IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
           + +P  I+G GSN+LV D G RGV+++L              E+   A      +A +A 
Sbjct: 61  EELPYFILGNGSNLLVSDEGYRGVIIQLYRNYGDI--TVKGNEIHATAGALLSQIAAAAK 118

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
              + GF F  GIPG++GGA  MNAGA   E    + EV  +   G   V+P E+L+  Y
Sbjct: 119 NASLTGFEFAGGIPGTLGGAVVMNAGAYGGEMKDVLKEVTVMTAAGEILVLPAEKLEMGY 178

Query: 180 RSSEIT-KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R+S +  K  ++   V+     +Q  I A +  +   R + QP++  + GSTFK P G+ 
Sbjct: 179 RTSLVKTKGYLVLSAVIVLEQGNQEAIKARMKELTEQRISKQPLEFPSAGSTFKRPEGYF 238

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI  +G RG + GGA++SE HC F+IN DNAT  D+  L   V+ KV  Q G+ LE 
Sbjct: 239 AGKLIMDAGLRGYQTGGAQVSEKHCGFVINKDNATAADVCRLLRDVQDKVKEQFGVTLEP 298

Query: 299 EIKRLGDF 306
           E+K LG F
Sbjct: 299 EVKFLGKF 306


>gi|313893157|ref|ZP_07826734.1| UDP-N-acetylmuramate dehydrogenase [Veillonella sp. oral taxon 158
           str. F0412]
 gi|313442510|gb|EFR60925.1| UDP-N-acetylmuramate dehydrogenase [Veillonella sp. oral taxon 158
           str. F0412]
          Length = 310

 Score =  231 bits (588), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 102/304 (33%), Positives = 165/304 (54%), Gaps = 5/304 (1%)

Query: 5   RISRLLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DI 62
            I  L     ++L   + +E   L   T F+ GG A++  +P  + +L + L  +    +
Sbjct: 8   NIKALKEALLEKLPSTRVREQELLCHHTTFKIGGPADLFIEPTTMDELSFTLRTIHELQV 67

Query: 63  PITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHG 122
           P+TI+G GSNILV+D GIRG V+ +     + I   N   + +G+    K  +  A  +G
Sbjct: 68  PVTIIGCGSNILVKDGGIRGAVVSVR--HMTQIMDCNDNVLCIGSGYMLKDASEFAWENG 125

Query: 123 IGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS 182
           + G  F  GIPG++GGA +MNAGA + E S  V  V  +D +GN        L + YR S
Sbjct: 126 LSGLEFAIGIPGTLGGAVFMNAGAYDGEMSNVVTTVRAVDFQGNIKEYDASHLDFGYRHS 185

Query: 183 EITKDLIITHVVLR-GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
               +  +   V+    P  ++ I A +  +   RE+ QP++  + GSTFK P G+ A  
Sbjct: 186 VFHDNHEVIGEVIMTLQPGDKDAIKARMDELTEKRESKQPLEYASAGSTFKRPPGYFAGT 245

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           LIE++G +GL  G A++S+ H  F+IN  NA   D+  L ++V+K+V++Q G+ LE E++
Sbjct: 246 LIEQTGLKGLSVGDAQVSQKHAGFVINTGNAKAKDVLDLIKEVQKRVYHQHGVHLEPEVR 305

Query: 302 RLGD 305
            +G+
Sbjct: 306 MIGE 309


>gi|303241085|ref|ZP_07327594.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acetivibrio
           cellulolyticus CD2]
 gi|302591345|gb|EFL61084.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acetivibrio
           cellulolyticus CD2]
          Length = 314

 Score =  230 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 95/304 (31%), Positives = 156/304 (51%), Gaps = 6/304 (1%)

Query: 7   SRLLRERGKQLRGK--FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIP 63
             +  E  + L GK   + + P+K+ T F+ GG A+++  P  +  L   + L    ++P
Sbjct: 13  KEMFLELLENLVGKENIKVDEPMKRHTSFKIGGPADLLITPASVSQLGELIKLCNRQNLP 72

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           I I+G G+N+LV D GIR   + +      N        +          L+  AL + +
Sbjct: 73  IFIMGNGTNLLVSDKGIR--GVVIKIYDNLNGYTVKEDCIEAYGGILLSKLSGIALENEL 130

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            G  F  GIPG++GGA  MNAGA   E    V+E   ID+ G+  V+  ++ ++ YR+S 
Sbjct: 131 AGLEFASGIPGTLGGAVAMNAGAYGGEIKDVVIETEFIDKDGDIKVLRGDEHQFGYRTSF 190

Query: 184 ITKDL-IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
           I K   I+   +++     +  I   I ++   R+  QP++  + GS FK P G+ A +L
Sbjct: 191 IQKQSGIVVRSIIKLKKGDKTSIKTLIDDLTGRRKDKQPLEMPSAGSVFKRPEGYFAGKL 250

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IE  G RG   GGA++S+ HC F++N  NAT  D+  L   ++K V ++    L+ EI+ 
Sbjct: 251 IEDCGLRGYSIGGAQVSDKHCGFIVNTGNATSKDIMDLISHIQKTVKDKFNAELQTEIRI 310

Query: 303 LGDF 306
           +GD+
Sbjct: 311 VGDY 314


>gi|226325343|ref|ZP_03800861.1| hypothetical protein COPCOM_03136 [Coprococcus comes ATCC 27758]
 gi|225206086|gb|EEG88440.1| hypothetical protein COPCOM_03136 [Coprococcus comes ATCC 27758]
          Length = 303

 Score =  230 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 104/289 (35%), Positives = 157/289 (54%), Gaps = 4/289 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDA 78
           K Q++ P+K+ T FR GG A+    P +  +L   + +     IPI IVG GSN+LV D 
Sbjct: 17  KIQKDEPMKKHTTFRIGGPADYFIMPSNEKELAETIRVCREFSIPIYIVGNGSNLLVGDK 76

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           G RG +++L  +  +        ++   A CS   +AN+AL   + GF F  GIPG++GG
Sbjct: 77  GFRGAIIQLYKSMGTF--QVEGNQITAQAGCSLAQIANAALDAALTGFEFAAGIPGTLGG 134

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLII-THVVLRG 197
           A  MNAGA   E    +  V  +  +G    +P E+L   YR+S I +   I    V+  
Sbjct: 135 AVVMNAGAYGGEMKDVLTSVRVMTEEGEIMELPAEKLGLGYRTSIIPEKRYIVLGAVISL 194

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
               +  I A + ++   R + QP++  + GSTFK P G+ A +LI+ SG +G   GGA+
Sbjct: 195 TEGKKEEIKAQMDDLRQKRVSKQPLEYPSAGSTFKRPEGYFAGKLIQDSGLKGFTVGGAQ 254

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           +SE H  F+IN  NAT  D+  L  QV  KV   +G+ +E E+K++G+F
Sbjct: 255 VSEKHSGFVINKGNATAADVMELIRQVTAKVKEDTGVTMEPEVKQIGEF 303


>gi|218289900|ref|ZP_03494090.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Alicyclobacillus
           acidocaldarius LAA1]
 gi|218240040|gb|EED07226.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Alicyclobacillus
           acidocaldarius LAA1]
          Length = 316

 Score =  230 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 102/296 (34%), Positives = 153/296 (51%), Gaps = 2/296 (0%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDA 78
           K     P+K+ T +R GG A+   +P  ++ L+  +       +PIT++G GSN LV D 
Sbjct: 16  KVIRGEPMKRHTTWRIGGPADYFVEPDSVNALRASVCAARAHGLPITVIGRGSNTLVLDG 75

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIRG+V++L +A  S     + C +   A  S  +LAN A+RHG+ G  F  GIPGS+GG
Sbjct: 76  GIRGLVIKLHDAFASYEVKEDECAVYAMAGRSYVALANLAIRHGLSGLEFATGIPGSVGG 135

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL-IITHVVLRG 197
           A  MNAGA   ET + +     +D  G    +    L++ YR S +     I+T    + 
Sbjct: 136 AVMMNAGAYGRETCEVLAWAEVMDETGAITRLSNGDLRFGYRYSVLKDRFGIVTWAKFQL 195

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P  ++ +   +      R   QP+     GS F+NP G  A +LIE++G +GL  G A 
Sbjct: 196 KPGDRDEMRRVVREWSQRRIATQPLSFPNCGSVFRNPEGTHAARLIEEAGLKGLRRGQAM 255

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVD 313
           IS+ H NF+IN  NA+  D+ +L    +  V  + GI LE E++ LG+       D
Sbjct: 256 ISDKHANFIINLGNASASDVLWLIRHAQAVVRERFGIALETEVRVLGEPLLGGADD 311


>gi|149186200|ref|ZP_01864514.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Erythrobacter sp.
           SD-21]
 gi|148830231|gb|EDL48668.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Erythrobacter sp.
           SD-21]
          Length = 323

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 116/288 (40%), Positives = 175/288 (60%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           L+GK   + PL ++ WF++GG A+ +F+P+D+ DLK FL  L  D+P+  +GLGSN++VR
Sbjct: 34  LKGKLTPDAPLAKLVWFKSGGKADWLFEPEDLADLKEFLRRLDGDLPVMALGLGSNMIVR 93

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ GVV++L             C +  G    G  +A++A   G+ G  F  GIPG++
Sbjct: 94  DGGVPGVVIKLGKPFADVAIDDESCVVDCGGGAHGILVASAARDCGVAGLEFMRGIPGTV 153

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GG   MN GA   E S  +++   +   G  H +P   L+Y YR S +    ++     +
Sbjct: 154 GGFVRMNGGAYGREVSDVLIDCEVVMPDGQFHTLPASDLQYSYRHSALPAGAVVIRARFK 213

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G P    +I A +  +   RE  QP++ KTGGSTFKNP G  AW+L++ +GCRGL  GGA
Sbjct: 214 GEPGDPEVIGAKMDEIAGARENSQPLRTKTGGSTFKNPPGRKAWELVDAAGCRGLTMGGA 273

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           ++SE H NF++N  +AT  D+E LGE+V+++V+  SG+ LEWEI+R+G
Sbjct: 274 QVSEKHTNFLLNTGDATSADIEGLGEEVKRRVYEHSGVELEWEIQRVG 321


>gi|154244281|ref|YP_001415239.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Xanthobacter
           autotrophicus Py2]
 gi|154158366|gb|ABS65582.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Xanthobacter
           autotrophicus Py2]
          Length = 345

 Score =  230 bits (585), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 131/302 (43%), Positives = 182/302 (60%), Gaps = 2/302 (0%)

Query: 3   YGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDI 62
           +  +   L+ R   LRG  + N PL + TWFR GG A+V+F P D  DL  FL  LP+++
Sbjct: 41  FEDLVPGLKARLPGLRGSLKANAPLAEFTWFRAGGPAQVLFVPADEDDLATFLAGLPAEV 100

Query: 63  PITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHG 122
           P+T++GLGSN++VRD G+ GVV+RL+              +I GA      +A +A   G
Sbjct: 101 PVTVIGLGSNLIVRDGGVPGVVIRLARGFTDIAV--EGNRIIAGAGVPDVKVARAAADAG 158

Query: 123 IGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS 182
           + GF F  GIPG++GGA  MN GA   ET   +V    + R G +      ++ + YR  
Sbjct: 159 LAGFSFLRGIPGAVGGALRMNGGAYGGETKDVLVSADAVTRAGAKVRFTNAEMGFTYRHC 218

Query: 183 EITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
            +  D++ T  V  G P    +I+A +A +   RE  QPIK +TGGSTFKNP G SAW+L
Sbjct: 219 GVPADVVFTRAVFEGRPGDPAVIAAEMAKITESREATQPIKSRTGGSTFKNPPGTSAWKL 278

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           ++ +GCRGL  G A++SELH NF+IN   AT  ++E LGE+VR++V  Q GI LEWEIKR
Sbjct: 279 VDAAGCRGLTIGRAQVSELHTNFLINLGGATAAEIEGLGEEVRRRVKAQCGIELEWEIKR 338

Query: 303 LG 304
           +G
Sbjct: 339 IG 340


>gi|121535180|ref|ZP_01666996.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermosinus
           carboxydivorans Nor1]
 gi|121306289|gb|EAX47215.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermosinus
           carboxydivorans Nor1]
          Length = 308

 Score =  230 bits (585), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 99/302 (32%), Positives = 155/302 (51%), Gaps = 9/302 (2%)

Query: 11  RERGKQLRG-----KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPI 64
           +E   +L+      + + + P+ Q T F  GG A+  F P    ++   L L     +P+
Sbjct: 8   QEFLSKLKSIASADRVRTDEPMSQHTTFHIGGPADFFFVPASTGEVAAALALAAKFGLPV 67

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T++G GSN+LV D GIRG+V++                +  GA  S   ++  A R G+ 
Sbjct: 68  TVLGNGSNVLVLDKGIRGLVIKFDEHMG--YIRHTGALIYAGAGASLGDVSRYAARQGLT 125

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGSIGGA +MNAGA   E    V  V  +   G      + ++ + YR S  
Sbjct: 126 GMEFAVGIPGSIGGAVFMNAGAYGGEMGNVVAAVTAVCPDGTLKRFTKAEIDFGYRHSVF 185

Query: 185 TKDLIITHVVL-RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            ++  +   V     P S   IS+ +A   + RE  QP++  + GSTFK P G+ A  LI
Sbjct: 186 QENKCVICEVELALKPGSPAEISSKMAEYTNRREAKQPVEMPSAGSTFKRPPGYYAGTLI 245

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           E++G +GL  GGA++SE H  F+INA  AT  D+  L  +V+++V  +  + L+ E++ +
Sbjct: 246 EQTGLKGLRIGGAQVSEKHAGFIINAGGATAQDVLALIREVQRRVQEKFDVRLQPEVRII 305

Query: 304 GD 305
           G+
Sbjct: 306 GE 307


>gi|256061486|ref|ZP_05451630.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella neotomae
           5K33]
 gi|261325493|ref|ZP_05964690.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella neotomae
           5K33]
 gi|261301473|gb|EEY04970.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella neotomae
           5K33]
          Length = 322

 Score =  230 bits (585), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 162/315 (51%), Positives = 210/315 (66%), Gaps = 2/315 (0%)

Query: 1   MIYG--RISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL 58
           M+     + + L  R   LRG+   +  + +ITWFR GG A+V+FQP D  DL  FL  +
Sbjct: 1   MMESGEALLKKLDGRLSGLRGRLTPDTGMDKITWFRAGGPAQVLFQPSDEEDLSAFLKAV 60

Query: 59  PSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSA 118
           P +IP+ +VG+GSN+LVRD G+ G V+RLS  GF  +E     ++  GA    K +A +A
Sbjct: 61  PEEIPLLVVGIGSNLLVRDGGVPGFVVRLSAKGFGEVEQVCDTQLRAGAAAPDKRVAAAA 120

Query: 119 LRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQ 178
           L  G+ GFHF++GIPG IGGA  MNAGAN  ET + VVEV  +DRKG  HV+    + Y 
Sbjct: 121 LEAGLAGFHFYHGIPGGIGGALRMNAGANGVETRERVVEVRALDRKGEVHVLSNADMGYA 180

Query: 179 YRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           YR S  + DLI T V+  G P  ++ I  A+  V HHRETVQP++EKTGGSTFKNP G S
Sbjct: 181 YRHSSASPDLIFTSVLFEGVPGERDDIRRAMDEVQHHRETVQPVREKTGGSTFKNPEGTS 240

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           AW+ I+K+GCRGL  GGA++SE+HCNFMIN  NA G+DLE LGE VR +VF  SGI L W
Sbjct: 241 AWKEIDKAGCRGLRVGGAQMSEMHCNFMINTGNAAGHDLETLGETVRARVFENSGIRLHW 300

Query: 299 EIKRLGDFFDHQIVD 313
           EIKRLG F + + ++
Sbjct: 301 EIKRLGLFREGEQIE 315


>gi|153852656|ref|ZP_01994093.1| hypothetical protein DORLON_00066 [Dorea longicatena DSM 13814]
 gi|149754298|gb|EDM64229.1| hypothetical protein DORLON_00066 [Dorea longicatena DSM 13814]
          Length = 310

 Score =  230 bits (585), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 104/307 (33%), Positives = 159/307 (51%), Gaps = 6/307 (1%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PS 60
           +   + + L    K+   + +++ P+K  T FR GG A+    PQ   ++   +      
Sbjct: 8   MNQELGKKLLSILKE--EQVKKDEPMKSHTTFRVGGPADYFVTPQTAEEVAKVIEACTQE 65

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
            +P  IVG GSN+LV D G  GV++++              ++   A      +A  AL 
Sbjct: 66  KVPYYIVGNGSNLLVSDKGYEGVIIQIYKQMNQVKV--EGAQIHAQAGALLSMIAKRALD 123

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             + GF F  GIPG++GGA  MNAGA   E    +  V  +  KG    + +E+L+  YR
Sbjct: 124 AELTGFEFAAGIPGTLGGACVMNAGAYGGEMKDVLKSVTVLTGKGEVKTLAKEELELGYR 183

Query: 181 SSEI-TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
           +S I  K  I+   VL      +  I A + ++   R T QP++  + GSTFK P G+ A
Sbjct: 184 TSVIAKKGYIVLEAVLELQKGEKEKIQAVMDDLKERRVTKQPLEYPSAGSTFKRPEGYFA 243

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LI+ +G RG + GGA++SE HC F+IN D AT  D+  L  QV  KV+ + G+ L+ E
Sbjct: 244 GKLIQDAGLRGFQVGGAQVSEKHCGFVINKDQATASDVMNLMNQVSDKVYEEFGVRLQPE 303

Query: 300 IKRLGDF 306
           +KRLG+F
Sbjct: 304 VKRLGEF 310


>gi|167768137|ref|ZP_02440190.1| hypothetical protein CLOSS21_02692 [Clostridium sp. SS2/1]
 gi|167709661|gb|EDS20240.1| hypothetical protein CLOSS21_02692 [Clostridium sp. SS2/1]
 gi|291560166|emb|CBL38966.1| UDP-N-acetylmuramate dehydrogenase [butyrate-producing bacterium
           SSC/2]
          Length = 302

 Score =  230 bits (585), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 97/304 (31%), Positives = 156/304 (51%), Gaps = 5/304 (1%)

Query: 6   ISRLLRERGKQLRGK-FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIP 63
           +   + +  + +  K      P+K  T FR GG A++   P+++ ++K          IP
Sbjct: 1   MDTKIDQLKQIIPEKYILRQEPMKNHTTFRIGGPADIFVAPENMEEIKAVSRFAKEEGIP 60

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           + ++G GSN+LV D G     + L      +       E+IV A     S + +AL   +
Sbjct: 61  LFVLGNGSNLLVADDG--MDGIVLQIYKNYSGIEVRGNELIVKAGTLLSSTSRAALNEEL 118

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            GF F  GIPG+ GGA  MNAGA   E  Q + EV  + ++G    +  E+L+  YR+S 
Sbjct: 119 TGFEFAGGIPGTFGGAVVMNAGAYGGEMVQVLKEVTVLTKEGEIKTLKAEELELGYRTSN 178

Query: 184 -ITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
            +  + ++   V+     ++  I A +      R+T QP++  + GSTFK P G+ A +L
Sbjct: 179 VLKNEYVVLEGVIALKKGNKEEIKAKMDEYALARKTKQPLEYPSAGSTFKRPEGYFAGKL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           I+ +G +G + G A++SE H  F+IN  NAT  D+  L   V+ KV  Q G+ +E E+KR
Sbjct: 239 IQDAGLKGYQVGDAQVSEKHSGFVINRGNATASDVMQLISDVKDKVKEQFGVTMEPEVKR 298

Query: 303 LGDF 306
           +G F
Sbjct: 299 VGRF 302


>gi|209550172|ref|YP_002282089.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|254765536|sp|B5ZWJ2|MURB_RHILW RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|209535928|gb|ACI55863.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 324

 Score =  229 bits (584), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 174/309 (56%), Positives = 227/309 (73%)

Query: 4   GRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIP 63
            ++   L +  K +RG+   + P+ ++TWFR GG AE+MFQP DI DL  FL +LP ++P
Sbjct: 7   EKLLASLGDGVKDIRGRITPDAPMDRVTWFRAGGLAELMFQPHDIDDLVAFLKILPEEVP 66

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           +T++G+GSNILVRD GI GVVLRLS  GF  +E+     ++ G+ C  K +A  A+ +GI
Sbjct: 67  LTVIGVGSNILVRDGGIPGVVLRLSAKGFGFVELAGENRILAGSICPDKHVAAMAMDNGI 126

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
           GGFHFFYGIPGSIGGAA MNAGAN  ET + ++EV+ +DRKGN+HV+   ++ Y YR S 
Sbjct: 127 GGFHFFYGIPGSIGGAARMNAGANGVETRERLIEVNAVDRKGNKHVLSNAEMGYSYRHST 186

Query: 184 ITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            + +LI T V+  G+PE +  I A +  V +HRETVQP++EKTGGSTFKNP GHSAW+LI
Sbjct: 187 ASSELIFTSVLFEGYPEERAQIRAEMDAVRNHRETVQPVREKTGGSTFKNPAGHSAWKLI 246

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           +++GCRGL  GGA++S LHCNFMIN   ATGYDLEYLGEQVR++VF + GI LEWEIKRL
Sbjct: 247 DEAGCRGLVIGGAQMSSLHCNFMINMGQATGYDLEYLGEQVRREVFEKEGIKLEWEIKRL 306

Query: 304 GDFFDHQIV 312
           G F   + V
Sbjct: 307 GVFMPGREV 315


>gi|294792252|ref|ZP_06757400.1| UDP-N-acetylmuramate dehydrogenase [Veillonella sp. 6_1_27]
 gi|294457482|gb|EFG25844.1| UDP-N-acetylmuramate dehydrogenase [Veillonella sp. 6_1_27]
          Length = 309

 Score =  229 bits (584), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 98/302 (32%), Positives = 161/302 (53%), Gaps = 6/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           +   L E+    R   +E   L   T F+ GG A++  +P  + +L + L  +   D+P+
Sbjct: 11  LQTALLEKLPSTR--VREQELLCHHTTFKIGGPADLFIEPTTMAELSFTLRTIHELDVPV 68

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           TI+G GSNILV+D GIR     +S    + I   N   + +G+    K  +  A  + + 
Sbjct: 69  TIIGCGSNILVKDGGIR--GAVVSVRHMTQIMDCNENTLCIGSGYMLKDASEFAWENSLS 126

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPG++GGA +MNAGA + E S  V  V  +D +GN        L + YR S  
Sbjct: 127 GLEFAIGIPGTLGGAVFMNAGAYDGEMSHVVTAVRAVDFQGNIKEYDASHLDFAYRHSVF 186

Query: 185 TKDLIITHVVLR-GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
             +  +   V+    P  ++ I A +  +   RE+ QP++  + GSTFK P G+ A  LI
Sbjct: 187 HDNHEVIGEVIMTLKPGDKDTIKARMDELTEKRESKQPLEYASAGSTFKRPPGYFAGTLI 246

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           E++G +GL  G A++S  H  F+IN  +A+  D+  L  +V+++V+++ G+ LE E++ +
Sbjct: 247 EQTGLKGLSVGDAQVSHKHAGFVINTGSASAKDVLDLIAEVQRRVYDRHGVHLEPEVRMI 306

Query: 304 GD 305
           G+
Sbjct: 307 GE 308


>gi|227822649|ref|YP_002826621.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sinorhizobium fredii
           NGR234]
 gi|254765543|sp|C3MEM7|MURB_RHISN RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|227341650|gb|ACP25868.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sinorhizobium fredii
           NGR234]
          Length = 324

 Score =  229 bits (584), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 168/312 (53%), Positives = 216/312 (69%), Gaps = 3/312 (0%)

Query: 1   MIYGRISRLLRERGK---QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTL 57
           M      +LL   G     +RG+   + P+ ++TWFR GG AE+MFQP D  DL  FL L
Sbjct: 1   MKQVNGQKLLDALGNGVSAIRGRITPDAPMDRVTWFRAGGLAELMFQPHDTDDLVAFLKL 60

Query: 58  LPSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANS 117
           +P ++P+ ++G+GSN+LVRD GI GVV+RLS  GF ++E+     +  GA C  K++A  
Sbjct: 61  VPEEVPVMVIGVGSNLLVRDGGIPGVVIRLSAKGFGDLEIVGENRIKAGAICPDKNIAAM 120

Query: 118 ALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKY 177
           AL HGIGGF+F+YGIPGSIGGA  MNAGAN  ET + VVEVH +DR+GN+HV+    + Y
Sbjct: 121 ALDHGIGGFYFYYGIPGSIGGALRMNAGANGGETRERVVEVHAVDRRGNRHVLSNADMGY 180

Query: 178 QYRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGH 237
            YR +   KDLI TH +  GFPE +  I   +  V  HRETVQPI+EKTGGSTFKNP G+
Sbjct: 181 SYRHTAAAKDLIFTHAIFEGFPEDKAKIRHDMDAVRQHRETVQPIREKTGGSTFKNPEGN 240

Query: 238 SAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLE 297
           SAW+LI+++G RG+  GGA++S LHCNFMIN   A+GY+LEYLGE VR +V   SGI LE
Sbjct: 241 SAWKLIDEAGGRGMMIGGAQMSPLHCNFMINTGQASGYELEYLGETVRAQVLEHSGIKLE 300

Query: 298 WEIKRLGDFFDH 309
           WEIKR+G F   
Sbjct: 301 WEIKRIGKFMPG 312


>gi|158426184|ref|YP_001527476.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Azorhizobium
           caulinodans ORS 571]
 gi|187609722|sp|A8HZA5|MURB_AZOC5 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|158333073|dbj|BAF90558.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Azorhizobium
           caulinodans ORS 571]
          Length = 308

 Score =  229 bits (584), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 131/302 (43%), Positives = 180/302 (59%), Gaps = 2/302 (0%)

Query: 3   YGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDI 62
           +  +   L     +LRGK   N P+  +TWFR GG A+V+FQP D  DL Y L  LP++I
Sbjct: 6   FPDLVPALAAALPELRGKLTANAPIADVTWFRVGGPAQVLFQPADEADLAYALAHLPAEI 65

Query: 63  PITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHG 122
           P+T++GLGSN++VRD G+ G+V+RL               ++ GA      +A +A   G
Sbjct: 66  PVTVIGLGSNLIVRDGGVPGMVIRLGRGFTDIAVD--GTTIVAGAGVPDVKVARAAADAG 123

Query: 123 IGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS 182
           + G  F  GIPG+IGGA  MN GA   ET   ++    +DR G  H++  + + + YR S
Sbjct: 124 LAGLAFLRGIPGAIGGALRMNGGAYGGETKDALMSARAVDRAGRIHILSLDDMGFTYRHS 183

Query: 183 EITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
              +D I T    RG P     I A +  +   RE  QPIK +TGGSTFKNP GH AWQL
Sbjct: 184 AAPEDFIFTQATFRGTPGEVAEIQAEMERITSSREATQPIKSRTGGSTFKNPPGHKAWQL 243

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           ++ +GCRGL  G A++SE+H NF+IN   AT  ++E LGE+VR++V   SG+ LEWEIKR
Sbjct: 244 VDAAGCRGLVLGRAQVSEMHTNFLINLGCATAAEIEGLGEEVRRRVLETSGVTLEWEIKR 303

Query: 303 LG 304
           +G
Sbjct: 304 IG 305


>gi|125972636|ref|YP_001036546.1| UDP-N-acetylmuramate dehydrogenase [Clostridium thermocellum ATCC
           27405]
 gi|166222838|sp|A3DBM4|MURB_CLOTH RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|125712861|gb|ABN51353.1| UDP-N-acetylmuramate dehydrogenase [Clostridium thermocellum ATCC
           27405]
          Length = 305

 Score =  229 bits (584), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 93/303 (30%), Positives = 158/303 (52%), Gaps = 6/303 (1%)

Query: 7   SRLLRERGKQLRGK--FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IP 63
             LL    +++ G+   + + P+K  T F+ GG A+++  P  +  L   L L  +  +P
Sbjct: 4   KELLAREIEKIAGQENVKLDEPMKNHTSFKVGGPADILVTPVSVSQLSQILKLCKNKSVP 63

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           + ++G G+N++VRD GIRGVV+++      N        +   A      ++  A  +G+
Sbjct: 64  VFVMGNGTNLIVRDKGIRGVVVKI--FDNLNQFTVKDDIITAYAGILLSRVSTIAYENGL 121

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            G  F  GIPG++GGA  MNAGA   E    VVE   +D+ G   V+  +  ++ YR+S 
Sbjct: 122 TGLEFACGIPGTLGGAVAMNAGAYGGEMKDVVVETEYMDKDGEIRVVRDDGHQFGYRTSF 181

Query: 184 ITKDLIITHVVLR-GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
           I K+  I           ++  I A + ++   R+  QP++  + GS FK P G+ A +L
Sbjct: 182 IQKNSGIVIKTSMKLKKGNKEEIKALMDDLTQRRQEKQPLEMPSAGSIFKRPEGYFAGKL 241

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IE  G RG   GGA++S+ HC F++N  +A   D+  L E +R  V  + G+ ++ E++ 
Sbjct: 242 IEDCGLRGHRIGGAEVSQKHCGFIVNTGDAKAKDILDLIEYIRNTVKMKFGVDMQTEVRI 301

Query: 303 LGD 305
           +G+
Sbjct: 302 VGE 304


>gi|331091816|ref|ZP_08340648.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lachnospiraceae
           bacterium 2_1_46FAA]
 gi|330402715|gb|EGG82282.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lachnospiraceae
           bacterium 2_1_46FAA]
          Length = 303

 Score =  229 bits (583), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 103/303 (33%), Positives = 162/303 (53%), Gaps = 5/303 (1%)

Query: 7   SRLLRERGKQL-RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
            + L    + + + +   + P+ + T FR GG A+    P+ + +++  + L    D+P 
Sbjct: 3   RKFLDRVTEIIDKERVFTDEPMSRHTTFRIGGPADCFVCPETVDEVQKVVRLCNEMDMPF 62

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G GSN+LV D G RGV++RL           +  ++   A      +A+ A R+G+ 
Sbjct: 63  YLLGNGSNLLVGDKGFRGVIVRLYKQMDKIEV--SGTKIRAQAGALLVKVASEACRNGLT 120

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPG++GGA  MNAGA   E    + EV  + R+G    + +E+L+  YR+S +
Sbjct: 121 GLEFAGGIPGTLGGAVVMNAGAYGGEMKNVLEEVTVLTREGELLTLSKEELELGYRTSIV 180

Query: 185 -TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
             +  I    VL+   +    I   +  +   R T QP++  + GSTFK P GH A QLI
Sbjct: 181 GRRGYIALEAVLQLEKKDAKEIREYMNELREKRTTKQPLEYASAGSTFKRPEGHFAGQLI 240

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           E++G RG   G A++SE HC F+IN  NAT  D+  L  +V  KV  + G+ LE E+K+L
Sbjct: 241 EQAGLRGFRVGDAQVSEKHCGFLINRGNATAEDVVELMREVTVKVEEKFGVTLEPEVKKL 300

Query: 304 GDF 306
           G+F
Sbjct: 301 GEF 303


>gi|256004723|ref|ZP_05429699.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           thermocellum DSM 2360]
 gi|255991316|gb|EEU01422.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           thermocellum DSM 2360]
 gi|316941126|gb|ADU75160.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           thermocellum DSM 1313]
          Length = 304

 Score =  229 bits (583), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 93/303 (30%), Positives = 158/303 (52%), Gaps = 6/303 (1%)

Query: 7   SRLLRERGKQLRGK--FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IP 63
             LL    +++ G+   + + P+K  T F+ GG A+++  P  +  L   L L  +  +P
Sbjct: 3   KELLAREIEKIAGQENVKLDEPMKNHTSFKVGGPADILVTPVSVSQLSQILKLCKNKSVP 62

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           + ++G G+N++VRD GIRGVV+++      N        +   A      ++  A  +G+
Sbjct: 63  VFVMGNGTNLIVRDKGIRGVVVKI--FDNLNQFTVKDDIITAYAGILLSRVSTIAYENGL 120

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            G  F  GIPG++GGA  MNAGA   E    VVE   +D+ G   V+  +  ++ YR+S 
Sbjct: 121 TGLEFACGIPGTLGGAVAMNAGAYGGEMKDVVVETEYMDKDGEIRVVRDDGHQFGYRTSF 180

Query: 184 ITKDLIITHVVLR-GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
           I K+  I           ++  I A + ++   R+  QP++  + GS FK P G+ A +L
Sbjct: 181 IQKNSGIVIKTSMKLKKGNKEEIKALMDDLTQRRQEKQPLEMPSAGSIFKRPEGYFAGKL 240

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IE  G RG   GGA++S+ HC F++N  +A   D+  L E +R  V  + G+ ++ E++ 
Sbjct: 241 IEDCGLRGHRIGGAEVSQKHCGFIVNTGDAKAKDILDLIEYIRNTVKMKFGVDMQTEVRI 300

Query: 303 LGD 305
           +G+
Sbjct: 301 VGE 303


>gi|303230280|ref|ZP_07317047.1| UDP-N-acetylmuramate dehydrogenase [Veillonella atypica
           ACS-134-V-Col7a]
 gi|302515063|gb|EFL57038.1| UDP-N-acetylmuramate dehydrogenase [Veillonella atypica
           ACS-134-V-Col7a]
          Length = 310

 Score =  229 bits (583), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 102/304 (33%), Positives = 165/304 (54%), Gaps = 5/304 (1%)

Query: 5   RISRLLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DI 62
            I  L     K+L   + +E   L+  T F+ GG A++  +P  + +L + L  +   D+
Sbjct: 8   NIKALQTALLKELPSTRVREEEYLRHHTTFKIGGPADLFVEPTTMAELSFALRTVHEFDV 67

Query: 63  PITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHG 122
           P+TI+G GSNILV+D GIR     +S    + I   N   + +G+    K  +  A  +G
Sbjct: 68  PVTIIGCGSNILVKDGGIR--GAVVSVRHMTQIMDCNDNVLCIGSGYMLKDASEFAWENG 125

Query: 123 IGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS 182
           + G  F  GIPG++GGA +MNAGA + E S  V  V  +D +GN        L + YR S
Sbjct: 126 LTGLEFAIGIPGTLGGAVFMNAGAYDGEMSHVVTAVRAVDFQGNIKEYDASHLDFGYRHS 185

Query: 183 EITKDLIITHVVLR-GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
               +  +   V+    P  +N+I A +  +   RE+ QP++  + GSTFK P G+ A  
Sbjct: 186 VFHDNHEVIGEVIMTLKPGDKNVIKARMDELTEKRESKQPLEFASAGSTFKRPPGYFAGT 245

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           LIE++G +GL  G A++S  H  F+IN  +A+  D+  L  +V+++V++Q G+ LE E++
Sbjct: 246 LIEQTGLKGLSVGDAQVSHKHAGFVINTGSASAKDVLDLIAEVQRRVYDQHGVHLEPEVR 305

Query: 302 RLGD 305
            +G+
Sbjct: 306 MIGE 309


>gi|281416828|ref|ZP_06247848.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           thermocellum JW20]
 gi|281408230|gb|EFB38488.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           thermocellum JW20]
          Length = 304

 Score =  229 bits (583), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 94/303 (31%), Positives = 159/303 (52%), Gaps = 6/303 (1%)

Query: 7   SRLLRERGKQLRGK--FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IP 63
             LL    +++ G+   + + P+K  T F+ GG A+++  P  +  L   L L  +  +P
Sbjct: 3   KELLAREIEKIAGQENVKLDEPMKNHTSFKVGGPADILVTPVSVSQLSQILKLCKNKSVP 62

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           + ++G G+N++VRD GIRGVV+++      N        +   A      ++  A  +G+
Sbjct: 63  VFVMGNGTNLIVRDKGIRGVVVKI--FDNLNQFTVKDDIITAYAGILLSRVSTIAYENGL 120

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            G  F  GIPG++GGA  MNAGA   E    VVE   +D+ G   V+  +  ++ YR+S 
Sbjct: 121 TGLEFACGIPGTLGGAVAMNAGAYGGEMKDVVVETEYMDKDGEIRVVRDDGHQFGYRTSF 180

Query: 184 ITKDLIITHVVLR-GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
           I K+  I    L      ++  I A + ++   R+  QP++  + GS FK P G+ A +L
Sbjct: 181 IQKNSGIVIKTLMKLKKGNKEEIKALMDDLTQRRQEKQPLEMPSAGSIFKRPEGYFAGKL 240

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IE  G RG   GGA++S+ HC F++N  +A   D+  L E +R  V  + G+ ++ E++ 
Sbjct: 241 IEDCGLRGHRIGGAEVSQKHCGFIVNTGDAKAKDILDLIEYIRNTVKMKFGVDMQTEVRI 300

Query: 303 LGD 305
           +G+
Sbjct: 301 VGE 303


>gi|269798384|ref|YP_003312284.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Veillonella parvula
           DSM 2008]
 gi|269095013|gb|ACZ25004.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Veillonella parvula
           DSM 2008]
          Length = 309

 Score =  228 bits (582), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 95/288 (32%), Positives = 157/288 (54%), Gaps = 4/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDA 78
           + +E   L   T F+ GG A++  +P  + +L + L  +   D+P+TI+G GSNILV+D 
Sbjct: 23  RVREQELLCHHTTFKIGGPADLFIEPTTMAELSFTLRTIHELDVPVTIIGCGSNILVKDG 82

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIR     +S    + I   N   + +G+    K  +  A  + + G  F  GIPG++GG
Sbjct: 83  GIR--GAVVSVRHMTQIMDCNENTLCIGSGYMLKDASEFAWENSLSGLEFAIGIPGTLGG 140

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR-G 197
           A +MNAGA + E S  V  V  +D +G+        L + YR S    +  +   V+   
Sbjct: 141 AVFMNAGAYDGEMSHVVTAVRAVDFQGSIKEYDASHLDFAYRHSVFHDNHEVIGEVIMTL 200

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P  ++ I A +  +   RE+ QP++  + GSTFK P G+ A  LIE++G +GL  G A+
Sbjct: 201 KPGDKDAIKARMDELTEKRESKQPLEYASAGSTFKRPPGYFAGTLIEQTGLKGLSVGDAQ 260

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S  H  F+IN  +A+  D+  L  +V+++V++Q G+ LE E++ +G+
Sbjct: 261 VSHKHAGFVINTGSASAKDVLDLISEVQRRVYDQHGVHLEPEVRMIGE 308


>gi|303231928|ref|ZP_07318636.1| UDP-N-acetylmuramate dehydrogenase [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302513357|gb|EFL55391.1| UDP-N-acetylmuramate dehydrogenase [Veillonella atypica
           ACS-049-V-Sch6]
          Length = 310

 Score =  228 bits (582), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 101/304 (33%), Positives = 163/304 (53%), Gaps = 6/304 (1%)

Query: 4   GRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DI 62
             +   L E     R   +E   L+  T F+ GG A++  +P  + +L + L  +   D+
Sbjct: 10  KALQTALLETLPSTR--VREEEYLRHHTTFKIGGPADLFVEPTTMAELSFALRTIHEFDV 67

Query: 63  PITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHG 122
           P+TI+G GSNILV+D GIR     +S    + I   N   + +G+    K  +  A  +G
Sbjct: 68  PVTIIGCGSNILVKDGGIR--GAVVSVRHMTQIMDCNDNVLCIGSGYMLKDASEFAWENG 125

Query: 123 IGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS 182
           + G  F  GIPG++GGA +MNAGA + E S  V  V  +D +GN        L + YR S
Sbjct: 126 LTGLEFAIGIPGTLGGAVFMNAGAYDGEMSHVVTAVRAVDFQGNIKEYDASHLDFGYRHS 185

Query: 183 EITKDLIITHVVLR-GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
               +  +   V+    P  +N+I A +  +   RE+ QP++  + GSTFK P G+ A  
Sbjct: 186 VFHDNHEVIGEVIMTLKPGDKNVIKARMDELTEKRESKQPLEFASAGSTFKRPPGYFAGT 245

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           LIE++G +GL  G A++S  H  F+IN  +A+  D+  L  +V+++V++Q G+ LE E++
Sbjct: 246 LIEQTGLKGLSVGDAQVSHKHAGFVINTGSASAKDVLDLIAEVQRRVYDQHGVHLEPEVR 305

Query: 302 RLGD 305
            +G+
Sbjct: 306 MIGE 309


>gi|83858913|ref|ZP_00952435.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Oceanicaulis
           alexandrii HTCC2633]
 gi|83853736|gb|EAP91588.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Oceanicaulis
           alexandrii HTCC2633]
          Length = 307

 Score =  228 bits (582), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 131/301 (43%), Positives = 175/301 (58%), Gaps = 6/301 (1%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           L +R   +RGK  EN  L  ITW R GG A+V+F P D  DL  FL   P DI + ++G 
Sbjct: 6   LLDRLPSVRGKLIENASLADITWLRVGGPAQVLFLPADAADLARFLAETPRDIDVRVLGA 65

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
           GSN LVRD G+ GV ++L    F  +E   +  +  GA    K +A +A + GI G  F+
Sbjct: 66  GSNTLVRDGGLPGVTVKL-TPAFGKVEALENNRIRAGAAALDKMVAKAAAKAGIAGLEFY 124

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLI 189
            G+PG+IGGA  MNAG    ET   +VE   +DR G + + P E+L Y YR S+  +D I
Sbjct: 125 VGVPGAIGGALRMNAGCYGTETKDVLVEAVALDRTGRRIIAPVEELGYAYRHSDAPEDWI 184

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPT-----GHSAWQLIE 244
               V  G  +    ++  +  +   RE  QPI+EKT GSTFKNP      G SAWQL++
Sbjct: 185 FIEAVFEGQADDPEAVTERMNAITERREASQPIREKTSGSTFKNPDPETSGGRSAWQLVD 244

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            +G RG   GGA+ SE HCNF+IN   AT  DLE LGE VR +V ++ G+ L WE+KR+G
Sbjct: 245 AAGWRGKPIGGARFSEQHCNFLINDGTATASDLETLGETVRAEVKDKFGVQLHWEVKRIG 304

Query: 305 D 305
           +
Sbjct: 305 E 305


>gi|197302640|ref|ZP_03167694.1| hypothetical protein RUMLAC_01370 [Ruminococcus lactaris ATCC
           29176]
 gi|197298222|gb|EDY32768.1| hypothetical protein RUMLAC_01370 [Ruminococcus lactaris ATCC
           29176]
          Length = 301

 Score =  228 bits (582), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 103/289 (35%), Positives = 151/289 (52%), Gaps = 4/289 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDA 78
               + P+ + T FR GG A+    PQ + +++  L +    ++P  IVG GSN+LV D 
Sbjct: 15  NILRDEPMCRHTTFRVGGPADYFVTPQSVEEIRGILAVCRKENVPYYIVGNGSNLLVGDG 74

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           G RGVVL++                   A      +A++A    + G  F  GIPG++GG
Sbjct: 75  GFRGVVLQIFKKMNDVRVEGERVT--AQAGVLLSKVASAAYNASLTGLEFAAGIPGTLGG 132

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLRG 197
           A  MNAGA   E  Q +     + ++G    IP E+L   YR+S +  KD ++    LR 
Sbjct: 133 AVRMNAGAYGGEMKQVLESAVVLTQEGELLTIPVEELGLAYRTSVVEKKDYVVVEATLRL 192

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
               Q  I   + ++   R T QP++  + GSTFK P G+ A +LIE +G RG   G A+
Sbjct: 193 KKGDQAAIREVMDDLKQRRVTKQPLEFGSAGSTFKRPKGYFAGKLIEDAGLRGFRIGDAQ 252

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           +SE HC F+IN  NAT   +  L ++V KKV   SG+ LE E+KR+G+F
Sbjct: 253 VSEKHCGFVINRGNATAAQVCELMQEVVKKVKETSGVTLEPEVKRIGEF 301


>gi|329888139|ref|ZP_08266737.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brevundimonas
           diminuta ATCC 11568]
 gi|328846695|gb|EGF96257.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brevundimonas
           diminuta ATCC 11568]
          Length = 302

 Score =  228 bits (581), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 131/295 (44%), Positives = 175/295 (59%), Gaps = 5/295 (1%)

Query: 14  GKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNI 73
              +RGK   N PL   TWFR GG A+ +F P D  DL  FL  LP D+P+T++G+GSN+
Sbjct: 7   LPAVRGKLLLNEPLGPYTWFRVGGAADALFIPADADDLADFLKTLPEDVPVTVIGVGSNL 66

Query: 74  LVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           +VRD G+ GVV+RL+   +  +       +  GA      +A ++ + GI G  F+ GIP
Sbjct: 67  IVRDGGVEGVVIRLAGRAWGQVTTDG-VTVTAGAGALDSMVARASAKAGIAGLEFYAGIP 125

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHV 193
           GSIGGA  MNAG    ET   +V   G++RKG +  +      Y YR S    D+I    
Sbjct: 126 GSIGGALTMNAGCYGSETKDVLVSAWGLNRKGERVELALADFGYTYRHSNAPADIIWVEA 185

Query: 194 VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGL-- 251
             RG P++   ++A I  +   RE  QPI+EKTGGSTFKNP GHS+W+L++++G RG   
Sbjct: 186 TYRGTPDAPEAVAARINEITERREKTQPIREKTGGSTFKNPEGHSSWRLVDEAGWRGKLH 245

Query: 252 --EFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
               GGAK SELH NFMIN   AT  D+E LGE VR  V  ++G+ L WEIKR+G
Sbjct: 246 AVTGGGAKFSELHSNFMINPGEATAADIEGLGEAVRADVLEKTGVQLNWEIKRIG 300


>gi|331089732|ref|ZP_08338629.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lachnospiraceae
           bacterium 3_1_46FAA]
 gi|330404313|gb|EGG83859.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lachnospiraceae
           bacterium 3_1_46FAA]
          Length = 301

 Score =  228 bits (581), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 96/291 (32%), Positives = 146/291 (50%), Gaps = 4/291 (1%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVR 76
            G   ++ P+K  T FR GG A+   QP  I +++  + +      P  I+G GSN+LV 
Sbjct: 13  EGNVLKDEPMKMHTTFRIGGPADYFIQPSKIEEIRRIVAVCRECSTPYYIMGNGSNLLVG 72

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G RGV++++                   A       A  A    + G  F  GIPG++
Sbjct: 73  DKGFRGVIVQVFKQMSDVYADGERVY--AQAGALLSKTAAVACEASLTGMEFASGIPGTL 130

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLII-THVVL 195
           GGA  MNAGA   E  Q V     +  +G    +  E+L   YR+S I K+  +    VL
Sbjct: 131 GGALRMNAGAYGGEMKQIVESAEVLTSEGEVLNLTNEELGMGYRTSVIAKNDYVALSAVL 190

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           +     +  I A + ++   R T QP++  + GSTFK P G+ A +LI+ SG +G   G 
Sbjct: 191 KLEKGDRQEIRAYMEDLKERRVTKQPLEFGSAGSTFKRPEGYFAGKLIQDSGMQGYRVGD 250

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           A++SE HC F+IN  NAT  ++  L + V  +V  + G+ LE E++R+G+F
Sbjct: 251 AQVSEKHCGFVINRGNATAAEVMQLMKDVADRVEEKFGVRLEPEVRRIGEF 301


>gi|153009076|ref|YP_001370291.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Ochrobactrum
           anthropi ATCC 49188]
 gi|187609732|sp|A6WZQ8|MURB_OCHA4 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|151560964|gb|ABS14462.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Ochrobactrum
           anthropi ATCC 49188]
          Length = 320

 Score =  228 bits (581), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 159/308 (51%), Positives = 206/308 (66%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPIT 65
           + + L  +   LRG+   +  + +ITWFR GG A+V+FQP D  DL  FL  +P ++PI 
Sbjct: 7   LLKKLDGKLSGLRGRLTPDTGMDKITWFRAGGPAQVLFQPADEEDLSSFLKAVPEEVPIL 66

Query: 66  IVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGG 125
           +VG+GSN+LVRD G+ G V+RLS  GF  ++  +  ++  GA    K +A +AL  G+ G
Sbjct: 67  VVGIGSNLLVRDGGVPGFVVRLSAKGFGEVDQVSETQLRAGAATPDKRVAAAALEAGLAG 126

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT 185
           FHF++GIPG +GGA  MNAGAN  ET + VVEV  +DRKG  HV+    + Y YR S  +
Sbjct: 127 FHFYHGIPGGMGGALRMNAGANGVETRERVVEVRALDRKGEVHVLSNADMGYAYRHSSAS 186

Query: 186 KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEK 245
            DLI T V+  G P     I  A+  V HHRETVQP++EKTGGSTFKNP G SAW+ I+K
Sbjct: 187 SDLIFTSVLFEGTPGEHEAIKQAMDEVQHHRETVQPVREKTGGSTFKNPEGTSAWKEIDK 246

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +GCRGL  GGA++SE+HCNFMIN   ATG DLE LGE VR +VF  SGI L WEIKRLG 
Sbjct: 247 AGCRGLRVGGAQMSEMHCNFMINTGTATGLDLETLGETVRARVFENSGIRLHWEIKRLGL 306

Query: 306 FFDHQIVD 313
           F + + V+
Sbjct: 307 FREGEAVE 314


>gi|294794114|ref|ZP_06759251.1| UDP-N-acetylmuramate dehydrogenase [Veillonella sp. 3_1_44]
 gi|294455684|gb|EFG24056.1| UDP-N-acetylmuramate dehydrogenase [Veillonella sp. 3_1_44]
          Length = 309

 Score =  228 bits (581), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 95/288 (32%), Positives = 157/288 (54%), Gaps = 4/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDA 78
           + +E   L   T F+ GG A++  +P  + +L + L  +   D+P+TI+G GSNILV+D 
Sbjct: 23  RVREQELLCHHTTFKIGGPADLFIEPTTMAELSFTLRTIHELDVPVTIIGCGSNILVKDG 82

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIR     +S    + I   N   + +G+    K  +  A  + + G  F  GIPG++GG
Sbjct: 83  GIR--GAVVSVRHMTQIMDCNENTLCIGSGYMLKDASEFAWENSLSGLEFAIGIPGTLGG 140

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR-G 197
           A +MNAGA + E S  V  V  +D +GN        L + YR S    +  +   V+   
Sbjct: 141 AVFMNAGAYDGEMSHVVTAVRAVDFQGNIKEYDGSHLDFAYRHSVFHDNHEVIGEVIMTL 200

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P  ++ I A +  +   RE+ QP++  + GSTFK P G+ A  LIE++G +GL  G A+
Sbjct: 201 KPGDKDAIKARMDELTEKRESKQPLEYASAGSTFKRPPGYFAGTLIEQTGLKGLSVGDAQ 260

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S  H  F+IN  +A+  D+  L  +V+++V+++ G+ LE E++ +G+
Sbjct: 261 VSHKHAGFVINTGSASAKDVLDLIAEVQRRVYDRHGVHLEPEVRMIGE 308


>gi|160872534|ref|ZP_02062666.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsiella
           grylli]
 gi|159121333|gb|EDP46671.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsiella
           grylli]
          Length = 293

 Score =  228 bits (581), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 96/293 (32%), Positives = 148/293 (50%), Gaps = 1/293 (0%)

Query: 13  RGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSN 72
             K L+G+  +N  L + T +  GG+A  +++P DI DL +F+  L  + P+  +GLGSN
Sbjct: 1   MMKNLKGELLKNTKLAEYTSWHVGGHANQLYKPSDIDDLIHFIKQLSPEEPLFFLGLGSN 60

Query: 73  ILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGI 132
            L+RD GI G  + ++    + +   N   +   A  +  + A  A R  + G  F  GI
Sbjct: 61  TLIRDNGING-TVVITQGSLTQLNRINDVTLYADAGVASPAFARFAARKNLMGAEFLAGI 119

Query: 133 PGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITH 192
           PG+IGGA  MNAG + CET   V  V  ++R G + +         YR+  +        
Sbjct: 120 PGTIGGALVMNAGCDGCETWNIVQSVLVVNRHGEKKIRYPRDYNIAYRTVSVFPGEYYLG 179

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
                 P ++      I ++  +R   QP  E   GS F+NP G  A +LIE  G +GL 
Sbjct: 180 AEFHLKPGNKEDAFNNIRHLLKYRTDTQPTNEPNCGSVFRNPPGDYAARLIEACGLKGLS 239

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            G A +S  H NF++N  NA+  D+E L E++ + VF+Q  I L  E++ +GD
Sbjct: 240 IGNAAVSTKHANFILNKGNASAADIEALIEKIAETVFHQFHIRLIPEVRIIGD 292


>gi|257791839|ref|YP_003182445.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Eggerthella lenta
           DSM 2243]
 gi|317489840|ref|ZP_07948336.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Eggerthella sp.
           1_3_56FAA]
 gi|325829878|ref|ZP_08163336.1| UDP-N-acetylmuramate dehydrogenase [Eggerthella sp. HGA1]
 gi|257475736|gb|ACV56056.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Eggerthella lenta
           DSM 2243]
 gi|316911054|gb|EFV32667.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Eggerthella sp.
           1_3_56FAA]
 gi|325488045|gb|EGC90482.1| UDP-N-acetylmuramate dehydrogenase [Eggerthella sp. HGA1]
          Length = 308

 Score =  228 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 95/306 (31%), Positives = 140/306 (45%), Gaps = 3/306 (0%)

Query: 2   IYGRISRLLRERGKQ--LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP 59
           +  R +  L          G    + P+ + T +R GG A    Q   +  LK  +T+  
Sbjct: 1   MTARHTSPLEALLVDDAFDGDVYPSEPMARHTMYRIGGPARFYVQVASVGALKRLVTVCE 60

Query: 60  S-DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSA 118
              +P   +G GSN+LV D G  GVV+ L           +     VGA     S+   A
Sbjct: 61  ESRVPWVAIGRGSNLLVADEGYPGVVITLGRDFRICRYDEDAHSFCVGAGVPLSSVVQEA 120

Query: 119 LRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQ 178
            R  + GF F  G PG++GGA  MNAG+ +      VV V  +           +Q+ + 
Sbjct: 121 FRRSLAGFEFAVGTPGTVGGALRMNAGSRDEWIGSRVVSVTTLSPGKGLVRRDGDQIAWG 180

Query: 179 YRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           YRSS    D +I    L   P     I   +      R+  QP+   + GS F+NP G  
Sbjct: 181 YRSSSFASDEVIVECELSVEPADPFFIRGKMEASHARRKKTQPLSLPSCGSVFRNPEGAP 240

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
              LIE++G +GL  GGA++SE+H NF++N  +AT  D+  L   V+ KV+   GI L+ 
Sbjct: 241 VGALIEEAGLKGLRIGGAQVSEVHANFIVNTGDATARDVLELINLVKTKVYETYGIELQP 300

Query: 299 EIKRLG 304
           E++ LG
Sbjct: 301 EVRFLG 306


>gi|17986864|ref|NP_539498.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           bv. 1 str. 16M]
 gi|17982502|gb|AAL51762.1| udp-n-acetylenolpyruvoylglucosamine reductase [Brucella melitensis
           bv. 1 str. 16M]
          Length = 304

 Score =  228 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 159/297 (53%), Positives = 205/297 (69%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RG+   +  + +ITWFR GG A+V+FQP D  DL  FL  +P +IP+ +VG+GSN+LVR
Sbjct: 1   MRGRLTPDTGMDKITWFRAGGPAQVLFQPSDEEDLSAFLKAVPEEIPLLVVGIGSNLLVR 60

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ G V+RLS  GF  +E     ++  GA    K +A +AL  G+ GFHF++GIPG I
Sbjct: 61  DGGVPGFVVRLSAKGFGEVEQVCDTQLRAGAAAPDKRVAAAALEAGLAGFHFYHGIPGGI 120

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET + VVEV  +DRKG  HV+    + Y YR S  + DLI T V+  
Sbjct: 121 GGALRMNAGANGVETRERVVEVRALDRKGEVHVLSNADMGYAYRHSSASPDLIFTSVLFE 180

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G P  ++ I  A+  V HHRETVQP++EKTGGSTFKNP G SAW+ I+K+GCRGL  GGA
Sbjct: 181 GVPGERDDIRRAMDEVQHHRETVQPVREKTGGSTFKNPEGTSAWKEIDKAGCRGLRVGGA 240

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVD 313
           ++SE+HCNFMIN  NATG+DLE LGE VR +VF  SGI L WEIKRLG F + + ++
Sbjct: 241 QMSEMHCNFMINTGNATGHDLETLGETVRARVFENSGIRLHWEIKRLGLFREGEQIE 297


>gi|302383798|ref|YP_003819621.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302194426|gb|ADL01998.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 303

 Score =  228 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 131/298 (43%), Positives = 176/298 (59%), Gaps = 5/298 (1%)

Query: 11  RERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLG 70
           R+    +RGK   + PL   TWFR GG A+V+F P D  DL  FL  L   +P+TI+G+G
Sbjct: 4   RDTLPTVRGKLLRDEPLAPFTWFRVGGAADVLFIPADADDLADFLKALDPAVPVTILGVG 63

Query: 71  SNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFY 130
           SN++VRD G+ GVV+RL+   F+ I          GA      +A ++ + G+ G  F+ 
Sbjct: 64  SNVIVRDGGVEGVVIRLAGRPFAGISTDGETIT-AGAGALDAMVAKASAKAGLAGLEFYA 122

Query: 131 GIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLII 190
           GIPG+IGGA  MNAG    ET   VV   G+ R G       +   Y YR ++  +D++ 
Sbjct: 123 GIPGTIGGALVMNAGCYGSETKDVVVSARGVTRTGELRDFSVDDFGYSYRHNDYDEDILW 182

Query: 191 THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRG 250
                RG P+    ++A IA +   RET QPI+EKTGGSTFKNP GHS+W+L++++G RG
Sbjct: 183 VEATYRGTPDDPEAVAARIAAITARRETTQPIREKTGGSTFKNPPGHSSWKLVDEAGWRG 242

Query: 251 L----EFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
                  GGA  S+LH NFMIN   AT  D+E LGE VR  V ++ G+ LEWEIKRLG
Sbjct: 243 KLHAVTGGGAMFSDLHSNFMINPGEATAADIEGLGETVRADVQSKLGVNLEWEIKRLG 300


>gi|239832307|ref|ZP_04680636.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Ochrobactrum
           intermedium LMG 3301]
 gi|239824574|gb|EEQ96142.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Ochrobactrum
           intermedium LMG 3301]
          Length = 320

 Score =  228 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 158/308 (51%), Positives = 204/308 (66%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPIT 65
           + + L  +   LRG+   +  + +ITWFR GG A+V+FQP D  DL  FL  +P +IPI 
Sbjct: 7   LLKKLDGKLSGLRGRLTADAGMDKITWFRAGGPAQVLFQPADEEDLSAFLKAVPEEIPIL 66

Query: 66  IVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGG 125
           +VG+GSN+LVRD G+ G V+RLS  GF  +E  +  ++  GA    K +A +AL  G+ G
Sbjct: 67  VVGIGSNLLVRDGGVPGFVVRLSAKGFGEVEQVSDTQLRAGAATPDKRVAAAALDAGLAG 126

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT 185
           FHF++GIPG IGGA  MNAGAN  ET + VVEV  +DR G   V+    + Y YR S  +
Sbjct: 127 FHFYHGIPGGIGGALRMNAGANGVETRERVVEVRALDRNGEVQVLSNVDMGYAYRHSSAS 186

Query: 186 KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEK 245
             LI T V+  G    ++ I  A+  V HHRETVQP++EKTGGSTFKNP G SAW+ I+K
Sbjct: 187 PGLIFTSVLFEGIAGERDAIRQAMDEVQHHRETVQPVREKTGGSTFKNPEGTSAWKEIDK 246

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +GCRGL  GGA++SE+HCNFMIN   ATG DLE LGE VR +VF  SGI L WEIKRLG 
Sbjct: 247 AGCRGLRVGGAQMSEMHCNFMINTGTATGLDLETLGETVRARVFENSGIRLHWEIKRLGL 306

Query: 306 FFDHQIVD 313
           F + + V+
Sbjct: 307 FREGEPVE 314


>gi|90418192|ref|ZP_01226104.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90337864|gb|EAS51515.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 318

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 167/313 (53%), Positives = 212/313 (67%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    +   L +R + +RG+   +  + +ITWFR GG AE++FQP D  DL  FL  LP 
Sbjct: 1   MAGADLLASLGDRLETVRGRLTPDAGMDKITWFRAGGPAELLFQPADEADLATFLAALPE 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           +IP+ +VG+GSN+LVRD G+ GVV+RLS  GF  +E      +  G     K LA +AL 
Sbjct: 61  EIPVLVVGIGSNLLVRDGGVPGVVIRLSAKGFGQVERIGERTLRAGTALPDKRLAAAALE 120

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
            G+GGFHF++GIPG+IGGA  MNAGAN  ET + VVEV  +DR+G  HV+  E++ Y YR
Sbjct: 121 AGLGGFHFYHGIPGAIGGALRMNAGANGVETCERVVEVRALDRQGAVHVLTNEEMGYAYR 180

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
            S  ++DLI T  V  G+P  +  I A +  V HHRETVQPI+EKTGGSTFKNP G SAW
Sbjct: 181 HSAASRDLIFTSAVFEGYPAEEAEIRAKMDEVQHHRETVQPIREKTGGSTFKNPVGSSAW 240

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           + ++K+GCRGL  GGA +SELHCNFMIN  +AT YDLE LGE VR +V   SGI LEWEI
Sbjct: 241 KEVDKAGCRGLRVGGAHMSELHCNFMINDASATAYDLECLGETVRARVLEASGIRLEWEI 300

Query: 301 KRLGDFFDHQIVD 313
           KRLG F D  +V+
Sbjct: 301 KRLGRFRDGAVVE 313


>gi|317499773|ref|ZP_07958028.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lachnospiraceae
           bacterium 5_1_63FAA]
 gi|316892939|gb|EFV15166.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lachnospiraceae
           bacterium 5_1_63FAA]
          Length = 302

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 97/304 (31%), Positives = 156/304 (51%), Gaps = 5/304 (1%)

Query: 6   ISRLLRERGKQLRGK-FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIP 63
           +   + +  + +  K      P+K  T FR GG A++   P+++ ++K          IP
Sbjct: 1   MDTKIDQLKQIIPEKYILRQEPMKNHTTFRIGGPADIFVAPENMEEIKAVSCFAKEEGIP 60

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           + ++G GSN+LV D G     + L      +       E+IV A     S + +AL   +
Sbjct: 61  LFVLGNGSNLLVADDG--MDGIVLQIYKNYSGIEVRGNELIVKAGTLLSSTSRAALNEEL 118

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            GF F  GIPG+ GGA  MNAGA   E  Q + EV  + ++G    +  E+L+  YR+S 
Sbjct: 119 TGFEFAGGIPGTFGGAVVMNAGAYGGEMVQVLKEVTVLTKEGEIKTLKAEELELGYRTSN 178

Query: 184 -ITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
            +  + ++   V+     ++  I A +      R+T QP++  + GSTFK P G+ A +L
Sbjct: 179 VLKNEYVVLEGVIALKKGNKEEIKAKMDEYALARKTKQPLEYPSAGSTFKRPEGYFAGKL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           I+ +G +G + G A++SE H  F+IN  NAT  D+  L   V+ KV  Q G+ +E E+KR
Sbjct: 239 IQDAGLKGYQVGDAQVSEKHSGFVINRGNATASDVMQLISDVKDKVKEQFGVTMEPEVKR 298

Query: 303 LGDF 306
           +G F
Sbjct: 299 VGRF 302


>gi|260887247|ref|ZP_05898510.1| UDP-N-acetylmuramate dehydrogenase [Selenomonas sputigena ATCC
           35185]
 gi|330838995|ref|YP_004413575.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Selenomonas
           sputigena ATCC 35185]
 gi|260863309|gb|EEX77809.1| UDP-N-acetylmuramate dehydrogenase [Selenomonas sputigena ATCC
           35185]
 gi|329746759|gb|AEC00116.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Selenomonas
           sputigena ATCC 35185]
          Length = 307

 Score =  227 bits (578), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 98/302 (32%), Positives = 151/302 (50%), Gaps = 9/302 (2%)

Query: 11  RERGKQLRGK-----FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPI 64
           ++   ++R +        N P+K+ T FR GG A+ +  P  + D+ +    L   DIP 
Sbjct: 7   QKFVDEIRSRMAPEHILLNEPMKEHTTFRIGGPADCLILPASMEDVAFVFQCLKRHDIPF 66

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            I+G GSN+LV D GIR   + +      +   + +  +  GA    + ++  A  + + 
Sbjct: 67  VILGNGSNVLVLDKGIR--GVVIKFNSPISAIRKKNNTLTAGAGALLRDVSEFAAENSLS 124

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGSIGGA +MNAGA + E    V  V  I  KG        +L + YR S  
Sbjct: 125 GMEFACGIPGSIGGAVFMNAGAYDGEMKNIVSAVRAISPKGEIVQFAANELDFGYRHSIF 184

Query: 185 TKDLIITHVVL-RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            ++      V       +   I   IA     RE+ QP++  + GSTFK P GH A  LI
Sbjct: 185 QENGCAICEVDLTLASGNAEEIKEKIAGFTERRESKQPLEMPSAGSTFKRPEGHYAGTLI 244

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           E++G +G   GGA++S+ H  F++NA +AT  D+  L  QV+ +VF +  + L  E++ L
Sbjct: 245 EQTGLKGFTVGGAQVSDKHAGFVVNAGDATAKDVLELIRQVQDRVFEKHHVKLFPEVRIL 304

Query: 304 GD 305
           G+
Sbjct: 305 GE 306


>gi|296284496|ref|ZP_06862494.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Citromicrobium
           bathyomarinum JL354]
          Length = 303

 Score =  227 bits (578), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 121/293 (41%), Positives = 177/293 (60%), Gaps = 1/293 (0%)

Query: 12  ERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGS 71
           E+   +RGK  ++ PL ++ WF+ GG A+ +F+P D+ DL  F+  L   +P+  +GLGS
Sbjct: 10  EKLPDVRGKLTQHAPLAKLVWFKAGGAADWLFEPADVDDLCAFVRDLDPAVPLLPLGLGS 69

Query: 72  NILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYG 131
           N++VRD G+ GV +RL  +  + IE      +  GA   G  +A++A  +GI G  F  G
Sbjct: 70  NLIVRDGGVPGVTIRLGKSF-AKIETAGDHTLHSGAGAHGVLIASTARDNGIAGLEFLRG 128

Query: 132 IPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIIT 191
           IPG++GG   MN GA   ET+  +V+   + R G+   +P  +L Y YR S++ +  ++ 
Sbjct: 129 IPGTLGGFVRMNGGAYGRETADVLVDCDVVLRDGSLKTLPVAELGYTYRHSQLPEGAVVV 188

Query: 192 HVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGL 251
              L+G       I A +  +   RE  QP++ KTGGSTFKNP G  AWQL++ +GCRG+
Sbjct: 189 AARLKGEAGDPEAIGAEMERIAQAREESQPVRTKTGGSTFKNPPGEKAWQLVDAAGCRGM 248

Query: 252 EFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
             GGA++SE H NF+IN   AT  D+E LGE VR KV   SG+ LEWEI+R+G
Sbjct: 249 MRGGAQVSEKHTNFLINTGTATSEDIEQLGEDVRAKVRANSGVELEWEIQRVG 301


>gi|255282641|ref|ZP_05347196.1| UDP-N-acetylmuramate dehydrogenase [Bryantella formatexigens DSM
           14469]
 gi|255266934|gb|EET60139.1| UDP-N-acetylmuramate dehydrogenase [Bryantella formatexigens DSM
           14469]
          Length = 300

 Score =  227 bits (578), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 105/308 (34%), Positives = 153/308 (49%), Gaps = 10/308 (3%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           MIY R+  +                P+ + T FR GG A+    P    +L   + L   
Sbjct: 1   MIYQRLCEIAGAE------NVCRQEPMSRHTTFRIGGPADYFVLPHSSGELAAVIALCRE 54

Query: 61  D-IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
             +P  ++G GSN+LV D G+RGVV++L       +         + A       A   L
Sbjct: 55  SAVPWYVIGNGSNLLVGDKGVRGVVIQLFKNFQKIVIEEETAV--LQAGVINSLAAKRLL 112

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
              + GF F  GIPG+IGGA  MNAGA   E    V  V  +D  G    +P ++L++ Y
Sbjct: 113 DAELTGFEFAAGIPGTIGGAVVMNAGAYGGEMKDIVSSVTVLDENGALQTLPADELEFGY 172

Query: 180 RSSEI-TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R+S +  +  ++T V L      +  I+A +  +   R T QP++  + GSTFK P G+ 
Sbjct: 173 RTSIVARRGYVVTEVTLALQRGCREEIAARMEELKERRITKQPLEYPSAGSTFKRPEGYF 232

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI  +G RG   GGA++SE HC F+IN   AT  D+  L E V+  V  + G+ LE 
Sbjct: 233 AGKLIMDAGLRGFSVGGAQVSEKHCGFVINTGGATAADVVALMEAVQDTVEKKFGVRLEP 292

Query: 299 EIKRLGDF 306
           E+KRLG+F
Sbjct: 293 EVKRLGEF 300


>gi|291615172|ref|YP_003525329.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sideroxydans
           lithotrophicus ES-1]
 gi|291585284|gb|ADE12942.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sideroxydans
           lithotrophicus ES-1]
          Length = 308

 Score =  227 bits (578), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 106/298 (35%), Positives = 154/298 (51%), Gaps = 3/298 (1%)

Query: 14  GKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNI 73
            + LRG+   + P+ + T +R GG A+ M++P D+ DL+ FL  +P D P+  VGLGSN+
Sbjct: 11  AEGLRGEMLHDEPMNRHTSWRAGGPAQRMYRPADLEDLQRFLQQMPDDEPLVAVGLGSNL 70

Query: 74  LVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           LVRD G RG VL +  A    + +     +   A  +G  LA  A  + + G  FF GIP
Sbjct: 71  LVRDGGFRGTVLLMVGALAE-LRMDGDNIIYAQAGVAGAKLARFAASNHLYGAEFFVGIP 129

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS--SEITKDLIIT 191
           G++GG   MNAG    ET Q V  V  + R+G       ++ +  YR        +    
Sbjct: 130 GTLGGMLTMNAGCYGGETWQKVQRVQVLTRRGELLERTPQEYEIGYRHVLRRAAGEEFFV 189

Query: 192 HVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGL 251
              LR            I  +   R   QP++    GS F+NP G  A +LIE  G +G 
Sbjct: 190 GAWLRFEAGDVEAARQEIKALMEKRSASQPLQLPNAGSVFRNPPGRHAAKLIEDCGLKGR 249

Query: 252 EFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDH 309
             GGA++SE H NF++NAD AT  D+E L ++VR  V  Q+GI L  E++ +G+  +H
Sbjct: 250 RMGGAQVSEKHANFIVNADGATATDIENLIDEVRAVVLQQTGIDLHPEVRIIGEHANH 307


>gi|295399715|ref|ZP_06809696.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|312111766|ref|YP_003990082.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus sp.
           Y4.1MC1]
 gi|294978118|gb|EFG53715.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|311216867|gb|ADP75471.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus sp.
           Y4.1MC1]
          Length = 303

 Score =  227 bits (578), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 95/302 (31%), Positives = 146/302 (48%), Gaps = 5/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           +  +++E      GK +E  PL   T  + GG A+V+ +P  I  L+  + ++   ++P 
Sbjct: 1   MKAMIKELANANVGKVKEREPLANHTTMKVGGPADVLIEPSSIESLQNAIAIVKKYEVPW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
             +G GSN+LV D GI GVV+++                 VG   S   LA    + G+ 
Sbjct: 61  RAIGRGSNLLVSDEGIEGVVIKMDEGLDELHVDGETVT--VGGGYSLVRLATLMSKQGLS 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA+  + +Q V     +   G    +  E++++ YR+S +
Sbjct: 119 GLEFAGGIPGSVGGAVYMNAGAHGSDMAQIVKRALILFPDGTMEWLTNEEMEFAYRTSVL 178

Query: 185 TKDLIITHVVLRGFPESQNIISA--AIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
                   V       S N       +     +R   QP  +   GS F+NP    A +L
Sbjct: 179 QTKRRGICVAAELRLASGNREKIVAKMRENKDYRRKTQPWDKPCAGSIFRNPLPQHAGRL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IE++G +G   GGAKISE H NF++N  NA   D+  L   V+K +    GI L+ E++ 
Sbjct: 239 IEEAGLKGYAIGGAKISEQHANFIVNTGNAKAKDVLDLIRFVKKTINELYGIHLQTEVEI 298

Query: 303 LG 304
           +G
Sbjct: 299 IG 300


>gi|315498793|ref|YP_004087597.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Asticcacaulis
           excentricus CB 48]
 gi|315416805|gb|ADU13446.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Asticcacaulis
           excentricus CB 48]
          Length = 300

 Score =  226 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 130/295 (44%), Positives = 173/295 (58%), Gaps = 4/295 (1%)

Query: 12  ERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGS 71
           +    +RGK  +   L   TWFR GG A+V+F P+D  DL  FL  L   +P+T +G+GS
Sbjct: 6   DALPAVRGKIVKQAELAPFTWFRVGGPADVLFLPEDEADLATFLKGLDPAVPVTPIGVGS 65

Query: 72  NILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYG 131
           N+LVRD G+ GVV+RL       +       +  GA      +A  A R G+ G  F+ G
Sbjct: 66  NLLVRDGGLEGVVVRLGRNFAQIVTDD--WGLTAGAAALDAQVAKVAARAGLAGLEFYAG 123

Query: 132 IPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIIT 191
           IPG++GGA  MNAG    ET   ++    +DR GN   +   +L++ YR S + +   I 
Sbjct: 124 IPGTVGGAVTMNAGCYGRETKDALLSARIMDRSGNVVTLSNAELQFAYRHSILQEKNWIV 183

Query: 192 --HVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
                        + + A I  +   RET QPI+EKTGGSTFKNP GHSAW+L++++G R
Sbjct: 184 LGAAYELQEGNDPSEVIARIEEITAKRETSQPIREKTGGSTFKNPEGHSAWKLVDEAGWR 243

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           G  FGGAK SELH NFMINADNAT  DLE LG+ VR +V ++ GI L WEIKR+G
Sbjct: 244 GKFFGGAKFSELHSNFMINADNATAADLEGLGDTVRAEVKDKFGIDLHWEIKRIG 298


>gi|13471547|ref|NP_103113.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Mesorhizobium loti
           MAFF303099]
 gi|30316111|sp|Q98KB5|MURB_RHILO RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|14022289|dbj|BAB48899.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Mesorhizobium loti
           MAFF303099]
          Length = 320

 Score =  226 bits (577), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 168/303 (55%), Positives = 204/303 (67%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           L +R   LRG+   N  + +ITWFR GG AEV FQP D  DL  FL  +P +IP+TIVG+
Sbjct: 10  LGDRLAGLRGRLTPNAEMDKITWFRAGGLAEVFFQPADEEDLAAFLRAVPEEIPLTIVGV 69

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
           GSN+LVRD GI G V+RLS  GF   E+ +   +  GA    K +A  AL  GIGGFHF+
Sbjct: 70  GSNLLVRDGGIPGFVIRLSAKGFGEAEIVSPIRIKAGAATPDKRVAALALEAGIGGFHFY 129

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLI 189
           +GIPG+IGGA  MNAGAN  ET + VVEV  +DRKGN   +   ++ Y YR S     LI
Sbjct: 130 HGIPGAIGGALRMNAGANGVETRERVVEVRALDRKGNVQTMSNAEMGYAYRHSAAPVGLI 189

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
            T  V  GF E +  I AA+  V +HRETVQPI+EKTGGSTFKNP G SAW+ I+K+GCR
Sbjct: 190 FTSAVFEGFAEDKATIKAAMDAVQNHRETVQPIREKTGGSTFKNPEGTSAWKEIDKAGCR 249

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDH 309
           GL  GGA++S +HCNFMIN   ATGYDLEYLGE VR +V   SGI L+WEIKR+G+F   
Sbjct: 250 GLMIGGAQMSPMHCNFMINTGTATGYDLEYLGETVRARVLEHSGIRLQWEIKRIGNFRPG 309

Query: 310 QIV 312
             V
Sbjct: 310 HAV 312


>gi|307824833|ref|ZP_07655056.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacter
           tundripaludum SV96]
 gi|307734191|gb|EFO05045.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacter
           tundripaludum SV96]
          Length = 304

 Score =  226 bits (576), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 101/305 (33%), Positives = 146/305 (47%), Gaps = 3/305 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M     +   +E+  +  G+  +   L + T +R GG  + ++ P D  DL  F+  LP 
Sbjct: 1   MTIEMTTSSTQEQLPK--GRLLKREKLAKYTSWRVGGPVDQLYIPADRQDLIAFIKTLPE 58

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
             P+  +GLGSN+LVRD GIRG  +  +      + +     + V A      +A     
Sbjct: 59  SEPVFWMGLGSNLLVRDGGIRG-TVINTKGRLKEMSLTADGSVYVEAGVPCAHVARFCGE 117

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
            G+ G  F  GIPG++GGA  MNAGA   ET   V  V  +   GN      E  K  YR
Sbjct: 118 RGLTGAEFLAGIPGTMGGALKMNAGAFGGETWAIVKSVEMLGAVGNVTYRKSEDFKVSYR 177

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
           S +   +      +L        +    I  +   R   QP  + + GS FKNP G  A 
Sbjct: 178 SVKGFDNEWFLSCLLTLQQGDTVVSQQKIKGLLEKRGATQPTNQPSCGSVFKNPEGDYAA 237

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LIE++G +G   GGA +SE H NF++N  NAT  D+E L   V+ KV  Q GI+L+ E+
Sbjct: 238 RLIEQTGLKGYAIGGACVSEKHANFIVNTGNATAADIEALIHYVQDKVEQQQGIVLQTEV 297

Query: 301 KRLGD 305
             +GD
Sbjct: 298 CMVGD 302


>gi|284048188|ref|YP_003398527.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acidaminococcus
           fermentans DSM 20731]
 gi|283952409|gb|ADB47212.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acidaminococcus
           fermentans DSM 20731]
          Length = 303

 Score =  226 bits (576), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 106/307 (34%), Positives = 163/307 (53%), Gaps = 7/307 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP- 59
           M    +   L ER     GKFQ N P+++ T FR GG A+++ +P+   ++   L  +  
Sbjct: 1   MTMSGLLSFLEERLP---GKFQINAPMERYTTFRVGGPADLLVEPETREEVCSLLREIHT 57

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
             +P+T++G GSN+LV D GIRG V++L +           C + V A      LA++A 
Sbjct: 58  QQVPLTVIGNGSNLLVLDKGIRGCVVKLGSCLKQL--TIQGCTIRVEAGVLLSRLASAAA 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
             G+ G  F  GIPGS+GGA  MNAGA   E    V  V   D  G    + RE+++++Y
Sbjct: 116 EGGLAGLEFASGIPGSLGGAILMNAGAYGGEIGNLVRSVTVADGGGELRTLNREEMEFRY 175

Query: 180 RSSEITK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S +     II    L    +  + I   I+ +   R + QP+   + GSTFK P G+ 
Sbjct: 176 RHSAVMDSGDIILGATLELTRDDPDAIRERISELTRKRVSKQPLNFPSAGSTFKRPPGYF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A  LI+++G RG   G A++SE H  F++N  +AT  ++  L + VR+KV   SG+ LE 
Sbjct: 236 AAALIDQAGLRGYRVGDAQVSEKHTGFVVNRGHATASEILQLMDDVREKVHAMSGVWLEP 295

Query: 299 EIKRLGD 305
           E++ +G+
Sbjct: 296 EVRIIGE 302


>gi|53803429|ref|YP_114841.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylococcus
           capsulatus str. Bath]
 gi|81681289|sp|Q604V9|MURB_METCA RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|53757190|gb|AAU91481.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylococcus
           capsulatus str. Bath]
          Length = 304

 Score =  226 bits (576), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 101/288 (35%), Positives = 140/288 (48%), Gaps = 1/288 (0%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRD 77
           RG + E+ PL   T +R GG AE  +QP D+ DL  FL  L    P+  +GLGSN+LVRD
Sbjct: 15  RGTWLEHEPLAGHTSWRVGGPAERFYQPADLDDLVQFLRALSPQEPLFWLGLGSNVLVRD 74

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            GIRG V+   N     IE R    +   A      +A         G  F  GIPG++G
Sbjct: 75  GGIRGTVVCTKNRL-RVIEARGPACVYAEAGIPCAHVARFCTERDWVGAEFLAGIPGTLG 133

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRG 197
           GA  MNAGA   ET   V  V  ++R G       E+ +  YR  +  +        L  
Sbjct: 134 GALAMNAGAFGGETWSLVRRVLTVNRGGRTIWRAPEEFEVGYRHVQGPEGEWFVAAELEL 193

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P         I  +   R   QP  + + GS F+NP    A +LIE  G +G   GGA+
Sbjct: 194 APGDGRAGRERIKALLARRSATQPTHQPSCGSVFRNPPSDFAARLIEACGLKGHTVGGAQ 253

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S  H NF++N+ +AT  D+E L  +VR +V    G+ LE E++ +G+
Sbjct: 254 VSLKHANFIVNSGDATAADIETLIAEVRDRVALLCGVWLEPEVRIVGE 301


>gi|304316241|ref|YP_003851386.1| UDP-N-acetylenolpyruvoylglucosamine reductase
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302777743|gb|ADL68302.1| UDP-N-acetylenolpyruvoylglucosamine reductase
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 301

 Score =  226 bits (575), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 102/305 (33%), Positives = 163/305 (53%), Gaps = 7/305 (2%)

Query: 3   YGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-D 61
              I  +L++   +       N  + + T FR GG AEV+  PQ+  +L   L ++ + +
Sbjct: 1   MKNIVEILKKAISE--ENIYINELMSRHTSFRIGGPAEVLVIPQNREELINVLDIIRNEN 58

Query: 62  IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRH 121
           IP  I+G G+N++V D GIRGVV++L+     ++E                ++AN+AL +
Sbjct: 59  IPYFILGNGTNVIVSDRGIRGVVIKLTAIRKISVEGEYIVSET---GALLSAIANTALDN 115

Query: 122 GIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS 181
            + GF F  GIPG++GGA  MNAGA   E    + +V  ID  GN + I    +K+ YRS
Sbjct: 116 ELTGFEFASGIPGTLGGAVTMNAGAYGTEIKDVIEKVEVIDENGNIYEIKNGNMKFAYRS 175

Query: 182 SEIT-KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
           S I   +LI     +     +   I A +  +   R+  QP++  + GS FK P G+ A 
Sbjct: 176 SAIQLDNLIALKAWIHLKKGNYKDIRAKMDELNGLRKKKQPLEYPSAGSVFKRPEGYYAG 235

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LI+ +G +G   GGA++SE HC F+IN  +AT  D+  L   ++K V ++ G+ L  E+
Sbjct: 236 KLIQDAGLQGYTIGGAQVSEKHCGFIINKGDATAEDVINLIRFIQKTVKDRFGVDLHTEV 295

Query: 301 KRLGD 305
           K +G+
Sbjct: 296 KIIGE 300


>gi|110634355|ref|YP_674563.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Mesorhizobium sp.
           BNC1]
 gi|123162149|sp|Q11GS7|MURB_MESSB RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|110285339|gb|ABG63398.1| UDP-N-acetylmuramate dehydrogenase [Chelativorans sp. BNC1]
          Length = 321

 Score =  225 bits (574), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 171/308 (55%), Positives = 212/308 (68%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPIT 65
           +   L +R   LRG+   +  + +ITWFR GG A+++FQPQD  DL  FL  +P +IP+T
Sbjct: 7   LLEKLGDRLSGLRGRLTPDAGMDKITWFRAGGEADLLFQPQDEEDLAAFLKAVPEEIPVT 66

Query: 66  IVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGG 125
           IVG+GSN+LVRD G+RG V+RLS  GF   EV +   +  GA    K LA  AL  GIGG
Sbjct: 67  IVGIGSNLLVRDDGMRGFVVRLSAKGFGEAEVISPTRIRAGAAIPDKRLAAFALEAGIGG 126

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT 185
           FHFF+GIPG +GGA  MNAGAN  ETS+ VVEV  +DR+G  HV    ++ Y YR+S  +
Sbjct: 127 FHFFHGIPGGLGGALRMNAGANGVETSERVVEVRALDRRGELHVFSNAEMGYSYRASAAS 186

Query: 186 KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEK 245
           + LI T  VL G+ E +  I AA+  V HHRETVQPI+EKTGGSTFKNP G SAW+ I++
Sbjct: 187 QGLIFTSAVLEGYAEDREAIRAAMDAVQHHRETVQPIREKTGGSTFKNPEGTSAWKEIDR 246

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +GCRGL  GGA++S +HCNFMIN   ATGYDLEYLGE VR +V   SGI LEWEIKR+G 
Sbjct: 247 AGCRGLMIGGAQMSPMHCNFMINTGTATGYDLEYLGETVRARVLENSGIKLEWEIKRIGA 306

Query: 306 FFDHQIVD 313
           F     VD
Sbjct: 307 FKPDHSVD 314


>gi|253997367|ref|YP_003049431.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylotenera
           mobilis JLW8]
 gi|253984046|gb|ACT48904.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylotenera
           mobilis JLW8]
          Length = 296

 Score =  225 bits (574), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 99/293 (33%), Positives = 143/293 (48%), Gaps = 3/293 (1%)

Query: 14  GKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNI 73
             QL+GK   N P+ + T +R GG A+  + P+ + DL  FL       P   +GLGSN+
Sbjct: 1   MSQLKGKLLLNEPMARYTSWRVGGRADQFYIPESLEDLSAFLRSQDEAEPTYFIGLGSNL 60

Query: 74  LVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           LVRD GIRG V+ + N   +         +   A  +   LA    +    G  FF GIP
Sbjct: 61  LVRDGGIRGTVVLMHNVLTTLQMD--GDAVYAEAGVTCAKLAKFCAKEAKQGAEFFAGIP 118

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITH 192
           G++GGA  MNAG    ET   V  V  I++ G  +          YR  ++   D     
Sbjct: 119 GTLGGALAMNAGCYGSETWNVVQRVTTINKSGELNTRDAAAFIPSYRHIDMPVADEWFIA 178

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
             LR         +  I  +   R   QP+ + + GSTF+NP G  A +LIE SG +G  
Sbjct: 179 AWLRLAQGDAQESAQKIKTLLAKRLASQPLNQPSAGSTFRNPPGDFAARLIEASGLKGYI 238

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            GGA++SE H NF++N   A   D+E L + +R+ V  + G+ L+ E+K LG+
Sbjct: 239 IGGAQVSEKHANFIVNIGGANALDIELLIQHMRETVLEKQGVALQQEVKVLGE 291


>gi|225569537|ref|ZP_03778562.1| hypothetical protein CLOHYLEM_05631 [Clostridium hylemonae DSM
           15053]
 gi|225161745|gb|EEG74364.1| hypothetical protein CLOHYLEM_05631 [Clostridium hylemonae DSM
           15053]
          Length = 307

 Score =  225 bits (574), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 104/309 (33%), Positives = 159/309 (51%), Gaps = 6/309 (1%)

Query: 2   IYGRISRLLRERGKQL--RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP 59
           +   +++      K +    K   + P+K  T FR GG A+    P+   +++  + L  
Sbjct: 1   METHMNQDFYNALKDVLTEDKVLADEPMKNHTTFRVGGAADYYTVPESKEEVRDIIRLCR 60

Query: 60  S-DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSA 118
             D+P  I+G GSN+LV D G RGV++++           +       A     S+A  A
Sbjct: 61  QWDVPFYIIGNGSNLLVSDKGYRGVMIQIYRDMSEITVEGHTVR--AQAGALLSSIAARA 118

Query: 119 LRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQ 178
           L  G+ GF F  GIPG++GGA  MNAGA   E    +  V  +   G    + R++L+  
Sbjct: 119 LSAGLTGFEFAAGIPGTLGGACVMNAGAYGGEMKDVLRYVTVLTEDGAFLTLHRDELELG 178

Query: 179 YRSSEI-TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGH 237
           YR+S I  K  I     +     S++ I A +  +   R T QP++  + GSTFK P G+
Sbjct: 179 YRTSVIARKGYIALEAEIELKEGSKDEIKARMDELKEKRVTKQPLEYPSAGSTFKRPEGY 238

Query: 238 SAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLE 297
            A +LIE +G RG   GGA++SE HC F+IN  +AT  D+  L  +V  +V  Q+G+ +E
Sbjct: 239 FAGKLIEDAGLRGFRVGGAQVSEKHCGFVINRGSATAADIMALITEVADRVERQTGVRME 298

Query: 298 WEIKRLGDF 306
            E+KRLG+F
Sbjct: 299 PEVKRLGEF 307


>gi|332798690|ref|YP_004460189.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Tepidanaerobacter
           sp. Re1]
 gi|332696425|gb|AEE90882.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Tepidanaerobacter
           sp. Re1]
          Length = 303

 Score =  225 bits (573), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 105/307 (34%), Positives = 163/307 (53%), Gaps = 6/307 (1%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP- 59
           M   +I  ++RE   +   + + N P+K+ T FR GG A++M  P +I ++   + +   
Sbjct: 1   MDVTKIYEIMREFLPE--SQVKINEPMKKHTSFRIGGPADIMVLPTNIGEVTSIIKVCRQ 58

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
           +DIP  ++G G+N+LV+D GIRGVV++L+          N   +   A     +L+  AL
Sbjct: 59  NDIPFFVMGNGTNLLVKDEGIRGVVMKLAQNFNDA--NVNKNIIRCKAGVPLSALSRIAL 116

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
              + G  F  GIPG++GGA  MNAGA   E +  V +V  +D  G  + + +E+L Y Y
Sbjct: 117 ESSLSGLEFANGIPGTVGGAVVMNAGAYGGEMADVVKKVTVVDMNGRLYEMQKEELDYSY 176

Query: 180 RSSEITK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R   +   D I+  V +   P +   I   +      R+  QP+   + GS FK P GH 
Sbjct: 177 RRCILQDGDRILLEVEMELLPGNYEDIKRQMEEFAACRKAKQPLNLPSAGSAFKRPPGHF 236

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A  LIEK+G +G   GGA +S+ H  F++N +NAT  D+  L   V+K+V  +  + LE 
Sbjct: 237 AGALIEKAGLKGYRIGGAMVSDKHAGFIVNVENATFKDVISLISHVQKEVKRKFNVDLES 296

Query: 299 EIKRLGD 305
           EIK +GD
Sbjct: 297 EIKIIGD 303


>gi|254292776|ref|YP_003058799.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Hirschia baltica
           ATCC 49814]
 gi|254041307|gb|ACT58102.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Hirschia baltica
           ATCC 49814]
          Length = 305

 Score =  225 bits (573), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 126/304 (41%), Positives = 166/304 (54%), Gaps = 8/304 (2%)

Query: 7   SRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITI 66
              L  +  ++RGK   +  LK  TWFR GG A+V++ P D  DL  FL  LP DIPIT+
Sbjct: 1   MTDLISKMPEVRGKLIADAELKPFTWFRVGGKADVLYLPADPDDLADFLKALPLDIPITV 60

Query: 67  VGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGF 126
           +G  SN +VRD GI    + +              E++ GA      ++  A   G+ G 
Sbjct: 61  LGAASNTIVRDGGIE--GVVIRLTPAFGKIRVQGNELVAGAAALDSKVSQKAAMFGLSGL 118

Query: 127 HFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK 186
            FF G+PG+IGGA  MNAG    ET+  +VE   + RKG+   +      Y YR SE  +
Sbjct: 119 EFFSGVPGTIGGALRMNAGCYEQETADVLVEAIALTRKGDWVTLVNRDFGYSYRHSEAPE 178

Query: 187 DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTG------HSAW 240
           DLI    + RG      I+   I  +   RE  QPI+EKTGGSTF NP           W
Sbjct: 179 DLIFVEALFRGNIIEPAIVKERIEALKKRREEAQPIREKTGGSTFANPDPPGTPDQRKCW 238

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LI+++G RG   GGA++SE HCNFMIN  +AT  D+E LGE+VR KV   SG+ L WEI
Sbjct: 239 KLIDEAGMRGARVGGAQVSEKHCNFMINTSDATASDIEELGEKVRAKVKENSGVDLRWEI 298

Query: 301 KRLG 304
           KR+G
Sbjct: 299 KRIG 302


>gi|319782850|ref|YP_004142326.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317168738|gb|ADV12276.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 321

 Score =  225 bits (573), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 168/313 (53%), Positives = 210/313 (67%), Gaps = 1/313 (0%)

Query: 1   MIYGR-ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP 59
           M++G+ +   L +R   LRG+   N  + +ITWFR GG AE +FQP D  DL  FL  +P
Sbjct: 1   MMHGQALIDRLGDRLAGLRGRLTPNAEMDKITWFRAGGLAEALFQPADEEDLAAFLKAVP 60

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +IP+T+VG+GSN+LVRD GI G V+RLS  GF + EV +   +  GA    K +A  AL
Sbjct: 61  EEIPLTVVGVGSNLLVRDGGIEGFVIRLSAKGFGDAEVISPIRIKAGAATPDKRVAAVAL 120

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
             GIGGFHF++GIPG+IGGA  MNAGAN  ET + V+EV  +DRKGN   +    + Y Y
Sbjct: 121 EAGIGGFHFYHGIPGAIGGALRMNAGANGVETRERVIEVRALDRKGNVQTLSNADMGYAY 180

Query: 180 RSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
           R S     LI T  V  GF E +  I AA+  V +HRETVQPI+EKTGGSTFKNP G SA
Sbjct: 181 RHSAAPSGLIFTSAVFEGFAEDRATIKAAMEAVQNHRETVQPIREKTGGSTFKNPDGTSA 240

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
           W+ I+K+GCRGL  GGA++S +HCNFMIN   ATGYDLEYLGE VR +V   SGI L+WE
Sbjct: 241 WKEIDKAGCRGLMIGGAQMSPMHCNFMINTGTATGYDLEYLGETVRTRVLENSGIRLQWE 300

Query: 300 IKRLGDFFDHQIV 312
           IKR+G+F     V
Sbjct: 301 IKRIGNFRPGHAV 313


>gi|325261391|ref|ZP_08128129.1| UDP-N-acetylmuramate dehydrogenase [Clostridium sp. D5]
 gi|324032845|gb|EGB94122.1| UDP-N-acetylmuramate dehydrogenase [Clostridium sp. D5]
          Length = 314

 Score =  225 bits (573), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 107/316 (33%), Positives = 161/316 (50%), Gaps = 12/316 (3%)

Query: 1   MIYGRISRL------LRERGKQLRGK--FQENFPLKQITWFRTGGNAEVMFQPQDIHDLK 52
           MI  ++ +       L E+   L G+     + P+ + T FR GG A+    P D  D+K
Sbjct: 1   MIEEKVQKNWRTYMNLYEKLCDLLGEESVFADEPMSRHTTFRIGGPADYFTVPGDTDDVK 60

Query: 53  YFLTLLP-SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSG 111
             + L    ++P  I+G GSN+LV D G RGV++++           +   +   A    
Sbjct: 61  KVIDLCKKEEVPYYILGNGSNLLVGDKGYRGVIIQIYKNMSEI--HTDGNRIFAQAGALL 118

Query: 112 KSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIP 171
             +A  AL H + GF F  GIPG++GGA  MNAGA   E  Q +     +  +G    + 
Sbjct: 119 SKVAAEALSHSLKGFEFASGIPGTLGGAVMMNAGAYGGEMKQVLESARVLTPEGEIKTLK 178

Query: 172 REQLKYQYRSSEI-TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGST 230
            E+L   YR+S I  K+ I+   V+R        I + +  +   R T QP++  + GST
Sbjct: 179 EEELDLGYRTSVIAKKNYIVLEAVIRLETGDAESIRSYMEELKEKRVTKQPLEYPSAGST 238

Query: 231 FKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFN 290
           FK P G+ A +LIE +G RG + G A++S+ HC F+IN   AT  ++  L  QV  KV  
Sbjct: 239 FKRPEGYFAGKLIEDAGLRGFQVGNAQVSQKHCGFVINRGGATAAEVISLMGQVADKVEA 298

Query: 291 QSGILLEWEIKRLGDF 306
            SG+ LE E+KR+G+F
Sbjct: 299 ASGVRLEPEVKRIGEF 314


>gi|254491332|ref|ZP_05104512.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylophaga
           thiooxidans DMS010]
 gi|224463461|gb|EEF79730.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylophaga
           thiooxydans DMS010]
          Length = 296

 Score =  225 bits (573), Expect = 8e-57,   Method: Composition-based stats.
 Identities = 103/296 (34%), Positives = 151/296 (51%), Gaps = 2/296 (0%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           +    + L+G+ + N PL + T +R GGNA+  ++P DI DL  FL  LP   P+  +GL
Sbjct: 1   MMALHQNLKGELKLNEPLAKYTSWRVGGNAQRFYKPTDIDDLATFLKQLPQSEPLLWLGL 60

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
           GSN+L+RD G +G V+  + A            +          LA  A + G+ G  F 
Sbjct: 61  GSNVLIRDGGFKGTVIVTAGALQDIHVD--GNTVHAEVGVYCSKLAKQAAKAGLKGGAFL 118

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLI 189
            GIPG++GGA  MNAGA+  ET  +V +V  ID +GN H     + +  YR    +KD  
Sbjct: 119 AGIPGTLGGALAMNAGAHGAETWDFVSDVTTIDMQGNLHQRQASEFEVSYRHVAKSKDEY 178

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
                ++         S  I ++   R   QP  +   GS F+NP G  A +LIE SG +
Sbjct: 179 FVAATMQFAQGDAEAESDLIRDLLRKRNASQPTNQPCAGSVFRNPEGDFAGRLIETSGLK 238

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           GL  GGA +S  H NF++N D AT  D+E L   V++K+    G+ L  E+  +G+
Sbjct: 239 GLRVGGASVSTKHANFIVNDDAATAADIENLILLVQQKIEQMQGVKLTPEVHVIGE 294


>gi|86606523|ref|YP_475286.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Synechococcus sp.
           JA-3-3Ab]
 gi|123505929|sp|Q2JTH4|MURB_SYNJA RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|86555065|gb|ABD00023.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Synechococcus sp.
           JA-3-3Ab]
          Length = 312

 Score =  225 bits (573), Expect = 8e-57,   Method: Composition-based stats.
 Identities = 92/297 (30%), Positives = 143/297 (48%), Gaps = 5/297 (1%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNIL 74
           +L G+ Q   PL  +T FR GG AE   +P +  +L+  L       IP+T++G GSN+L
Sbjct: 15  RLSGRIQAGIPLAPLTTFRVGGKAEWYCEPHNNLELQQCLAWARAQGIPVTLLGAGSNLL 74

Query: 75  VRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPG 134
           + DAG+    L +       +++     +   A     +LA +A + G  G  +  GIPG
Sbjct: 75  ISDAGLP--GLVIHTRRLRGMQLLEGGRIWAAAGEPLVNLARAAAKRGWSGLEWAIGIPG 132

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITH-- 192
           ++GGA  MNAGA+    S  +VEV  +D +     +    L++ YR S +          
Sbjct: 133 TLGGAVVMNAGAHGRAMSDVLVEVQILDEEQEPCRLEPVDLQFGYRRSRLQDSPWTVTGA 192

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
            +          +        + R + QP    + GS F+NP  H A  LIE+ G +G  
Sbjct: 193 TLQLLPGRDPAQVQRQTQRHLNQRLSSQPYHLPSCGSVFRNPETHPAGWLIEQVGLKGYR 252

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDH 309
            GGA+ISE H NF++N   A+  D+  L    ++KV+ +  I LE E++ LG F D 
Sbjct: 253 IGGAQISERHANFILNCGQASANDIYRLICLAQEKVYQRWSIFLEPEVRILGSFDDP 309


>gi|167630130|ref|YP_001680629.1| udp-n-acetylenolpyruvoylglucosamine reductase [Heliobacterium
           modesticaldum Ice1]
 gi|254764193|sp|B0TGC2|MURB_HELMI RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|167592870|gb|ABZ84618.1| udp-n-acetylenolpyruvoylglucosamine reductase [Heliobacterium
           modesticaldum Ice1]
          Length = 314

 Score =  225 bits (572), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 100/299 (33%), Positives = 148/299 (49%), Gaps = 5/299 (1%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVG 68
           + +  +  RG++ +  P+ + T ++ GG A++   P D  DL   +       IP  +VG
Sbjct: 1   MTQITRDFRGQWMQQEPMSRHTTWKIGGPADLFAIPADEADLAGLIRRCREKGIPWMVVG 60

Query: 69  LGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHF 128
            GSN+LV D GIRGVV+ L  A            +  G  C+   LA  A+R G+ G  F
Sbjct: 61  NGSNLLVADKGIRGVVIHLGRAFSDRRLDDRR--LTAGGGCALSGLARFAVRAGLQGLEF 118

Query: 129 FYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL 188
             GIP S+GGA  MNAGA+       V  V  ID +G       E++ + YR S + ++ 
Sbjct: 119 ACGIPASLGGAVAMNAGAHGGAMENIVRWVDVIDDEGRIRRYRGEEMDFAYRHSRLQREK 178

Query: 189 IITHVVLR-GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTG-HSAWQLIEKS 246
            I   V        +  +   +      R   QP++    GS F NP G  SA QLIE++
Sbjct: 179 AIVVRVGMELRWGDREALERWMEEKLALRRKSQPLEFPNAGSVFLNPPGSLSAGQLIEEA 238

Query: 247 GCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           G +G   GGA++SE H NF++N   AT  D+  L + VR +V    GI L+ E++ +GD
Sbjct: 239 GMKGFAIGGAQVSERHANFIVNRGGATAADVLALIDAVRARVLATCGIELQSEVRVIGD 297


>gi|168181971|ref|ZP_02616635.1| UDP-N-acetylmuramate dehydrogenase [Clostridium botulinum Bf]
 gi|237796837|ref|YP_002864389.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           botulinum Ba4 str. 657]
 gi|259509757|sp|C3KV11|MURB_CLOB6 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|182674781|gb|EDT86742.1| UDP-N-acetylmuramate dehydrogenase [Clostridium botulinum Bf]
 gi|229260592|gb|ACQ51625.1| UDP-N-acetylmuramate dehydrogenase [Clostridium botulinum Ba4 str.
           657]
          Length = 306

 Score =  225 bits (572), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 107/290 (36%), Positives = 155/290 (53%), Gaps = 5/290 (1%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVR 76
                 + P+K+ T F+ GG A+++  P  +  +K  + L  ++ IP  I+G GSN+LVR
Sbjct: 17  NNNVLIDEPMKKHTSFKVGGPADLLITPTTLEQVKDSIILCRNNSIPYYIIGNGSNLLVR 76

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GIRGVV++    G   +EV     +I  +     ++ N AL+  +GG  F  GIPGS+
Sbjct: 77  DGGIRGVVIKFLKLGDIKVEVDR---VIAQSGAPLTNICNEALKSNLGGLEFACGIPGSV 133

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGA N E SQ +     ID+ GN  ++ +EQL   YR S I K   I   V  
Sbjct: 134 GGAVTMNAGAYNGEISQVIESAKVIDKDGNVFLLNKEQLDLGYRMSAIQKYHYIVLEVTF 193

Query: 197 GFPESQNIISAAIANVCHHRET-VQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
               S+           + R T  QP++  + GSTFK P GH A +LIE +G +G   GG
Sbjct: 194 KLHNSEYDTIKNRIMDLNRRRTEKQPLEYPSAGSTFKRPEGHFAAKLIEDTGLKGKSIGG 253

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           A++SE H  F+IN   AT  D+  L E V+ KV  +  + L  E++ +G+
Sbjct: 254 AQVSEKHSGFIINKGGATAGDILNLIEFVQNKVKEKFQVDLHTEVRIIGE 303


>gi|311029928|ref|ZP_07708018.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus sp. m3-13]
          Length = 302

 Score =  224 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 95/302 (31%), Positives = 155/302 (51%), Gaps = 5/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           +  LL+E  ++  GK   N PL   T  + GG A+V+ +P+ +  L+  +  +    +  
Sbjct: 1   MEALLKELQEKEVGKVLPNEPLANHTTMKIGGPADVLVEPKSLEKLQETMETINKYKVKW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T +G GSN+LV D GI GVV++L N            E+ VG   S   L     + G+ 
Sbjct: 61  TAIGRGSNLLVSDLGIEGVVIKLGNGMD--HFELEGDEVHVGGGYSLIKLVTIISKKGLT 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA+  + S+ + + H +   G    +  ++L + YR+S +
Sbjct: 119 GLEFAGGIPGSVGGAVYMNAGAHGSDMSKVLKKAHILFEDGKMEWLTADELNFSYRTSLL 178

Query: 185 TKDLIITHVVLRG--FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
            K+     +         ++  + A +     +R   QP      GS F+NP    A QL
Sbjct: 179 QKERPGICLEAVLIVEQGNREEVVAQLQKNKDYRRDTQPFSYPCAGSIFRNPLPDYAGQL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IEK+G +G + GGAK+S++H NF++N D A   D+  L E +++ +  +  + LE E++ 
Sbjct: 239 IEKAGLKGHKIGGAKVSDMHANFIVNDDGAKAQDVLDLIEYIKETILEKYNVQLETEVEI 298

Query: 303 LG 304
           +G
Sbjct: 299 IG 300


>gi|54298602|ref|YP_124971.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Legionella
           pneumophila str. Paris]
 gi|81369791|sp|Q5X1S7|MURB_LEGPA RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|53752387|emb|CAH13819.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Legionella
           pneumophila str. Paris]
          Length = 303

 Score =  224 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 104/288 (36%), Positives = 150/288 (52%), Gaps = 2/288 (0%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDA 78
           G    N PL + T +R GG A  +++P +I DL  FL+ LP D P+  +GLGSN L+RD 
Sbjct: 11  GTLLFNEPLAEYTTWRVGGPAARLYKPANIDDLALFLSRLPFDEPLLWLGLGSNSLIRDG 70

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           G  G  + L+      + + +   + V A  S  S+A  + R+ +    F+ GIPG++GG
Sbjct: 71  GFSG-TVILTQGCLKEMTLLSDNCIRVEAGVSCASMARFSARNNLSEGEFWAGIPGTMGG 129

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGF 198
           A  MNAG +  ET Q V+EV  I+R+G       E+ +  YR      D       L+  
Sbjct: 130 ALRMNAGCHGGETWQSVIEVQTINRRGEIRTRKPEEFEVAYRHVAGLGDEWFISAKLQLT 189

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P ++      I ++  HR   QP  E   GS F+NP G  A +LIE  G +G+  GGA +
Sbjct: 190 PGNKETSLQLIKDLLAHRAKTQPTNEYNCGSVFRNPPGDFAARLIESCGLKGVSIGGAVV 249

Query: 259 SELHCNFMINA-DNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H NF+IN    AT  ++E L   V+ KV  Q+ I L  E+  +GD
Sbjct: 250 SEKHANFIINHQGTATAANIEALIHLVQTKVREQTSIELIREVHIIGD 297


>gi|182677687|ref|YP_001831833.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|254764133|sp|B2IGG2|MURB_BEII9 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|182633570|gb|ACB94344.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 310

 Score =  224 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 128/303 (42%), Positives = 182/303 (60%), Gaps = 3/303 (0%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD 61
           ++  +   LR+   +LRG+ Q N PL   TWF+TGG A+ ++   D+ DL YFL  L  D
Sbjct: 1   MFADLIPRLRDAMPELRGELQTNVPLAPWTWFKTGGPAQCVYVAPDVEDLAYFLGNLDPD 60

Query: 62  IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRH 121
           I I ++GLGSNILVRD GI    + +S     +  V     +  GA  +   LA++A   
Sbjct: 61  ISIFVLGLGSNILVRDGGIE--GVVISFGPSFHKIVIEGDTISAGAAVADVKLASAAAMA 118

Query: 122 GIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS 181
           G+GGF F  GIPG+IGGA  MNAGA     +  +V   G+DR+G  H    E++ + YR 
Sbjct: 119 GLGGFAFLRGIPGTIGGALRMNAGAFGGTIADILVSCEGLDRRGALHHFTPEEMGFSYRH 178

Query: 182 SEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
             + + +I T  +  G+PE+   I   +  +   R   QP+  +TGGSTFKNP G  AW+
Sbjct: 179 CAV-EGIIFTQGLFAGWPENPEKIREDMGKIAQERAKTQPVNTRTGGSTFKNPNGAKAWE 237

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           LI+++GCRGL  G A++SELHCNF++N   A+  D+E LGE VR+KV  ++G+ LEWEI 
Sbjct: 238 LIDRAGCRGLTLGDAQVSELHCNFLVNRGKASAADIENLGEMVRQKVLAETGVELEWEIL 297

Query: 302 RLG 304
           R+G
Sbjct: 298 RVG 300


>gi|254470499|ref|ZP_05083903.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Pseudovibrio sp.
           JE062]
 gi|211960810|gb|EEA96006.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Pseudovibrio sp.
           JE062]
          Length = 324

 Score =  224 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 156/311 (50%), Positives = 206/311 (66%)

Query: 3   YGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDI 62
           Y  +  LL +  + +RG+   N  L  +TWFR GG A++MFQP D  DL  F+  LP D+
Sbjct: 7   YPDLLPLLGDAVEDIRGRLIPNQLLSAVTWFRVGGPAQLMFQPADEADLAVFMKALPEDV 66

Query: 63  PITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHG 122
           P+T+VGLGSN+LVRD GI GVV+RL   GF  +E     ++  GA    K LA  A + G
Sbjct: 67  PVTVVGLGSNLLVRDGGIEGVVIRLPIRGFGQVEYLGGHKLRAGASVPDKKLAEEAAKTG 126

Query: 123 IGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS 182
            GGF F+ GIPG++GGA  MNAGA+  ET   VV V+ + R G    +  E++ Y YR S
Sbjct: 127 TGGFAFYTGIPGAVGGALRMNAGAHGTETKDRVVNVNAVTRSGEILTLSNEEMGYAYRHS 186

Query: 183 EITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
             +KDLI T  V  GF +S++ I A +A+V  HRE  QPI+EKTGGSTFKNP G+SAW++
Sbjct: 187 SASKDLIFTSAVFEGFAQSEDEIRAEMADVVAHREKAQPIREKTGGSTFKNPEGNSAWKV 246

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           ++ +GCRGL+ GGAK+SELHCNFM+N  +AT +DLE LGE VR +   ++G  LEWEIKR
Sbjct: 247 VDAAGCRGLQIGGAKMSELHCNFMLNVADATAHDLEMLGETVRSEALAKTGTRLEWEIKR 306

Query: 303 LGDFFDHQIVD 313
           LG F D   ++
Sbjct: 307 LGAFVDGAAIE 317


>gi|220933051|ref|YP_002509959.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Halothermothrix
           orenii H 168]
 gi|219994361|gb|ACL70964.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Halothermothrix
           orenii H 168]
          Length = 304

 Score =  224 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 106/304 (34%), Positives = 162/304 (53%), Gaps = 6/304 (1%)

Query: 6   ISRLLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIP 63
           I+  L +  K++ G + ++  PLKQ T F+ GG AE+   P +I  LK  + +L  +++P
Sbjct: 3   INNKLLDILKEINGLEVKKGIPLKQYTSFKIGGPAELFLVPSNITALKKAVKILFNNNLP 62

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
             ++G GSNI+V D G  GVV+ L       +E             +   LA      G+
Sbjct: 63  YFVLGRGSNIIVSDKGYNGVVIYLGKLDKITVEETRVTSEC---GVTLARLAGRVAEAGL 119

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            G  F  GIPGS+GGA YMNAGA   E    V EV  +D+ G +  I   +LK+ YR S 
Sbjct: 120 TGLEFASGIPGSLGGALYMNAGAYGGEMKDVVKEVVVVDKTGKEISIKAPELKFSYRHSV 179

Query: 184 ITKDLII-THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
           + +   I    VL     ++  I   +  +   R+  QP++  + GS FK P G+ A +L
Sbjct: 180 LQEKHYIAVKAVLELKKGNREKIKTRMKELNEKRKQKQPLEWPSAGSAFKRPEGYYAGKL 239

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IE +G +GL  G A++S  H  F+IN   AT  D+  L  ++++KV++++G+LLE E K 
Sbjct: 240 IEDAGLKGLRVGDAQVSTKHAGFIINLGEATASDVRKLMNKIQQKVYDKNGVLLEPEPKF 299

Query: 303 LGDF 306
           +GDF
Sbjct: 300 IGDF 303


>gi|103487363|ref|YP_616924.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sphingopyxis
           alaskensis RB2256]
 gi|123253132|sp|Q1GRY1|MURB_SPHAL RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|98977440|gb|ABF53591.1| UDP-N-acetylmuramate dehydrogenase [Sphingopyxis alaskensis RB2256]
          Length = 299

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 119/292 (40%), Positives = 171/292 (58%), Gaps = 1/292 (0%)

Query: 14  GKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNI 73
              +RGK     PL  + WF++GG A+ +F+P+D+ DL  FL  L   IP+  +GLGSN+
Sbjct: 7   LPAVRGKLTPQAPLAPLVWFKSGGAADWLFEPKDVDDLADFLRDLDPAIPVMALGLGSNL 66

Query: 74  LVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           +VRD G  GVV+RL  A      +            SG  ++++A   GI G  F   IP
Sbjct: 67  IVRDGGFPGVVVRLGKAFAKVEPIDATTLRCG-GGASGILVSSTARDAGIAGMEFLRSIP 125

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHV 193
           G++GG   MN GA   E    +V+   + R G +  +    L Y YR SE+ +  ++   
Sbjct: 126 GTVGGFVRMNGGAYGGEVKDILVDCDVVLRSGERKTLALADLGYTYRHSELPEGAVVVGA 185

Query: 194 VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEF 253
             RG P +   I A +  +   RE  QP++ +TGGSTFKNP GH AWQL++ +GCRGL  
Sbjct: 186 TFRGRPGASAAIQAEMDRISASREASQPLRSRTGGSTFKNPAGHKAWQLVDAAGCRGLMV 245

Query: 254 GGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           GGA++SE H NF+IN  +AT  D+E LGE+VR++V ++SGI L+WEI+R+G 
Sbjct: 246 GGAQVSEKHTNFLINTGDATSADIEALGEEVRRRVKDKSGIELQWEIQRVGK 297


>gi|295093104|emb|CBK82195.1| UDP-N-acetylmuramate dehydrogenase [Coprococcus sp. ART55/1]
          Length = 304

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 102/308 (33%), Positives = 155/308 (50%), Gaps = 6/308 (1%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    I   +RE   +       +  +   T FR GG A+    P D   +   + L   
Sbjct: 1   MSDLEILNSIREITGE--KNASADEVMSAHTTFRVGGPADYFASPSDADQVAGLIELCRK 58

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +IP  ++G GSN+LV DAG RG+++ + +             +   A      ++  A 
Sbjct: 59  CEIPYFVLGNGSNLLVSDAGYRGMIINIMDNMNGITVD--GDVITAQAGAKLVRVSRLAR 116

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            + + G  F  GIPG+IGGA YMNAGA   E    V  V  +D  G+ + +  ++L + Y
Sbjct: 117 DNSLTGLEFASGIPGTIGGAVYMNAGAYGGEMKDVVTSVKVMDADGHIYDMSSDELDFSY 176

Query: 180 RSSEIT-KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S +  + LI+  V ++     Q  I   +  +   R T QP++  + GSTFK P G+ 
Sbjct: 177 RHSAVEAEGLIVLEVTMKLAAGVQQDIDDRMKELSDSRRTKQPLEYPSAGSTFKRPEGYF 236

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI ++G RG   GGA++SE HC F++N   AT  D+  L   V+KKV +Q G++LE 
Sbjct: 237 AGKLIMEAGLRGYSVGGAQVSEKHCGFVVNRGGATAADVTGLIHDVQKKVMDQFGVMLEP 296

Query: 299 EIKRLGDF 306
           E+K LGDF
Sbjct: 297 EVKMLGDF 304


>gi|270159085|ref|ZP_06187741.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Legionella
           longbeachae D-4968]
 gi|289166079|ref|YP_003456217.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Legionella
           longbeachae NSW150]
 gi|269987424|gb|EEZ93679.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Legionella
           longbeachae D-4968]
 gi|288859252|emb|CBJ13186.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Legionella
           longbeachae NSW150]
          Length = 303

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 101/296 (34%), Positives = 151/296 (51%), Gaps = 2/296 (0%)

Query: 12  ERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGS 71
           +   +L+G    N  L + T +R GG A  +++P +I DL  FL  LP   P+  +GLGS
Sbjct: 9   DFTDKLQGTLLYNESLAEYTTWRVGGPAAKLYKPANIADLSLFLRQLPETEPLLWLGLGS 68

Query: 72  NILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYG 131
           N L+RD G  G  + L+      + + +   + VGA  S  S+A    R+ + G  F+ G
Sbjct: 69  NSLIRDGGFSG-TVILTQGCLKEVALLDAQTIKVGAGVSCASMARFCARNDLSGGEFWAG 127

Query: 132 IPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIIT 191
           IPG++GGA  MNAG +  ET Q V+E+  + R+G   +   E+ +  YR      D    
Sbjct: 128 IPGTMGGALRMNAGCHGGETWQSVIELQTMTRRGEIKIRKPEEYEVAYRHVLAPSDEWFV 187

Query: 192 HVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGL 251
               +  P ++      I ++  HR   QP  E   GS F+NP G  A +LIE  G +G 
Sbjct: 188 SATFKLNPGNKETSLQVIKDLLAHRANTQPTNEYNCGSVFRNPPGDYAARLIESCGLKGF 247

Query: 252 EFGGAKISELHCNFMINA-DNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
             GGA +S+ H NF+IN   +A   D+E L   V+ KV  Q+ I L  E+  +GD+
Sbjct: 248 TIGGAVVSQKHANFIINHQGSAIAADIEALIHLVQTKVREQTTIELMREVHIIGDY 303


>gi|295688571|ref|YP_003592264.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Caulobacter segnis
           ATCC 21756]
 gi|295430474|gb|ADG09646.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Caulobacter segnis
           ATCC 21756]
          Length = 301

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 123/296 (41%), Positives = 163/296 (55%), Gaps = 3/296 (1%)

Query: 11  RERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLG 70
           +     +RGK   +  L   TWFR GG A+V+F P D  DL  FL  L   +P+  +G+G
Sbjct: 4   KTHLPTVRGKLLIDEALAPFTWFRVGGPADVVFLPADEQDLSDFLKALDPAVPVMAIGVG 63

Query: 71  SNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFY 130
           SN+LVRD G+ GV++RL     + +E      +  G+      LA  A   GI G  F+ 
Sbjct: 64  SNLLVRDGGVDGVIIRLGKGF-NTVEPLGDNRIKAGSAVPDAILARKAAEAGIAGLEFYA 122

Query: 131 GIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLII 190
           GIPG+IGGA  MNAG    ET   V  V  +DR G    +  E L Y YR S +     +
Sbjct: 123 GIPGTIGGAVIMNAGCYGSETVNVVKSVRVMDRAGVVRELAVEDLHYTYRHSALQDGETV 182

Query: 191 THVVLRGFPESQNIISAAIAN--VCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGC 248
             +       +    +       +   RET QPI+EKTGGSTFKNP GHS+W+L++++G 
Sbjct: 183 IVLDAVFEGTADEPEAIKARMAEITARRETTQPIREKTGGSTFKNPPGHSSWKLVDEAGW 242

Query: 249 RGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           RG  FGGA  S LH NF+IN   AT  DLE LGE VR  V  ++G+ L+WEIKR+G
Sbjct: 243 RGKLFGGAMFSPLHSNFLINTGEATAADLEGLGEAVRADVKAKTGVQLDWEIKRIG 298


>gi|296133657|ref|YP_003640904.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermincola sp. JR]
 gi|296032235|gb|ADG83003.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermincola potens
           JR]
          Length = 302

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 104/302 (34%), Positives = 159/302 (52%), Gaps = 4/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           I R   E    + G+   N P+   T +R GG A++M  P+DI D    + L     IP 
Sbjct: 3   ICRFREELQNLISGEILVNEPMSLHTTWRIGGPADLMLIPEDIEDCWAAIKLAKKYGIPY 62

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G GSN+LV+D GIRG+V++++              +   A      +A  A  H + 
Sbjct: 63  LVMGNGSNLLVKDRGIRGLVIKMAAGEVKV--DEEQNLIFAPAGTLLPVVARVAADHALS 120

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE- 183
           G  F  GIP S+GGA  MNAGA+     + V EV+ +D  G   V+P   L ++YR S  
Sbjct: 121 GLEFAVGIPASVGGAIVMNAGAHGKSIGEVVKEVNVLDSDGELLVLPGRDLDFRYRYSNI 180

Query: 184 ITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
           + K+ I+T  V          I   +      R  +QP+ +   GS FKNP G SA +LI
Sbjct: 181 LQKNFIVTKAVFLLARAPAVEIKKRMTEFLEKRRQLQPVGKPNAGSVFKNPAGTSAGRLI 240

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           + +GC+GL  G A++SE H NF++N D+AT +D+  L EQV+  V+ +  ++LE E++ +
Sbjct: 241 DAAGCKGLTVGDAQVSEKHANFILNLDSATAHDVLTLIEQVKNAVYKKFNVMLELEVQVV 300

Query: 304 GD 305
           G+
Sbjct: 301 GE 302


>gi|302669474|ref|YP_003829434.1| UDP-N-acetylenolpyruvoylglucosamine reductase MurB [Butyrivibrio
           proteoclasticus B316]
 gi|302393947|gb|ADL32852.1| UDP-N-acetylenolpyruvoylglucosamine reductase MurB [Butyrivibrio
           proteoclasticus B316]
          Length = 303

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 103/307 (33%), Positives = 157/307 (51%), Gaps = 6/307 (1%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-S 60
           +   I   L++    L      N  + + T F+TGG A +  +P  +  LK  + LL  +
Sbjct: 1   MNHDIIEALKQIDSDLEMNI--NEKMSRHTTFKTGGPASLFIRPDSLEQLKKVVALLKRA 58

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           ++   I+G GSN+LV D G       +S   F++I + +   +   A     ++A  A  
Sbjct: 59  EVSYFILGNGSNLLVSDKGYD--GAIISTDKFTDIRLEDEKTIYAEAGVKNSAIAAFARD 116

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
           + + GF F  GIPGS+GGA  MNAGA   E    V EV  +  +G    +  E L++ YR
Sbjct: 117 NSLTGFEFAAGIPGSLGGAVIMNAGAYGGEMKLIVKEVRALSPQGEIIRLDNEALRFDYR 176

Query: 181 SSEIT-KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
           +S +  KD I+   +L      ++ ISA +  +   R+  QP++  + GSTFK P G+ A
Sbjct: 177 TSALKGKDFIVISALLELEKGDKDEISAQMNELALKRKEKQPLEYPSAGSTFKRPEGYFA 236

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LIE SG RG   GGA +S+ HC F+IN   AT  D+  L   V+  V+ + G+ LE E
Sbjct: 237 GKLIEDSGLRGYTVGGAMVSDKHCGFVINKGEATSKDIYTLILNVQNTVYEKFGVRLEPE 296

Query: 300 IKRLGDF 306
           +  LG F
Sbjct: 297 VILLGKF 303


>gi|307611492|emb|CBX01163.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Legionella
           pneumophila 130b]
          Length = 310

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 105/288 (36%), Positives = 151/288 (52%), Gaps = 2/288 (0%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDA 78
           G    N PL + T +R GG A  +++P +I DL  FL+ LP D P+  +GLGSN L+RD 
Sbjct: 18  GTLLFNEPLAEYTTWRVGGPAARLYKPANIDDLALFLSRLPFDEPLLWLGLGSNSLIRDG 77

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           G  G  + L+      + + +   + V A  S  S+A  + R+ + G  F+ GIPG++GG
Sbjct: 78  GFSG-TVILTQGCLKEMTLLSDNCIRVEAGVSCASMARFSARNNLSGGEFWAGIPGTMGG 136

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGF 198
           A  MNAG +  ET Q V+EV  I+R+G       E+ +  YR      D       L+  
Sbjct: 137 ALRMNAGCHGGETWQSVIEVQTINRRGEIRTRKPEEFEVAYRHVAGLGDEWFISAKLQLS 196

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P ++      I ++  HR   QP  E   GS F+NP G  A +LIE  G +G+  GGA +
Sbjct: 197 PGNKETSLQLIKDLLAHRAKTQPTNEYNCGSVFRNPPGDFAARLIESCGLKGVSIGGAVV 256

Query: 259 SELHCNFMINA-DNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H NF+IN    AT  ++E L   V+ KV  Q+ I L  E+  +GD
Sbjct: 257 SEKHANFIINHQGTATAANIEALIHLVQTKVREQTSIELIREVHIIGD 304


>gi|115311640|sp|Q5ZSA6|MURB_LEGPH RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
          Length = 308

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 105/288 (36%), Positives = 151/288 (52%), Gaps = 2/288 (0%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDA 78
           G    N PL + T +R GG A  +++P +I DL  FL+ LP D P+  +GLGSN L+RD 
Sbjct: 16  GTLLFNEPLAEYTTWRVGGPAARLYKPANIDDLALFLSRLPFDEPLLWLGLGSNSLIRDG 75

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           G  G  + L+      + + +   + V A  S  S+A  + R+ + G  F+ GIPG++GG
Sbjct: 76  GFSG-TVILTQGCLKEMTLLSDNCIRVEAGVSCASMARFSARNNLSGGEFWAGIPGTMGG 134

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGF 198
           A  MNAG +  ET Q V+EV  I+R+G       E+ +  YR      D       L+  
Sbjct: 135 ALRMNAGCHGGETWQSVIEVQTINRRGEIRTRKPEEFEVAYRHVAGLGDEWFISAKLQLS 194

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P ++      I ++  HR   QP  E   GS F+NP G  A +LIE  G +G+  GGA +
Sbjct: 195 PGNKETSLQLIKDLLAHRAKTQPTNEYNCGSVFRNPPGDFAARLIESCGLKGVSIGGAVV 254

Query: 259 SELHCNFMINA-DNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H NF+IN    AT  ++E L   V+ KV  Q+ I L  E+  +GD
Sbjct: 255 SEKHANFIINHQGTATAANIEALIHLVQTKVREQTSIELIREVHIIGD 302


>gi|52842819|ref|YP_096618.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|52629930|gb|AAU28671.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
          Length = 312

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 105/288 (36%), Positives = 151/288 (52%), Gaps = 2/288 (0%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDA 78
           G    N PL + T +R GG A  +++P +I DL  FL+ LP D P+  +GLGSN L+RD 
Sbjct: 20  GTLLFNEPLAEYTTWRVGGPAARLYKPANIDDLALFLSRLPFDEPLLWLGLGSNSLIRDG 79

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           G  G  + L+      + + +   + V A  S  S+A  + R+ + G  F+ GIPG++GG
Sbjct: 80  GFSG-TVILTQGCLKEMTLLSDNCIRVEAGVSCASMARFSARNNLSGGEFWAGIPGTMGG 138

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGF 198
           A  MNAG +  ET Q V+EV  I+R+G       E+ +  YR      D       L+  
Sbjct: 139 ALRMNAGCHGGETWQSVIEVQTINRRGEIRTRKPEEFEVAYRHVAGLGDEWFISAKLQLS 198

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P ++      I ++  HR   QP  E   GS F+NP G  A +LIE  G +G+  GGA +
Sbjct: 199 PGNKETSLQLIKDLLAHRAKTQPTNEYNCGSVFRNPPGDFAARLIESCGLKGVSIGGAVV 258

Query: 259 SELHCNFMINA-DNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H NF+IN    AT  ++E L   V+ KV  Q+ I L  E+  +GD
Sbjct: 259 SEKHANFIINHQGTATAANIEALIHLVQTKVREQTSIELIREVHIIGD 306


>gi|54295450|ref|YP_127865.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Legionella
           pneumophila str. Lens]
 gi|81367751|sp|Q5WTI8|MURB_LEGPL RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|53755282|emb|CAH16776.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Legionella
           pneumophila str. Lens]
          Length = 308

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 105/288 (36%), Positives = 151/288 (52%), Gaps = 2/288 (0%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDA 78
           G    N PL + T +R GG A  +++P +I DL  FL+ LP D P+  +GLGSN L+RD 
Sbjct: 16  GTLLFNEPLAEYTTWRVGGPAARLYKPANIDDLALFLSRLPFDEPLLWLGLGSNSLIRDG 75

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           G  G  + L+      + + +   + V A  S  S+A  + R+ + G  F+ GIPG++GG
Sbjct: 76  GFSG-TVILTQGCLKEMTLLSDNCIRVEAGVSCASMARFSARNNLSGGEFWAGIPGTMGG 134

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGF 198
           A  MNAG +  ET Q V+EV  I+R+G       E+ +  YR      D       L+  
Sbjct: 135 ALRMNAGCHGGETWQSVIEVQTINRRGEIRTRKPEEFEVAYRHVAGLGDEWFISAKLQLS 194

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P ++      I ++  HR   QP  E   GS F+NP G  A +LIE  G +G+  GGA +
Sbjct: 195 PGNKETSLQLIKDLLAHRAKTQPTNEYNCGSVFRNPPGDFAARLIESCGLKGVSIGGAVV 254

Query: 259 SELHCNFMINA-DNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H NF+IN    AT  ++E L   V+ KV  Q+ I L  E+  +GD
Sbjct: 255 SEKHANFIINHQGTATAANIEALIHLVQTKVREQTSIELIREVHIIGD 302


>gi|258514344|ref|YP_003190566.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Desulfotomaculum
           acetoxidans DSM 771]
 gi|257778049|gb|ACV61943.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Desulfotomaculum
           acetoxidans DSM 771]
          Length = 304

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 108/303 (35%), Positives = 167/303 (55%), Gaps = 4/303 (1%)

Query: 7   SRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPIT 65
             +  +  + L G+ + N P+ + T +R GG AEV+ +P  + D+K          IP+T
Sbjct: 3   ETIFNDLEQVLSGQLKYNEPMSRHTSWRVGGPAEVLVEPSGMVDIKTACEYARDKKIPLT 62

Query: 66  IVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGG 125
           ++G GSN+LV D GI+G+VL++               ++ GA      +A +A   G+GG
Sbjct: 63  VIGNGSNLLVSDYGIKGMVLKIGKGLSDIEIDNET--IMAGAGAKLSRIAAAAGAAGVGG 120

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT 185
             F  GIPG++GGA  MNAGA     SQ +  V  I++ G      +E + + YRSS + 
Sbjct: 121 LEFMAGIPGTLGGAVVMNAGAYGKSISQVLKRVSLINQNGQVSCQEQENIIFDYRSSSLQ 180

Query: 186 K-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIE 244
           +  LI+T  VL G+   +  I   + ++   R + QP+     GS F+NP G+SA +LIE
Sbjct: 181 ESGLIVTEGVLEGYLRDEKQIKDDMKDMGEKRRSSQPLNYPNAGSVFRNPPGYSAGKLIE 240

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           +SG +GL  G A++SE H NF+IN  +AT  D+  L E+V++ V  + GI L+ EI+ LG
Sbjct: 241 ESGAKGLRVGDAQVSEKHANFIINLGSATAEDILQLIERVQRMVEKRFGIRLKKEIRVLG 300

Query: 305 DFF 307
            F 
Sbjct: 301 RFL 303


>gi|326792000|ref|YP_004309821.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           lentocellum DSM 5427]
 gi|326542764|gb|ADZ84623.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           lentocellum DSM 5427]
          Length = 303

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 96/303 (31%), Positives = 157/303 (51%), Gaps = 5/303 (1%)

Query: 5   RISRLLRERGKQLRGK-FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDI 62
            I+++++   +++  +    + P+K  T F+ GG A++M +P++   L   L +     +
Sbjct: 2   DINKIVQLLSEKIPTQHILTHEPMKNYTTFKIGGLADIMVKPENKEQLSTILQVCATEKV 61

Query: 63  PITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHG 122
           P  I+G GSN+LV DAG RGV+++L N             +   +      +A  AL + 
Sbjct: 62  PYYILGNGSNLLVSDAGYRGVIIQLYNQFAEITVED--NRITAQSGALLARIAAKALENE 119

Query: 123 IGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS 182
           + GF F +GIPG++GGA  MNAGA   E    +     +  +G    +  E+L+  YR+S
Sbjct: 120 LTGFEFAHGIPGTLGGAVVMNAGAYGGEMKHVIASCEVMTPEGEILKLSNEELELGYRTS 179

Query: 183 EITK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
            I K   I+        P  +  I   + +    R   QP+ + + GSTFK P G+ A +
Sbjct: 180 VIQKKGYIVLEATFILEPGDKEKIQELMKDYAGRRRDKQPLDKPSAGSTFKRPEGYFAGK 239

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           LI  SG RG + GGA IS+ HC F++N   AT  D+ +L ++V++ V  +  + LE E+K
Sbjct: 240 LIMDSGLRGFQVGGAMISDKHCGFVVNTGEATCEDVIHLIQEVKRIVKEKFDVELEPEVK 299

Query: 302 RLG 304
            LG
Sbjct: 300 MLG 302


>gi|225175386|ref|ZP_03729381.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Dethiobacter
           alkaliphilus AHT 1]
 gi|225169138|gb|EEG77937.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Dethiobacter
           alkaliphilus AHT 1]
          Length = 307

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 94/288 (32%), Positives = 159/288 (55%), Gaps = 4/288 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTL-LPSDIPITIVGLGSNILVRDAG 79
           +  +  +K+ T F+TGG A+++ +PQ I +L   +   L  ++P  I+G GSN+LV D G
Sbjct: 20  YFPDEDMKKHTTFKTGGTADLLVEPQSIDELHKLMKFVLNEEVPYIIIGRGSNLLVSDQG 79

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           +R +V+R+            +  + V A  +   +A+ A R+ + G  F  GIPG++GGA
Sbjct: 80  VRELVIRIDKNLSKY--ETKNETLEVEAGAAIIDVAHFAQRNSLSGLEFASGIPGTVGGA 137

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGF 198
            +MNAGA   E    + EV  +   G+  V   ++L   YR+S + ++  I+     +  
Sbjct: 138 VFMNAGAYGGEVKDVLEEVLVLTTDGHLVVKSVDELGLGYRTSVMQRNGDIVLKAKFKLQ 197

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
             +Q +I   I  +   RE  QP++  + GSTFK PTG+ A +LI+ +G +G   GGA++
Sbjct: 198 KGNQEVIQNEINELKRKREESQPLELPSAGSTFKRPTGYFAGKLIQDAGLKGYRIGGAQV 257

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           S  H  F++N+ NA+  D+  L   ++ +V  Q G+ LE E+K +G+F
Sbjct: 258 SLKHAGFVVNSGNASSSDIYNLIRHIQAEVKKQFGVTLETEVKLIGEF 305


>gi|312128503|ref|YP_003993377.1| udp-n-acetylenolpyruvoylglucosamine reductase [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311778522|gb|ADQ08008.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 310

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 88/291 (30%), Positives = 133/291 (45%), Gaps = 7/291 (2%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDA 78
           +F ++ PLK +T F+ GG A  +  P+   +L   LTL     I   +VG  SNILV D 
Sbjct: 9   EFLKDHPLKDLTTFKIGGKARYIIFPKSTEELVKVLTLAKDKAINHVVVGNCSNILVSDK 68

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           G       +      +    +   +          +A  A   G+ GF F  GIPG++GG
Sbjct: 69  GF---DGTIIATVKIDFFKIDGNVIEAECGAMLSQVARKACEAGLKGFEFAVGIPGTVGG 125

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIIT---HVVL 195
           A YMNAGA + E          +D   N   + R  +++ YR S + ++ ++       L
Sbjct: 126 AVYMNAGAYDGEIKDVFEWAEVLDENLNPVELGRADMRFSYRHSRLKEEKMVLLRAAFCL 185

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           +   +               R   QP+   + GS FK P  + A +LIE +G +G   G 
Sbjct: 186 KFADKEDISPLQKANEFSKRRREKQPLSYPSAGSVFKRPPNNYAGKLIEDAGLKGYRIGD 245

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           A ISE H  F+IN  +A   D+  L    +K V+ + GILLE EI+ +G+F
Sbjct: 246 ACISEKHAGFIINLGDAKAEDVRKLIYLAQKTVYEKFGILLEPEIQFIGEF 296


>gi|217979593|ref|YP_002363740.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylocella
           silvestris BL2]
 gi|217504969|gb|ACK52378.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylocella
           silvestris BL2]
          Length = 315

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 130/305 (42%), Positives = 170/305 (55%), Gaps = 2/305 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M +  ++  LR     LRG    N PL  +T+FRTGG A+++F+P D  DL YFL  L  
Sbjct: 1   MAFPDLTPELRRAMPDLRGAISPNAPLSGLTFFRTGGPAQILFEPADEADLAYFLQRLDP 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           ++ +  +G GSN+LVRD GI+GVV+RL                  GA      LA  A R
Sbjct: 61  NLNVMTLGAGSNLLVRDGGIKGVVIRLGRPFEEIAIEGLRVT--AGAAARDMKLALVAGR 118

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
            G+ G  F  G+PGSIGGA  MNAGA   E    ++    +DR G         + + YR
Sbjct: 119 AGVAGLSFLRGVPGSIGGALRMNAGAYGSEIKDRLICCRVVDRAGKIIEFANADMGFSYR 178

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
            S I  D+I T     G P     + A +A +   R   QP+  +TGGSTFKNP GH AW
Sbjct: 179 HSAIGPDVIFTGATFEGLPGEPEKLMAEMAEITAERGKTQPVNSRTGGSTFKNPPGHKAW 238

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
            LI+ +GCRGL  G A+IS+LHCNF+IN  +A   DLE LGE+VR +V   SG+ LEWEI
Sbjct: 239 ALIDAAGCRGLTIGDAQISQLHCNFLINQGSAAAADLEALGEEVRTRVKATSGVSLEWEI 298

Query: 301 KRLGD 305
            R+G+
Sbjct: 299 LRVGE 303


>gi|160878488|ref|YP_001557456.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           phytofermentans ISDg]
 gi|187609716|sp|A9KSS3|MURB_CLOPH RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|160427154|gb|ABX40717.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           phytofermentans ISDg]
          Length = 310

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 97/306 (31%), Positives = 153/306 (50%), Gaps = 6/306 (1%)

Query: 6   ISRLLRERGKQLRG--KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDI 62
           ++ ++ +  K +    +   N PL + T F+ GG A+     + I +    +      ++
Sbjct: 1   MNNVILQELKNIVSTERVTCNEPLSKHTSFKIGGPADYFVITKKIEETAAVIQCCNQHNL 60

Query: 63  PITIVGLGSNILVRDAGIRGVVLRLSNAGFSNI--EVRNHCEMIVGARCSGKSLANSALR 120
           P+ ++G GSN+L+ DAGIRGVVL+  +        +      +  GA  +  + A     
Sbjct: 61  PLLMIGKGSNLLISDAGIRGVVLKQEDNTEGFFVTQCEEGYLVTGGAGMNLSAFAMKIAN 120

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             + GF F  GIPGS+GGA YMNAGA   E    +     + ++G    + RE+L+  YR
Sbjct: 121 ESLTGFEFAAGIPGSLGGAVYMNAGAYGGEIKDCIKSARVLTKEGQILSLNREELELSYR 180

Query: 181 SSEITKDLIITHVVLRG-FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
           SS I K               +Q  I   I  +   R+  QP++  + GSTFK P G+ A
Sbjct: 181 SSIIQKKGYYVIDATFLLQKGNQEDILRKIEELNQARKDKQPLEYPSAGSTFKRPEGYFA 240

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LI  +G RG   GGA +SE HC F+IN  +AT  D+  L + VR+ V  + G+ LE E
Sbjct: 241 GKLIMDAGLRGYRVGGAMVSEKHCGFVINTGDATAKDVLQLIDDVRRIVKEKFGVTLEPE 300

Query: 300 IKRLGD 305
           ++ +G+
Sbjct: 301 VRLIGE 306


>gi|254495867|ref|ZP_05108777.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Legionella
           drancourtii LLAP12]
 gi|254354903|gb|EET13528.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Legionella
           drancourtii LLAP12]
          Length = 300

 Score =  223 bits (568), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 103/295 (34%), Positives = 145/295 (49%), Gaps = 2/295 (0%)

Query: 12  ERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGS 71
           E   + +G    N PL + T +R GG A  +++P    DL  FL  LP   P+  +GLGS
Sbjct: 6   ELTAEYQGTLLYNEPLAEYTTWRVGGPAAKLYKPAHAADLALFLRNLPEREPLLWLGLGS 65

Query: 72  NILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYG 131
           N L++D G  G  + L+      I + +   + V A  S  S+A    R+ + G  F+ G
Sbjct: 66  NSLIKDNGFSG-TVVLTQGCLKEINLLSAQTVKVDAGVSCASMARFCARNNLSGGEFWAG 124

Query: 132 IPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIIT 191
           IPG++GGA  MNAG +  ET Q VVEV  I R G   +   E+ +  YR      D    
Sbjct: 125 IPGTMGGALRMNAGCHGGETWQSVVEVQTITRSGEIKIRKPEEYEVAYRHVSGPADEWFI 184

Query: 192 HVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGL 251
               +    ++      I ++  HR   QP  E   GS F+NP G  A +LIE  G +G 
Sbjct: 185 SATFKLLAGTKETSLQVIKDLLAHRANTQPTSECNCGSVFRNPPGDFAARLIESCGLKGF 244

Query: 252 EFGGAKISELHCNFMINADN-ATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
             GGA +S+ H NF+IN    AT  D+E L   V+ KV  Q+ I L  E+  +GD
Sbjct: 245 SIGGAMVSQKHANFIINHQGLATAADIEALIHLVQTKVREQTTIELMREVHIIGD 299


>gi|167760168|ref|ZP_02432295.1| hypothetical protein CLOSCI_02540 [Clostridium scindens ATCC 35704]
 gi|167662293|gb|EDS06423.1| hypothetical protein CLOSCI_02540 [Clostridium scindens ATCC 35704]
          Length = 310

 Score =  223 bits (568), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 110/309 (35%), Positives = 164/309 (53%), Gaps = 5/309 (1%)

Query: 1   MIYGRISRLLRERGKQL-RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP 59
           M Y       +E    + + + Q   P++  T FR GG AE   QP+   +++  + L  
Sbjct: 4   MEYDMNQDFYQELLNIISKEQIQIEEPMRNHTTFRVGGPAEFFVQPKTAEEVQGLVGLCK 63

Query: 60  S-DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSA 118
             +IP  IVG GSN+LV D G RGV++++               +   A     ++A+ A
Sbjct: 64  EREIPYYIVGNGSNLLVSDQGFRGVIIQIFKEMSQI--QIEGELVKAQAGALLSAIASKA 121

Query: 119 LRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQ 178
           L  G+ GF F  GIPG++GGA  MNAGA   E    + EV  +  +G    IP E+L+  
Sbjct: 122 LEAGLAGFEFAAGIPGALGGACVMNAGAYGKEMKDVLREVTVLTPEGEVLAIPDEKLELG 181

Query: 179 YRSSEI-TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGH 237
           YR+S I  K  I+   V+R     +  I A +  +   R T QP++  + GSTFK P G+
Sbjct: 182 YRTSIIAKKGYIVLEAVIRLQKGEKEEIKARMDELKEKRITKQPLEYPSAGSTFKRPEGY 241

Query: 238 SAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLE 297
            A +LI+ +G +G   GGA++S  HC F+IN DNAT  D+  L  +V ++V  + G+ LE
Sbjct: 242 FAGKLIQDAGLQGFSVGGAQVSMKHCGFVINKDNATAADVAELMRKVSEQVEEKFGVRLE 301

Query: 298 WEIKRLGDF 306
            E+KRLG+F
Sbjct: 302 PEVKRLGEF 310


>gi|294501019|ref|YP_003564719.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus megaterium
           QM B1551]
 gi|295706368|ref|YP_003599443.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus megaterium
           DSM 319]
 gi|294350956|gb|ADE71285.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus megaterium
           QM B1551]
 gi|294804027|gb|ADF41093.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus megaterium
           DSM 319]
          Length = 301

 Score =  223 bits (568), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 98/302 (32%), Positives = 149/302 (49%), Gaps = 5/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           +  L++E  +   GK +EN PL + T  + GG A+V+ +P  +  LK  + ++    +  
Sbjct: 1   MEALVKELVEANIGKVRENEPLAKHTTMKIGGPADVLVEPDSVDHLKVTMDIIKKHGVKW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
             +G GSN+LV D GI GVV++L                 VG       LA    + G+ 
Sbjct: 61  RAIGRGSNLLVSDKGIEGVVIKLGAGLDDLTVDGETVT--VGGGYPSIKLATVITKQGLS 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA+  + S  V +   +   G    +  E+L++ YR S +
Sbjct: 119 GLEFSSGIPGSVGGAVYMNAGAHGSDMSHVVEKALILFEDGTLEWLTNEELQFSYRHSIL 178

Query: 185 TKDLIITHVVL--RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
            KD     V    R    +++ I A +     +R   QP      GS F+NP  + A  L
Sbjct: 179 QKDRPGVCVEAVLRLKKGTKDDIVAVMQKNKDYRRETQPWNFPCAGSIFRNPLPNYAGDL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IEKS  +G   GGA+ISE H NF++N  +AT  D+  L   V+K +  +  I +  E++ 
Sbjct: 239 IEKSNLKGFSVGGAQISEQHANFIVNTGDATASDVLNLIAHVKKTIKEKFDIDIHTEVEI 298

Query: 303 LG 304
           +G
Sbjct: 299 IG 300


>gi|241205555|ref|YP_002976651.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240859445|gb|ACS57112.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 324

 Score =  223 bits (568), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 174/309 (56%), Positives = 225/309 (72%)

Query: 4   GRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIP 63
            ++   L +  K +RG+   + P+ ++TWFR GG AE+MFQP DI DL  FL +LP ++P
Sbjct: 7   EKLLASLGDGVKDIRGRITPDAPMDRVTWFRAGGLAELMFQPHDIDDLIAFLKILPEEVP 66

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           +T+VG+GSNILVRD GI GVVLRLS  GF  +E+     ++ GA C  K +A  A+ +GI
Sbjct: 67  LTVVGVGSNILVRDGGIPGVVLRLSAKGFGFVELAGENRILAGAICPDKHVAAMAMDNGI 126

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
           GGFHFFYGIPG IGGAA MNAGAN  ET + ++EVH +DRKG++HV+   ++ Y YR S 
Sbjct: 127 GGFHFFYGIPGGIGGAARMNAGANGVETRERLIEVHAVDRKGDKHVLSNAEMGYSYRHST 186

Query: 184 ITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            + DLI T V+  G+PE +  I   +  V +HRETVQP++EKTGGSTFKNP GHSAW+L+
Sbjct: 187 ASTDLIFTSVLFEGYPEERAQIRTEMDAVRNHRETVQPVREKTGGSTFKNPAGHSAWKLV 246

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           +++GCRGL  GGA++S LHCNFMIN   ATGYDLEYLGEQVR++VF + GI LEWEIKRL
Sbjct: 247 DEAGCRGLVIGGAQMSSLHCNFMINMGQATGYDLEYLGEQVRREVFEKDGIKLEWEIKRL 306

Query: 304 GDFFDHQIV 312
           G F   + V
Sbjct: 307 GVFMPGREV 315


>gi|296108258|ref|YP_003619959.1| UDP-N-acetylmuramate dehydrogenase [Legionella pneumophila 2300/99
           Alcoy]
 gi|295650160|gb|ADG26007.1| UDP-N-acetylmuramate dehydrogenase [Legionella pneumophila 2300/99
           Alcoy]
          Length = 303

 Score =  223 bits (568), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 105/288 (36%), Positives = 151/288 (52%), Gaps = 2/288 (0%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDA 78
           G    N PL + T +R GG A  +++P +I DL  FL+ LP D P+  +GLGSN L+RD 
Sbjct: 11  GALLFNEPLAEYTTWRVGGPAARLYKPANIDDLALFLSRLPFDEPLLWLGLGSNSLIRDG 70

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           G  G  + L+      + + +   + V A  S  S+A  + R+ + G  F+ GIPG++GG
Sbjct: 71  GFSG-TVILTQGCLKEMTLLSDNCIRVEAGVSCASMARFSARNNLSGGEFWAGIPGTMGG 129

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGF 198
           A  MNAG +  ET Q V+EV  I+R+G       E+ +  YR      D       L+  
Sbjct: 130 ALRMNAGCHGGETWQSVIEVQTINRRGEIRTRKPEEFEVAYRHVAGLGDEWFISAKLQLS 189

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P ++      I ++  HR   QP  E   GS F+NP G  A +LIE  G +G+  GGA +
Sbjct: 190 PGNKETSLQLIKDLLAHRAKTQPTNEYNCGSVFRNPPGDFAARLIESCGLKGVSIGGAVV 249

Query: 259 SELHCNFMINA-DNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H NF+IN    AT  ++E L   V+ KV  Q+ I L  E+  +GD
Sbjct: 250 SEKHANFIINHQGTATAANIEALIHLVQTKVREQTSIELIREVHIIGD 297


>gi|148358652|ref|YP_001249859.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Legionella
           pneumophila str. Corby]
 gi|166222839|sp|A5IAW3|MURB_LEGPC RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|148280425|gb|ABQ54513.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Legionella
           pneumophila str. Corby]
          Length = 308

 Score =  223 bits (568), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 105/288 (36%), Positives = 151/288 (52%), Gaps = 2/288 (0%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDA 78
           G    N PL + T +R GG A  +++P +I DL  FL+ LP D P+  +GLGSN L+RD 
Sbjct: 16  GALLFNEPLAEYTTWRVGGPAARLYKPANIDDLALFLSRLPFDEPLLWLGLGSNSLIRDG 75

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           G  G  + L+      + + +   + V A  S  S+A  + R+ + G  F+ GIPG++GG
Sbjct: 76  GFSG-TVILTQGCLKEMTLLSDNCIRVEAGVSCASMARFSARNNLSGGEFWAGIPGTMGG 134

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGF 198
           A  MNAG +  ET Q V+EV  I+R+G       E+ +  YR      D       L+  
Sbjct: 135 ALRMNAGCHGGETWQSVIEVQTINRRGEIRTRKPEEFEVAYRHVAGLGDEWFISAKLQLS 194

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P ++      I ++  HR   QP  E   GS F+NP G  A +LIE  G +G+  GGA +
Sbjct: 195 PGNKETSLQLIKDLLAHRAKTQPTNEYNCGSVFRNPPGDFAARLIESCGLKGVSIGGAVV 254

Query: 259 SELHCNFMINA-DNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H NF+IN    AT  ++E L   V+ KV  Q+ I L  E+  +GD
Sbjct: 255 SEKHANFIINHQGTATAANIEALIHLVQTKVREQTSIELIREVHIIGD 302


>gi|229544112|ref|ZP_04433171.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus coagulans
           36D1]
 gi|229325251|gb|EEN90927.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus coagulans
           36D1]
          Length = 303

 Score =  223 bits (568), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 91/302 (30%), Positives = 152/302 (50%), Gaps = 10/302 (3%)

Query: 11  RERGKQLRG-----KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPI 64
           +   + LR      +  E+ PL + T+ +TGG A+++  P+   +++  +     + +P 
Sbjct: 4   KTILQDLRSLIYPREILEDEPLSKYTFTKTGGKADILIFPETYEEVQKTVRFASLNGVPY 63

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           TI+G GSN++++D GIRG+VL L+     +       ++      +   ++  AL+  + 
Sbjct: 64  TILGNGSNLIIKDGGIRGIVLILTKLAKIS---HTGNDITAQCGAAIIDVSRYALKQKLT 120

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA   E    +     + + G    + +  L +QYR S I
Sbjct: 121 GLEFACGIPGSVGGALYMNAGAYGGEVKDVLKSALVLTKTGEMKRLEKSDLSFQYRKSSI 180

Query: 185 TKD-LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            ++  I         P     I A +  +   RE+ QP++  + GS FK P G+ A +LI
Sbjct: 181 AENGEIALEGTFSLEPGDAQEIKAKMDELTDLRESKQPLEYPSCGSVFKRPPGYFAGKLI 240

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           + SG +G   GG ++S  H  FM+N    T  D   L + V+K V  + G+ LE E+K +
Sbjct: 241 QDSGLQGKRIGGVEVSTKHAGFMVNVGGGTATDYMNLIKFVQKTVKEKFGVDLETEVKII 300

Query: 304 GD 305
           G+
Sbjct: 301 GE 302


>gi|288939896|ref|YP_003442136.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Allochromatium
           vinosum DSM 180]
 gi|288895268|gb|ADC61104.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Allochromatium
           vinosum DSM 180]
          Length = 294

 Score =  223 bits (568), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 104/290 (35%), Positives = 149/290 (51%), Gaps = 2/290 (0%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRG++Q + PL + T +R GG A  ++QP D  DL  F+  L  D P+  +GLGSN+LV 
Sbjct: 4   LRGRWQFDEPLSRHTSWRVGGPARRLYQPADADDLVGFMRQLDPDEPLLWLGLGSNLLVD 63

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           DAG  G  + L+      +E+R    +      S   LA  A RH + G  F  GIPG++
Sbjct: 64  DAGFPG-TVILTQGTLDTLELRGERRLYAEVGVSSAKLARFAARHDLTGIEFLAGIPGTL 122

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGA   ET  +V  V  +DR+G  H     + +  YR              L 
Sbjct: 123 GGALAMNAGAWGGETWSFVRRVWTLDRQGQIHEREASEYEPAYREIRGPAGEWFLAAELE 182

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
             P       A I  +   R   QP+ + + GS F+NP G  A +LI+  G +G   GGA
Sbjct: 183 LTPGDGAASLARIRELLDQRAATQPVGQPSCGSVFRNPPGDHAARLIDSLGLKGTRIGGA 242

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL-GD 305
           ++S +H NF+IN   AT  D+  L EQ+++ V   +GI L  E++R+ G+
Sbjct: 243 EVSSIHANFIINRGGATATDIARLIEQIQETVERHTGIRLMPEVRRIAGE 292


>gi|222149134|ref|YP_002550091.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Agrobacterium vitis
           S4]
 gi|254764126|sp|B9JY52|MURB_AGRVS RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|221736119|gb|ACM37082.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Agrobacterium vitis
           S4]
          Length = 324

 Score =  223 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 168/316 (53%), Positives = 213/316 (67%), Gaps = 3/316 (0%)

Query: 1   MIYGRISRLLRERGK---QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTL 57
           M      +LL   G     LRG+   + P+ ++TWF+ GG AE+MFQP D  DL  FL L
Sbjct: 1   MKQVDGEKLLARLGPGVDALRGRLTPDAPMDRVTWFQAGGLAELMFQPHDRDDLVTFLKL 60

Query: 58  LPSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANS 117
           LP D+P+T+VG+GSN+LVRD GI GVV+RLS  GF  +E+     +  GA C  K +A  
Sbjct: 61  LPDDVPLTVVGVGSNLLVRDGGIPGVVIRLSAKGFGGLELEGENRIRAGAICPDKHIAAM 120

Query: 118 ALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKY 177
           A+ + IGGF F+YGIPGSIGGA  MNAGAN  ET++ V+EV  +DR+GN HV+ +  + Y
Sbjct: 121 AMDNNIGGFAFYYGIPGSIGGALRMNAGANGGETAERVIEVEAVDRQGNLHVLSKADMGY 180

Query: 178 QYRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGH 237
            YR S   + LI    +  GF + ++ I A +  V  HRETVQP+KEKTGGSTFKNP GH
Sbjct: 181 GYRHSSAPEGLIFISGLFEGFSQEKSAIRAEMDAVRQHRETVQPVKEKTGGSTFKNPEGH 240

Query: 238 SAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLE 297
           SAW+LI++ G RGL  GGA++S LHCNFMIN  +AT YDLEYLGE +R +VF QSGI L+
Sbjct: 241 SAWELIDEVGGRGLMIGGAQMSSLHCNFMINVGHATAYDLEYLGETIRGQVFEQSGIKLQ 300

Query: 298 WEIKRLGDFFDHQIVD 313
           WEIKRLG F     V 
Sbjct: 301 WEIKRLGLFMPGSEVK 316


>gi|222086442|ref|YP_002544976.1| UDP-N-acetylenolpyruvoylglucosamine reductase protein
           [Agrobacterium radiobacter K84]
 gi|254764125|sp|B9JH49|MURB_AGRRK RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|221723890|gb|ACM27046.1| UDP-N-acetylenolpyruvoylglucosamine reductase protein
           [Agrobacterium radiobacter K84]
          Length = 324

 Score =  223 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 178/309 (57%), Positives = 226/309 (73%)

Query: 4   GRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIP 63
            ++   L +  K +RG+   + P+ ++TWFR GG AE+MFQP D  DL  FL +LP D+P
Sbjct: 7   EKLLASLGDSVKDIRGRLTPDAPMDRVTWFRAGGLAELMFQPHDTDDLIDFLKILPDDVP 66

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           +T+VG+GSNILVRD GI GVVLRLS  GF ++E+     ++ GA C  K +A  A+ +GI
Sbjct: 67  LTVVGVGSNILVRDGGIPGVVLRLSAKGFGSVELAGENRILAGAICPDKHVAAMAMDNGI 126

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
           GGFHF+YGIPG IGGAA MNAGAN  ET + V+EVH +DRKG +HV+  +Q+ Y YR S 
Sbjct: 127 GGFHFYYGIPGGIGGAARMNAGANGAETCERVIEVHAVDRKGVKHVLTNDQMGYTYRHSA 186

Query: 184 ITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
              DLI THV+  G+PE +  I A +  V  HRETVQPI+EKTGGSTFKNP G SAW+LI
Sbjct: 187 AADDLIFTHVLFEGYPEDRTKIRAEMDAVRAHRETVQPIREKTGGSTFKNPDGLSAWKLI 246

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           +++GCRGL  GGA++S LHCNFMIN + ATGYDLEYLGEQVR++VF +SG+ LEWEIKRL
Sbjct: 247 DEAGCRGLVIGGAQMSSLHCNFMINMEQATGYDLEYLGEQVRREVFEKSGVKLEWEIKRL 306

Query: 304 GDFFDHQIV 312
           G F   + V
Sbjct: 307 GGFMPGREV 315


>gi|134298545|ref|YP_001112041.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Desulfotomaculum
           reducens MI-1]
 gi|172044255|sp|A4J2B3|MURB_DESRM RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|134051245|gb|ABO49216.1| UDP-N-acetylmuramate dehydrogenase [Desulfotomaculum reducens MI-1]
          Length = 303

 Score =  223 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 100/307 (32%), Positives = 162/307 (52%), Gaps = 7/307 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           MIY  ++  L+     ++G  Q N P+++ T ++ GG A++   P D  D++  +     
Sbjct: 1   MIYTSLAGELQSL---VKGSIQINEPMRKHTTWKIGGKADLFLNPSDKEDIRQAVEFARE 57

Query: 61  D-IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
             IPIT++G GSN+LV+D GIRG+V+++               +  GA      LA  A 
Sbjct: 58  KAIPITVIGNGSNLLVKDGGIRGLVIKVGRGMAKI--TIEGTSIKAGAGALLPELAVFAC 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
           ++ +GGF F  GIPGS+GGA  MNAGA N   S  +  +  ++ +    V+ ++ L + Y
Sbjct: 116 KNSLGGFGFAAGIPGSLGGAIVMNAGAMNGCVSDVLQSIVVLNERNQFEVLTKDHLNFAY 175

Query: 180 RSSEIT-KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R+S +  + LI      +G+ + Q +I          R+  QP      GS FKNP G  
Sbjct: 176 RTSNLQSRGLICVETCWQGYAKDQWLIEQETKEYLAKRKAAQPQGFPNAGSVFKNPEGDF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LIE  G +GL  G A++S  H N+++N   AT  D+  L + +++ V  + G+LL+ 
Sbjct: 236 AGRLIEGCGGKGLRVGDAEVSSKHANWILNLGRATAQDVLILIDHLKQMVQERFGVLLQL 295

Query: 299 EIKRLGD 305
           E+K LG+
Sbjct: 296 EVKVLGE 302


>gi|91205777|ref|YP_538132.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia bellii
           RML369-C]
 gi|122425435|sp|Q1RHX1|MURB_RICBR RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|91069321|gb|ABE05043.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia bellii
           RML369-C]
          Length = 302

 Score =  223 bits (567), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 135/292 (46%), Positives = 179/292 (61%), Gaps = 1/292 (0%)

Query: 14  GKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNI 73
              ++G++++++ LK +TWF+ GGNAE+ F+P D  DL  FL      +PIT  G GSNI
Sbjct: 3   LPIVKGEYRKDYNLKHLTWFKVGGNAEIFFKPVDSEDLASFLVQNKQKLPITTFGAGSNI 62

Query: 74  LVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           ++RD GI GV ++L    FSNI+  +   +IVG+ C   SLA     + I GF F  GIP
Sbjct: 63  IIRDGGIEGVTIKL-GQNFSNIDFTDDGHLIVGSSCLNFSLAKFCQVNAISGFEFLVGIP 121

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHV 193
           G+IGG   MNAGA  CE    +V +  ID  GN      E++ ++YR + + KDLII   
Sbjct: 122 GTIGGGVAMNAGAYGCEFKDILVRIEAIDFAGNFRTFTNEEIGFKYRGNNLPKDLIILKA 181

Query: 194 VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEF 253
           V +    +   I A +  +   R + QPIKE+TGGSTF NP G  +WQLI+K+G RG   
Sbjct: 182 VFKVNKGNSEDILARMNEINAARSSTQPIKERTGGSTFANPEGFKSWQLIDKAGLRGYRI 241

Query: 254 GGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           G A ISELHCNFMIN  NAT  +LE LG  V++KVF  SGI L WEIKR+G 
Sbjct: 242 GDASISELHCNFMINNGNATAKELEDLGNFVQQKVFEDSGIKLNWEIKRIGK 293


>gi|116253046|ref|YP_768884.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|187609739|sp|Q1ME35|MURB_RHIL3 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|115257694|emb|CAK08792.1| putative UDP-N-acetylenolpyruvoylglucosamine reductase [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 324

 Score =  223 bits (567), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 176/309 (56%), Positives = 226/309 (73%)

Query: 4   GRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIP 63
            ++   L +  K +RG+   + P+ ++TWFR GG AE+MFQP DI DL  FL +LP ++P
Sbjct: 7   EKLLASLGDGVKDIRGRITPDAPMDRVTWFRAGGLAELMFQPHDIDDLVAFLKILPEEVP 66

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           +T+VG+GSNILVRD GI GVVLRLS  GF  +E+     ++ GA C  K +A  A+ +GI
Sbjct: 67  LTVVGVGSNILVRDGGIPGVVLRLSAKGFGFVELAGENRILAGAICPDKHVAAMAMDNGI 126

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
           GGFHFFYGIPG IGGAA MNAGAN  ET + ++EVH +DRKG++HV+   ++ Y YR S 
Sbjct: 127 GGFHFFYGIPGGIGGAARMNAGANGVETRERLIEVHAVDRKGDKHVLSNAEMGYSYRHST 186

Query: 184 ITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            + DLI T V+  G+PE +  I A +  V +HRETVQP++EKTGGSTFKNP GHSAW+LI
Sbjct: 187 ASTDLIFTSVLFEGYPEERAQIRAEMDAVRNHRETVQPVREKTGGSTFKNPAGHSAWKLI 246

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           +++GCRGL  GGA++S LHCNFMIN   ATGYDLEYLGEQVR++VF + GI LEWEIKRL
Sbjct: 247 DEAGCRGLVIGGAQMSSLHCNFMINMGQATGYDLEYLGEQVRREVFEKDGIKLEWEIKRL 306

Query: 304 GDFFDHQIV 312
           G F   + V
Sbjct: 307 GVFMPGREV 315


>gi|302389415|ref|YP_003825236.1| UDP-N-acetylmuramate dehydrogenase [Thermosediminibacter oceani DSM
           16646]
 gi|302200043|gb|ADL07613.1| UDP-N-acetylmuramate dehydrogenase [Thermosediminibacter oceani DSM
           16646]
          Length = 304

 Score =  222 bits (566), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 107/304 (35%), Positives = 160/304 (52%), Gaps = 5/304 (1%)

Query: 5   RISRLLRERGKQL-RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDI 62
            I    ++  K +   + + N  +K  T FR GG A++M  PQ   ++K  L L    DI
Sbjct: 2   DIQAFYKDICKVIPSNRVKMNELMKHHTSFRIGGPADIMVLPQSSEEIKKALMLCRQKDI 61

Query: 63  PITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHG 122
           P+ I+G G+N+LVRD GIRGVV++++              +   A      +A  AL + 
Sbjct: 62  PVFIMGNGTNLLVRDKGIRGVVIKIAQNFNDVEV--KGNTIRSKAGVFLSVVARIALENH 119

Query: 123 IGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS 182
           + G  F  GIPG++GGA  MNAGA   E +  + EV  +D  G    + +E+L++ YR  
Sbjct: 120 LSGLEFAAGIPGTVGGAIIMNAGAYGGEMADVIKEVVVMDFNGEIFSMKKEELEFGYRWC 179

Query: 183 EITKD-LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
            + K   I+    L   P +   I   +  +   R   QP+   + GS FK PTG+ A  
Sbjct: 180 NLQKGGKIVLEAELELKPGNYEDIKLKMEELSAKRRMKQPLNMPSAGSAFKRPTGNYAGA 239

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           LIEK+G +G + GGA IS+LH  F++N  NAT  D+  L   +++KV  + GILLE EIK
Sbjct: 240 LIEKAGLKGFKVGGAMISDLHAGFIVNTGNATAEDVLKLIGIIQRKVKEEFGILLEPEIK 299

Query: 302 RLGD 305
            +G+
Sbjct: 300 VVGE 303


>gi|86609025|ref|YP_477787.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86557567|gb|ABD02524.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 328

 Score =  222 bits (566), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 93/295 (31%), Positives = 144/295 (48%), Gaps = 5/295 (1%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILV 75
           L G+ Q   PL  +T FR GG AE   +P+   +L+  L       IP T++G GSN+L+
Sbjct: 36  LSGRIQSGIPLAPLTTFRVGGKAEWYCEPRSHLELQQCLAWARAEGIPTTLLGAGSNLLI 95

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
            DAG++   L +       I++     +   A     +L+ +A R G  G  +  GIPG+
Sbjct: 96  SDAGLK--GLVIGTRRLRGIQLLEGGRIWAAAGEPLVNLSRAAARQGWSGLEWAIGIPGT 153

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITH--V 193
           +GGA  MNAGA+    +  +VEV  +D +     +    L++ YR S +           
Sbjct: 154 LGGAVVMNAGAHGRAMADVLVEVQILDEEQEPCRLEPADLQFGYRRSRLQDSPWTVTGAT 213

Query: 194 VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEF 253
           +        + +        + R + QP    + GS F+NP  H A  LIE+ G +G   
Sbjct: 214 LQLIPSRDPSQVQWETQRYLNQRLSSQPYHLPSCGSVFRNPESHPAGWLIEQVGLKGYRI 273

Query: 254 GGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFD 308
           GGA+ISE H NF++N   A+  D+  L    ++KV+ Q  +LLE E++ LG F D
Sbjct: 274 GGAQISERHANFILNCHQASAKDIYRLIRLAQEKVYQQWSVLLEPEVRILGSFED 328


>gi|187776685|ref|ZP_02993158.1| hypothetical protein CLOSPO_00200 [Clostridium sporogenes ATCC
           15579]
 gi|187775344|gb|EDU39146.1| hypothetical protein CLOSPO_00200 [Clostridium sporogenes ATCC
           15579]
          Length = 298

 Score =  222 bits (566), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 103/290 (35%), Positives = 152/290 (52%), Gaps = 5/290 (1%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVR 76
                 + P+K  T F+ GG A+++  P  +  +K  + L  +  IP  I+G GSN+LVR
Sbjct: 9   NNNVLIDEPMKNHTSFKVGGPADLLITPTTLEQVKDSIVLCKNSSIPYYIIGNGSNLLVR 68

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+RGVV++ S  G   +       ++  +     ++ N AL+  +GG  F  GIPGS+
Sbjct: 69  DGGLRGVVIKFSKLGNIKV---EGDRVMAQSGAPLTNICNEALKSNLGGLEFACGIPGSV 125

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGA N E SQ +     ID+ GN  ++ +EQL   YR S I K   I   V  
Sbjct: 126 GGAVTMNAGAYNGEISQVIESAKVIDKDGNVFLLNKEQLDLGYRMSAIQKYHYIVLEVTF 185

Query: 197 GFPESQNIISAAIANVCHHRET-VQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
               S+           + R T  QP++  + GSTFK P GH A +LIE +G +G   GG
Sbjct: 186 RLHNSEYDTIKNRIMDLNRRRTEKQPLEYPSAGSTFKRPEGHFAAKLIEDTGLKGKSIGG 245

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           A++S+ H  F+IN   AT  D+  L E V+ KV  +  + L  E++ +G+
Sbjct: 246 AQVSQKHSGFIINKGGATAGDILNLIEFVQNKVKEKFEVDLHTEVRIIGE 295


>gi|304436489|ref|ZP_07396463.1| UDP-N-acetylmuramate dehydrogenase [Selenomonas sp. oral taxon 149
           str. 67H29BP]
 gi|304370535|gb|EFM24186.1| UDP-N-acetylmuramate dehydrogenase [Selenomonas sp. oral taxon 149
           str. 67H29BP]
          Length = 303

 Score =  222 bits (566), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 100/307 (32%), Positives = 163/307 (53%), Gaps = 7/307 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    I    +E     R +  EN P++  T FR GG A+++F P +  +++  +     
Sbjct: 1   MNEAFIHSCYQEFE---RTRLFENAPMRFHTTFRIGGPADLLFYPHNTEEVRAIIQKAKH 57

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            DIP+T++G GSN+L+RD GIRG+V+R S    +    +    +IV +    K +A+ A 
Sbjct: 58  YDIPVTVLGNGSNLLIRDGGIRGLVIRFSRQMSAI--TQEGTTLIVCSGALLKDIASFAQ 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
           + G+ G  F  GIPGSIGGA +MNAGA + E    V+ V  I   G       ++L + Y
Sbjct: 116 KKGLSGLEFACGIPGSIGGAIFMNAGAYDGEVKSVVMAVKTISPDGEVRRYSADELDFGY 175

Query: 180 RSSEITKDLIITHV-VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S    +        L    +  + I   ++++   RE+ QP+   + GSTFK P G+ 
Sbjct: 176 RHSVFHTNNEAICEAHLCLRTDDPSSILERMSDLNQRRESKQPLSYPSAGSTFKRPPGYF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A  LI+++G +GL +GGA++S  H  F+IN   AT  D++ L   V+ +V+ +  + L  
Sbjct: 236 AGTLIDQTGLKGLTYGGAQVSHKHAGFIINIGGATARDVQQLIHSVQNRVYAKHHVRLFP 295

Query: 299 EIKRLGD 305
           E++ +G+
Sbjct: 296 ELRIIGE 302


>gi|260462092|ref|ZP_05810336.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Mesorhizobium
           opportunistum WSM2075]
 gi|259031952|gb|EEW33219.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Mesorhizobium
           opportunistum WSM2075]
          Length = 321

 Score =  222 bits (566), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 169/313 (53%), Positives = 210/313 (67%), Gaps = 1/313 (0%)

Query: 1   MIYGR-ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP 59
           M++G+ +   L +R   LRG+   N  + +ITWFR GG AE +FQP D  DL  FL  +P
Sbjct: 1   MMHGQALIDRLGDRLAGLRGRITPNAEMDKITWFRAGGLAEALFQPADEEDLAAFLKAVP 60

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            ++P+TIVG+GSN+LVRD GI G V+RLS  GF   EV +   +  GA    K +A  AL
Sbjct: 61  EEVPMTIVGVGSNLLVRDGGIPGFVIRLSAKGFGEAEVISPIRIKAGAATPDKRVAAVAL 120

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
             GIGGFHF++GIPG+IGGA  MNAGAN  ET + VVEV  +DRKGN   +   ++ Y Y
Sbjct: 121 EAGIGGFHFYHGIPGAIGGALRMNAGANGVETRERVVEVRALDRKGNLLTLSNAEMGYAY 180

Query: 180 RSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
           R S     LI T  V  GF E + +I AA+  V +HRETVQPI+EKTGGSTFKNP G SA
Sbjct: 181 RHSGAPSGLIFTSAVFEGFAEEKAVIKAAMDAVQNHRETVQPIREKTGGSTFKNPEGTSA 240

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
           W+ I+K+GCRGL  GGA++S +HCNFMIN   ATGYDLEYLGE VR +V   SGI L WE
Sbjct: 241 WKEIDKAGCRGLMIGGAQMSPMHCNFMINTGTATGYDLEYLGETVRARVLEHSGIRLHWE 300

Query: 300 IKRLGDFFDHQIV 312
           IKR+G+F     V
Sbjct: 301 IKRIGNFRSGHAV 313


>gi|218961822|ref|YP_001741597.1| UDP-N-acetylenolpyruvoylglucosamine reductase (UDP-N-acetylmuramate
           dehydrogenase) [Candidatus Cloacamonas acidaminovorans]
 gi|167730479|emb|CAO81391.1| UDP-N-acetylenolpyruvoylglucosamine reductase (UDP-N-acetylmuramate
           dehydrogenase) [Candidatus Cloacamonas acidaminovorans]
          Length = 313

 Score =  222 bits (566), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 93/308 (30%), Positives = 138/308 (44%), Gaps = 14/308 (4%)

Query: 9   LLRERGKQL--RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPIT 65
           LLR+   QL   G      PLK+   F  GG AEV   P     L   L      +IP  
Sbjct: 8   LLRKEYPQLIDEGIVHIEVPLKEHCSFNIGGPAEVFCTPYTQKQLVTLLKFCLGHNIPYF 67

Query: 66  IVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGG 125
           I+G GSN+L+ D G++G+V+         +       +      + K L N A  +G+ G
Sbjct: 68  ILGKGSNLLISDKGVKGIVISTERFDKITL---GKHYLSAFCGVTLKDLGNFACENGLSG 124

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQ-------HVIPREQLKYQ 178
             F  GIPGS+GGA +MNAGA   E    +     I     +         +   +  + 
Sbjct: 125 LEFASGIPGSVGGAVFMNAGAYGNEIKDVLYSSRAILPTQEKLSSPNPVFYLKASEHNFS 184

Query: 179 YRSSEITK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGH 237
           YR S      LI    +     +    I   +  +   R+  QP+   + GS FK P G 
Sbjct: 185 YRHSVFQDLGLIHLSSLFILKKDKPENIRQRMQELQQKRQDKQPMDLPSAGSVFKRPEGF 244

Query: 238 SAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLE 297
              +LIE+ G +G   G A ISE HC F++N  +AT  D+  L + ++K V+ + G+ L+
Sbjct: 245 FTGKLIEECGLKGFRIGDAAISEKHCGFIVNLGSATAKDVFQLIQHIQKVVYERYGVHLQ 304

Query: 298 WEIKRLGD 305
            EI+ LG+
Sbjct: 305 TEIRILGE 312


>gi|222528350|ref|YP_002572232.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Caldicellulosiruptor
           bescii DSM 6725]
 gi|254764131|sp|B9MN03|MURB_ANATD RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|222455197|gb|ACM59459.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Caldicellulosiruptor
           bescii DSM 6725]
          Length = 314

 Score =  222 bits (566), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 87/291 (29%), Positives = 133/291 (45%), Gaps = 7/291 (2%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDA 78
           +F ++ PLK+ T F+ GG A  +  P+    L   LTL   + I   +VG  SN+LV D 
Sbjct: 13  EFLKDHPLKEFTTFKIGGKARYIVFPKSTKQLIEILTLAKDEAINYIVVGNCSNVLVSDK 72

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           G       +      +    +   +          +A  A   G+ G  F  GIPG++GG
Sbjct: 73  GY---NGAIITTVKIDSFKIDGNLIEAECGAMLSHVARKACEAGLKGLEFAVGIPGTVGG 129

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIIT---HVVL 195
           A YMNAGA + E          +D   N   + R  +++ YR+S + ++ ++       L
Sbjct: 130 AVYMNAGAYDGEIKDVFERAEVLDENLNPVELGRADMRFSYRNSRLKEEKMVLLRAVFCL 189

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           +                   R   QP+   + GS FK P  + A +LIE +G +G   GG
Sbjct: 190 KFADREDISPLQKANEFSKRRREKQPLSYPSAGSVFKRPPNNFAGKLIEDAGLKGYRIGG 249

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           A ISE H  F+IN  +A   D+  L    +K V+ + GILLE EI+ +G+F
Sbjct: 250 ACISEKHAGFIINLGDAKAEDVRKLIYLAQKSVYEKFGILLEPEIQFIGEF 300


>gi|312897973|ref|ZP_07757382.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Megasphaera
           micronuciformis F0359]
 gi|310620898|gb|EFQ04449.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Megasphaera
           micronuciformis F0359]
          Length = 307

 Score =  222 bits (565), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 86/307 (28%), Positives = 152/307 (49%), Gaps = 5/307 (1%)

Query: 1   MIYGRISRLLRERGKQL-RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP 59
           M    + +     G ++ + +   + P++  T F  GG A+V+  P  + ++   +    
Sbjct: 1   MTSKAVEKFTECLGAEIPKDRIYRDEPMRDHTTFAVGGPADVLVLPHSVKEMSLAIRAAR 60

Query: 60  S-DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSA 118
           S ++P+T++G GSN+LV D GIR   + +           +   +   +      +   A
Sbjct: 61  SLELPVTVLGGGSNVLVLDGGIR--GVVIQLNEMKRTLSCHGNRIHAASGYMLADVCEFA 118

Query: 119 LRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQ 178
             +G+ G  F  GIPG++GGA +MNAGA   E SQ V  V  ++  G      + +  + 
Sbjct: 119 YENGLTGAEFACGIPGTLGGAVFMNAGAYGGEMSQIVSRVRTVNGHGGVTTYEKGEFGFS 178

Query: 179 YRSSEITK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGH 237
           YR S   K    +  V L      +  I A + ++   R + QP++  + GSTFK P G+
Sbjct: 179 YRKSIFQKLQEYVVDVELSLQYGDKTEIRATMDDLTERRTSKQPLEMHSAGSTFKRPPGY 238

Query: 238 SAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLE 297
            A  LI+++G +GL  G A++SE H  F++N  +AT  D+  +  +V+++V    G+ LE
Sbjct: 239 FAGTLIDQTGLKGLSHGDAEVSEKHAGFVVNRGHATAADVLAVIREVQRRVEEAHGVTLE 298

Query: 298 WEIKRLG 304
            E++ +G
Sbjct: 299 TEVRIMG 305


>gi|300853520|ref|YP_003778504.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           ljungdahlii DSM 13528]
 gi|300433635|gb|ADK13402.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           ljungdahlii DSM 13528]
          Length = 304

 Score =  222 bits (565), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 103/305 (33%), Positives = 163/305 (53%), Gaps = 7/305 (2%)

Query: 3   YGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-D 61
           +   +  L +   +     + + P+K+ T FR GG  +++  P+   ++   +TL    +
Sbjct: 4   FKDFATNLEKILDK--EDIKIDEPMKEHTSFRVGGPVDILVTPKKFQEVVDVITLCKEHN 61

Query: 62  IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRH 121
           IP  I+G GSN+LV+D GIRG++++L       +E     ++I  +  S K ++ +AL +
Sbjct: 62  IPYYIMGNGSNLLVKDGGIRGIMIKLIKLNEVKVED---NKIITESGVSLKDISTTALNN 118

Query: 122 GIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS 181
            + GF F  GIPGS+GGA  MNAGA N E S  V     ID +G   V+ R+QL+ +YRS
Sbjct: 119 KLSGFEFACGIPGSVGGAVTMNAGAYNGEISHVVESAKVIDNEGKIKVLDRKQLELEYRS 178

Query: 182 SEITK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
           S I K    +  V           I   + ++   R   QP++  + GSTFK P G+ A 
Sbjct: 179 SSILKYKYTVLEVTFNLEHGDYEKIKNRVEDLNRRRNEKQPLEYPSAGSTFKRPEGYFAA 238

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LIE SG +G   GGA++SE H  F+IN  +AT  D+  L   V+ KV  +  + L  E+
Sbjct: 239 KLIEDSGLKGKSVGGAQVSEKHSGFIINKGSATAKDILDLIAIVQHKVKEKFNVDLYTEV 298

Query: 301 KRLGD 305
           + +G+
Sbjct: 299 RVIGE 303


>gi|225028032|ref|ZP_03717224.1| hypothetical protein EUBHAL_02301 [Eubacterium hallii DSM 3353]
 gi|224954632|gb|EEG35841.1| hypothetical protein EUBHAL_02301 [Eubacterium hallii DSM 3353]
          Length = 375

 Score =  221 bits (564), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 92/310 (29%), Positives = 157/310 (50%), Gaps = 6/310 (1%)

Query: 7   SRLLRERGKQLR-GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
              L+   +Q++ G   E  P+ + T F  GG A+V  QP    +++  +       IP 
Sbjct: 69  KEFLQNLREQIKAGTVTEQEPMNKHTSFAIGGPADVFVQPATREEIRSAVYCAKEAGIPF 128

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G GSN+LV D G RG+++++     +         + V A       A +A   G+ 
Sbjct: 129 FVMGNGSNLLVSDEGFRGMIIQIGKNFQAI--SVKDTVIEVQAGALLSRTARAAWNAGLT 186

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS-E 183
           GF F  GIPGS+GGA  MNAGA   E    +++   + ++G    +  E+L   YR S  
Sbjct: 187 GFEFAAGIPGSVGGAVAMNAGAYGGEVKDVLLDAEVLTQEGEFLTLTGEELDLSYRHSCI 246

Query: 184 ITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
             K+ ++            + I A +  +   R   QP++  + GSTFK P G+ A +LI
Sbjct: 247 FEKNYVVLSARFSFEKGESDKIKARMDELAKARREKQPLEFPSAGSTFKRPEGYFAGKLI 306

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           + +G +G   GGA++SE H  F++N   AT  ++ +L +QV+KKV  Q  ++++ E++ +
Sbjct: 307 QDAGLKGYTVGGAQVSEKHSGFVVNRGGATAEEVAFLIKQVQKKVMKQFNVMMQPEVRFV 366

Query: 304 GDFFDHQIVD 313
           G F D ++ +
Sbjct: 367 G-FADTEVRE 375


>gi|291536777|emb|CBL09889.1| UDP-N-acetylmuramate dehydrogenase [Roseburia intestinalis M50/1]
          Length = 302

 Score =  221 bits (564), Expect = 9e-56,   Method: Composition-based stats.
 Identities = 103/291 (35%), Positives = 155/291 (53%), Gaps = 5/291 (1%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVR 76
             +   + P+K+ T FR GG A+++ QP+   +L   + L    D+P  ++G GSN+LV 
Sbjct: 15  ENRIFTDEPMKKHTTFRVGGPADILVQPKGT-ELAAVIRLCRKYDVPYQVIGNGSNLLVG 73

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GIR   L +      +        + VGA       AN A  HG+ G  F  GIPGSI
Sbjct: 74  DRGIR--GLVIEMLSKEDEICVEDDCITVGAGMLLSKTANRAAEHGLIGMEFAAGIPGSI 131

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS-EITKDLIITHVVL 195
           GGA  MNAGA   E    +  V  +D++GN+ ++  E+L+  YR+S  + K  I+T   +
Sbjct: 132 GGAVVMNAGAYGGEMKDILTAVTVLDQEGNEKILSAEELELGYRTSCILKKGYIVTGAKI 191

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           +     +  ISA +  +   R   QP++  + GSTFK P G+ A +LI  +G RG + G 
Sbjct: 192 KLKHGEETAISARMEELKKQRVEKQPLEYPSAGSTFKRPEGYFAGKLIMDAGLRGYQVGD 251

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           A++SE HC F+IN  NAT  D+  L + V   V  +  + LE E+K +G+F
Sbjct: 252 AQVSEKHCGFVINRGNATAADVRTLMQNVSDIVEEKFDVRLEPEVKMIGEF 302


>gi|221195827|ref|ZP_03568880.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Atopobium rimae ATCC
           49626]
 gi|221184301|gb|EEE16695.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Atopobium rimae ATCC
           49626]
          Length = 308

 Score =  221 bits (564), Expect = 9e-56,   Method: Composition-based stats.
 Identities = 92/304 (30%), Positives = 144/304 (47%), Gaps = 9/304 (2%)

Query: 9   LLRERGKQLRG-----KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDI 62
            L     +LR        + + P+ + T F+ GG A++   P D  ++   L     +  
Sbjct: 7   DLESLAWRLRSIVGEENVRVDEPMSEHTTFKVGGPADIYVIPDDADEVHDVLEECKSAAA 66

Query: 63  PITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHG 122
           P  I+G GS++LV DAG RGV++ +++            E+   A    +  +  A    
Sbjct: 67  PYFILGYGSDLLVSDAGYRGVIVAIADGMSGVTVED--NEITCQAGVGLREASEMACELD 124

Query: 123 IGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS 182
           + G  F  GIPGSIGGA YMNAGA +   +  +  V  +   G Q  I    L   YR S
Sbjct: 125 LTGLEFACGIPGSIGGACYMNAGAYDGCIADVLKSVRVLLADGTQTTIDAADLDLGYRHS 184

Query: 183 EI-TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
            I  +++++              I   +      RE  QP++  + GSTFK P G+   +
Sbjct: 185 RIADENMVVLSATFALRRADGEKIREKMDEYTRRREEKQPLELPSAGSTFKRPEGYFVGK 244

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           L+  +G RG  FGGA +S+ H  F++N D+AT  D+  + E V+ +V  Q G+ L  E++
Sbjct: 245 LVTDAGLRGYRFGGAGVSDKHAGFVVNYDHATAADVHAVIEHVQAEVKRQFGVDLHPEVR 304

Query: 302 RLGD 305
            LGD
Sbjct: 305 FLGD 308


>gi|187609689|sp|A8MLW8|MURB_ALKOO RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
          Length = 304

 Score =  221 bits (563), Expect = 9e-56,   Method: Composition-based stats.
 Identities = 93/305 (30%), Positives = 152/305 (49%), Gaps = 10/305 (3%)

Query: 3   YGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD- 61
           Y  +++++ +           + P+K  T F+ GG A++M  P+ I  LK  + L   + 
Sbjct: 7   YKALTKVIPQDL------VLLDEPMKNHTSFKIGGPADIMVIPETIDQLKSAIKLSKENQ 60

Query: 62  IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRH 121
           +P  I+G GSN++VRD G+R +V++++              +I  A      L+   +  
Sbjct: 61  MPYFIIGNGSNLIVRDKGMRCIVIKIAEQFSKV--SFQGNTVIAEAGILLSKLSKKIMAE 118

Query: 122 GIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS 181
            + GF F  GIPG++GGA  MNAGA   E    V   H ++  G       E+L+  YR+
Sbjct: 119 SLKGFEFASGIPGTLGGAITMNAGAYGGEMKDVVKGAHLLNDNGEVRYFTLEELELGYRT 178

Query: 182 SEITK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
           S I K   I   V L         I     ++   R T QP+   + GS FK P G+ A 
Sbjct: 179 SIIQKQGYIALDVELALEKGDYQEILEITRDLTERRTTKQPLHLPSAGSVFKRPEGYFAG 238

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LI+ SG +G   GGA++SELH  F++N  +AT  D+  L + ++ +V+    + LE E+
Sbjct: 239 KLIQDSGLKGQRVGGAQVSELHSGFIVNVGDATAKDVLDLIQLIKDRVYETFHVQLETEV 298

Query: 301 KRLGD 305
           + +G+
Sbjct: 299 RIVGE 303


>gi|158319624|ref|YP_001512131.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Alkaliphilus
           oremlandii OhILAs]
 gi|158139823|gb|ABW18135.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Alkaliphilus
           oremlandii OhILAs]
          Length = 322

 Score =  221 bits (563), Expect = 9e-56,   Method: Composition-based stats.
 Identities = 93/305 (30%), Positives = 152/305 (49%), Gaps = 10/305 (3%)

Query: 3   YGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD- 61
           Y  +++++ +           + P+K  T F+ GG A++M  P+ I  LK  + L   + 
Sbjct: 25  YKALTKVIPQDL------VLLDEPMKNHTSFKIGGPADIMVIPETIDQLKSAIKLSKENQ 78

Query: 62  IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRH 121
           +P  I+G GSN++VRD G+R +V++++              +I  A      L+   +  
Sbjct: 79  MPYFIIGNGSNLIVRDKGMRCIVIKIAEQFSKV--SFQGNTVIAEAGILLSKLSKKIMAE 136

Query: 122 GIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS 181
            + GF F  GIPG++GGA  MNAGA   E    V   H ++  G       E+L+  YR+
Sbjct: 137 SLKGFEFASGIPGTLGGAITMNAGAYGGEMKDVVKGAHLLNDNGEVRYFTLEELELGYRT 196

Query: 182 SEITK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
           S I K   I   V L         I     ++   R T QP+   + GS FK P G+ A 
Sbjct: 197 SIIQKQGYIALDVELALEKGDYQEILEITRDLTERRTTKQPLHLPSAGSVFKRPEGYFAG 256

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LI+ SG +G   GGA++SELH  F++N  +AT  D+  L + ++ +V+    + LE E+
Sbjct: 257 KLIQDSGLKGQRVGGAQVSELHSGFIVNVGDATAKDVLDLIQLIKDRVYETFHVQLETEV 316

Query: 301 KRLGD 305
           + +G+
Sbjct: 317 RIVGE 321


>gi|329849872|ref|ZP_08264718.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Asticcacaulis
           biprosthecum C19]
 gi|328841783|gb|EGF91353.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Asticcacaulis
           biprosthecum C19]
          Length = 299

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 127/295 (43%), Positives = 167/295 (56%), Gaps = 1/295 (0%)

Query: 11  RERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLG 70
           R+    +RGK   +  L   TWFR GG AEV+F P D  DL  FL  L   +P+  +G+G
Sbjct: 4   RDNLPTVRGKIARDTALAPFTWFRVGGPAEVLFIPADPQDLSDFLRALDPAVPVIYLGVG 63

Query: 71  SNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFY 130
           SN+++RD G+ GVV+RL+   F+ I V+               +A +A + G+ G  F+ 
Sbjct: 64  SNVIIRDGGVDGVVVRLAGKAFAEISVQGELITAGPGAL-DSMVARTAAKAGLAGLEFYA 122

Query: 131 GIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLII 190
           GIPG+IGGA  MNAG    ET   +V   G DR G +         + YR ++I  D++ 
Sbjct: 123 GIPGTIGGALTMNAGCYGRETKDVLVSAWGYDRTGARREFQNADFGFTYRHTQIPGDIVW 182

Query: 191 THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRG 250
                RG P+    + A I  +   RE  QPI+EKTGGSTFKNP G SAWQ ++++G RG
Sbjct: 183 MQATFRGTPDDPVAVQARIDEITSRRERTQPIREKTGGSTFKNPQGRSAWQCVDEAGWRG 242

Query: 251 LEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
              GGAK SELH NFMIN   AT  DLE LGE VR  V  + G+ L WEIKR+G 
Sbjct: 243 KLHGGAKFSELHANFMINTGEATAADLEGLGEAVRADVLTKLGVELNWEIKRIGK 297


>gi|153939546|ref|YP_001392734.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           botulinum F str. Langeland]
 gi|168178940|ref|ZP_02613604.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           botulinum NCTC 2916]
 gi|170759800|ref|YP_001788707.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           botulinum A3 str. Loch Maree]
 gi|226950828|ref|YP_002805919.1| UDP-N-acetylmuramate dehydrogenase [Clostridium botulinum A2 str.
           Kyoto]
 gi|166222836|sp|A7GIX4|MURB_CLOBL RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|254764149|sp|C1FMJ6|MURB_CLOBJ RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|254764167|sp|B1L271|MURB_CLOBM RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|152935442|gb|ABS40940.1| UDP-N-acetylmuramate dehydrogenase [Clostridium botulinum F str.
           Langeland]
 gi|169406789|gb|ACA55200.1| UDP-N-acetylmuramate dehydrogenase [Clostridium botulinum A3 str.
           Loch Maree]
 gi|182670013|gb|EDT81989.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           botulinum NCTC 2916]
 gi|226840987|gb|ACO83653.1| UDP-N-acetylmuramate dehydrogenase [Clostridium botulinum A2 str.
           Kyoto]
 gi|295320715|gb|ADG01093.1| UDP-N-acetylmuramate dehydrogenase [Clostridium botulinum F str.
           230613]
 gi|322807701|emb|CBZ05276.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           botulinum H04402 065]
          Length = 306

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 105/290 (36%), Positives = 153/290 (52%), Gaps = 5/290 (1%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVR 76
                 + P+K+ T F+ GG A+++  P  +  +K  + L  ++ IP  I+G GSN+LVR
Sbjct: 17  NNNVLIDEPMKKHTSFKVGGPADLLITPTTLEQVKDSIILCRNNSIPYYIIGNGSNLLVR 76

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GIRGVV++    G   +       +I  +     ++ N AL+  +GG  F  GIPGS+
Sbjct: 77  DGGIRGVVIKFLKLGDIKV---EGDRVIAQSGAPLTNICNEALKSNLGGLEFACGIPGSV 133

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGA N E SQ +     ID+ GN  ++ +EQL   YR S I K   I   V  
Sbjct: 134 GGAVTMNAGAYNGEISQVIESAKVIDKDGNVFLLNKEQLDLGYRMSAIQKYHYIVLEVTF 193

Query: 197 GFPESQNIISAAIANVCHHRET-VQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
               S+           + R T  QP++  + GSTFK P GH A +LIE +G +G   GG
Sbjct: 194 KLHNSEYDTIKNRIMDLNRRRTEKQPLEYPSAGSTFKRPEGHFAAKLIEDTGLKGESIGG 253

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           A++SE H  F+IN   AT  D+  L E V+ KV  +  + L  E++ +G+
Sbjct: 254 AQVSEKHSGFIINKGGATAGDILNLIEFVQNKVMEKFQVDLHTEVRIIGE 303


>gi|297539590|ref|YP_003675359.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylotenera sp.
           301]
 gi|297258937|gb|ADI30782.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylotenera sp.
           301]
          Length = 299

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 95/289 (32%), Positives = 148/289 (51%), Gaps = 3/289 (1%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDA 78
           GK   N P+ + T +R GG A+ ++ P D+ DL+ FL  + ++  I  VGLGSN+LVRD 
Sbjct: 11  GKLLLNEPMARYTSWRVGGKADQLYIPADLEDLQEFLRNVDANQAIYFVGLGSNLLVRDG 70

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           G+RG V+ + N             +   A  +   LA  + +    G  FF GIPG++GG
Sbjct: 71  GVRGTVIIMHNVLTGLKMD--GDLVYAEAGVTCGKLAKFSAKEAKQGAEFFAGIPGTLGG 128

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLRG 197
           A  MNAG    ET   V  V  I+R+G  +     +    YR  ++           L  
Sbjct: 129 ALAMNAGCYGTETWNVVNSVTTINRQGELNKRSAAEFIASYRHVDMPVAGEWFIAAWLTL 188

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
                +  +  I ++   R   QP+   + GSTF+NP G  A +L+E SG +G   GGA+
Sbjct: 189 RAGDAHESAKKIKDLLATRLASQPLNLPSAGSTFRNPQGDYAARLVEASGLKGYIIGGAQ 248

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           +SE H NF++N  +A   D+E L + +R+ V  + G+ L+ E+K +G++
Sbjct: 249 VSEKHANFIVNIGDANALDIELLIKHMRETVLEKQGVALQQEVKVIGEY 297


>gi|308233671|ref|ZP_07664408.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Atopobium vaginae
           DSM 15829]
 gi|328943618|ref|ZP_08241083.1| UDP-N-acetylmuramate dehydrogenase [Atopobium vaginae DSM 15829]
 gi|327491587|gb|EGF23361.1| UDP-N-acetylmuramate dehydrogenase [Atopobium vaginae DSM 15829]
          Length = 308

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 94/284 (33%), Positives = 144/284 (50%), Gaps = 4/284 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAGIRG 82
           N P+ + T F+ GG A++   P    D++  + +     +P  I+G GS++LV DAG RG
Sbjct: 27  NEPMSEHTTFKIGGPADIFVIPDTPEDVQSLVKICKDEQVPYFILGRGSDLLVGDAGYRG 86

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           V++ +++   +         M   A  S +  +  A   G+ GF F  GIPGSIGGA +M
Sbjct: 87  VIIAIADGLVNVSINECQ--MTCQAGVSLREASEMACELGLTGFEFACGIPGSIGGACFM 144

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL-IITHVVLRGFPES 201
           NAGA +   +  +  V  +   G   VIP E+L   YR S +  D  ++           
Sbjct: 145 NAGAYDGCIADILTSVRVLMPDGTLCVIPAEELNLGYRHSRVKDDGLVVVSATFTLREGD 204

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
            + I A + ++   RE  QP++  + GSTFK P GH    LI K+G RG + G A IS  
Sbjct: 205 PSEIRAKMDDLTAKREEKQPLEYPSAGSTFKRPVGHFVGPLITKAGLRGYQSGNAAISTK 264

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           H  F+IN   AT  D+  + E V+ ++  Q  + LE E++ LG+
Sbjct: 265 HAGFVINLGGATARDVHNVIEHVQAEIKRQFDVELEPEVRFLGE 308


>gi|164686683|ref|ZP_02210711.1| hypothetical protein CLOBAR_00278 [Clostridium bartlettii DSM
           16795]
 gi|164604073|gb|EDQ97538.1| hypothetical protein CLOBAR_00278 [Clostridium bartlettii DSM
           16795]
          Length = 304

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 103/307 (33%), Positives = 162/307 (52%), Gaps = 10/307 (3%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           ++Y  + +++ E         + + P+K+   FR GG A+++ +P+    L   L  +  
Sbjct: 5   LVYNDLLKIVNEE------DIKIDEPMKKHISFRVGGPADILVRPRTEEQLSQILKYIDE 58

Query: 61  D-IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
           + +P  I+G GSN+LV+D GIRG+V+   +   +         +   A      L  +AL
Sbjct: 59  NALPYLIIGNGSNLLVKDGGIRGIVIEFGDNFNNFEID--GNIIKAQAGALLAVLGKAAL 116

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
           R  + GF    GIPGS+GG   MNAGA   E    V  V  ++ KG       E++K++Y
Sbjct: 117 REELTGFECISGIPGSLGGGLAMNAGAYGGEIKSVVKSVRVMNPKGEIFEFSNEEMKFEY 176

Query: 180 RSSEITK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S +T  D I+   VL     + + I A +A++ + R T QP+   + GSTFK P G+ 
Sbjct: 177 RRSILTNSDYIVLSAVLELQKGNYDEIKAFMADLTNRRTTKQPLNLPSAGSTFKRPEGYF 236

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI+  G RGL   GA++SE HC F++N  +AT  D+  L   V+  V N+ G+ LE 
Sbjct: 237 AGKLIDDCGLRGLTLRGAQVSEKHCGFVVNIGDATAKDILDLMYIVKSTVLNKFGVTLEE 296

Query: 299 EIKRLGD 305
           E+K LG+
Sbjct: 297 EVKILGE 303


>gi|312623332|ref|YP_004024945.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312203799|gb|ADQ47126.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 314

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 87/291 (29%), Positives = 134/291 (46%), Gaps = 7/291 (2%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDA 78
           +F ++ PLK+ T F+ GG A+ +  P++   L   LT+     I   +VG  SNILV D 
Sbjct: 13  EFLKDHPLKEFTTFKIGGEAKYIVFPKNTKQLIEVLTVAKDKAINYIVVGNCSNILVSDK 72

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           G       +      +    +   +          +A  A   G+ G  F  GIPG++GG
Sbjct: 73  GF---DGAIITTVKIDFFKIDGNLIEAECGAMLSQVARKACEVGLKGLEFAVGIPGTVGG 129

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIIT---HVVL 195
           A YMNAGA + E  +       +D   N   + R  +++ YR S + ++ ++       L
Sbjct: 130 AVYMNAGAYDGEIKEVFEWAEVLDENLNPVELGRTDMRFSYRHSRLKEEKMVLLRAAFCL 189

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           +                   R   QP+   + GS FK P  + A +LIE +G +G   GG
Sbjct: 190 KFADREDISPLQKANEFSKRRREKQPLSYPSAGSVFKRPPNNFAGKLIEDAGLKGYRIGG 249

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           A ISE H  F+IN  +A   D+  L    +K V+ + GILLE EI+ +G+F
Sbjct: 250 ACISEKHAGFIINLGDAKAEDVRKLIYLAQKTVYEKFGILLEPEIQFIGEF 300


>gi|307294493|ref|ZP_07574335.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sphingobium
           chlorophenolicum L-1]
 gi|306878967|gb|EFN10185.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sphingobium
           chlorophenolicum L-1]
          Length = 311

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 123/296 (41%), Positives = 180/296 (60%), Gaps = 1/296 (0%)

Query: 13  RGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSN 72
               +RG  + + PL  + WF+ GG A+ +F+P+D  DL  FL  L   IP+  +GLGSN
Sbjct: 7   ILPSVRGSLKADAPLAPLVWFKAGGVAQWLFEPKDADDLSDFLGDLDPAIPVMALGLGSN 66

Query: 73  ILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGI 132
           ++VRD G+ GVV+RL     + +E  +   +  G   SG  ++++A   GI G  F   I
Sbjct: 67  LIVRDGGVPGVVVRLGKPF-AKVEQLDATSLRCGGGASGILVSSTARDAGIAGLEFLRSI 125

Query: 133 PGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITH 192
           PG++GG   MN GA   ET   +VE   + R G +  +P + L Y YR S++ +  ++  
Sbjct: 126 PGTVGGFVRMNGGAYGRETCDILVECEVVLRSGERVTLPLDALGYTYRHSKLPEGAVVVS 185

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
            V RG P     I A +  +   RE  QP++ KTGGSTFKNP GH AW L++++GCRGL+
Sbjct: 186 AVFRGIPGESTAIQAEMDRIAAAREESQPLRSKTGGSTFKNPAGHKAWALVDEAGCRGLQ 245

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFD 308
            GGA++SE H NF++N  +AT  D+E LGE+VR++V  +SG+ LEWEI+R+G F D
Sbjct: 246 LGGAQVSEKHTNFLLNLGDATSADIEALGEEVRRRVKAKSGVELEWEIQRVGSFAD 301


>gi|91776619|ref|YP_546375.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacillus
           flagellatus KT]
 gi|91710606|gb|ABE50534.1| UDP-N-acetylmuramate dehydrogenase [Methylobacillus flagellatus KT]
          Length = 294

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 100/289 (34%), Positives = 142/289 (49%), Gaps = 3/289 (1%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRD 77
            G+     PL + T +RTGG A+ ++ P  +  L+ FL+ LP   P+  +GLGSN+LVRD
Sbjct: 4   EGRLLHREPLARYTSWRTGGVADQLYIPASMEGLQQFLSGLPDAEPLHFIGLGSNLLVRD 63

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G+RG V+ +  A            +   A  +   LA  A R    G  F  GIPG++G
Sbjct: 64  GGVRGTVILMHGALTGLRVD--QGRIYAEAGVTCAKLARFAARQHQHGAEFMAGIPGTVG 121

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLR 196
           GA  MNAG +  ET + V  V  IDR G  H    +     YR  E+   D        R
Sbjct: 122 GALAMNAGCHGGETWEIVDRVLTIDRVGKLHERNHQAFATAYRHVEMPVADEWFVAAWFR 181

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
                     + I  +   R   QP+     GS F+NP G  A +LIE SG +G   GGA
Sbjct: 182 LADGDAEEAESKIKQLLAMRLATQPLNLPNAGSVFRNPPGDHAARLIEASGLKGYRIGGA 241

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           ++SE H NF++N  +AT  D+E L   V+  V  Q G+ L+ E++ +G+
Sbjct: 242 QVSEKHANFIVNQGDATARDIEQLILHVQAVVKQQQGVDLQPEVRVIGE 290


>gi|85373188|ref|YP_457250.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Erythrobacter
           litoralis HTCC2594]
 gi|122545202|sp|Q2NCY8|MURB_ERYLH RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|84786271|gb|ABC62453.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Erythrobacter
           litoralis HTCC2594]
          Length = 323

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 123/291 (42%), Positives = 178/291 (61%), Gaps = 1/291 (0%)

Query: 14  GKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNI 73
            + +RGK     PL ++ WF++GG A+ +F+P D+ DLK FL  L  D+P+  +GLGSN+
Sbjct: 32  IEGIRGKLTNQAPLAKLVWFKSGGAADWLFEPADLDDLKTFLARLDGDLPVMALGLGSNL 91

Query: 74  LVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           ++RD G+ GVV++L  A  S     ++      A   G  +A++A   GI G  F  GIP
Sbjct: 92  IIRDGGVPGVVIKLGKAFASVETHDDYTVTCG-AGAHGVLVASTARDAGIAGLEFMRGIP 150

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHV 193
           G+IGG   MNAGA   ET   +++   +   G+   +P   L+Y YR S +    ++   
Sbjct: 151 GTIGGFVRMNAGAYGRETRDVLIDCDVVLPGGSFVTLPVADLQYTYRHSALPDGAVVVSA 210

Query: 194 VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEF 253
            L+G P    II A +  V   RE  QP++ KTGGSTFKNP G  AW+L++ +GCRGL  
Sbjct: 211 RLQGEPGDPEIIGAEMERVAEAREQSQPVRTKTGGSTFKNPPGKKAWELVDAAGCRGLTM 270

Query: 254 GGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           GGA++SE H NF+IN D AT  D+E LGE+V+++V+  SG+ LEWEI+R+G
Sbjct: 271 GGAQVSEKHTNFLINVDGATSADIEGLGEEVKRRVYAHSGVELEWEIQRVG 321


>gi|225574687|ref|ZP_03783297.1| hypothetical protein RUMHYD_02764 [Blautia hydrogenotrophica DSM
           10507]
 gi|225038114|gb|EEG48360.1| hypothetical protein RUMHYD_02764 [Blautia hydrogenotrophica DSM
           10507]
          Length = 316

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 104/311 (33%), Positives = 158/311 (50%), Gaps = 6/311 (1%)

Query: 4   GRISRLLRERGKQLRGK--FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS- 60
             +   ++    ++ G        P+   T FR GG AE    P  + +L+  L +    
Sbjct: 8   SILKEEIKNEFCRILGSDHVLVEEPMSAHTTFRIGGPAEYYVCPHSVDELQRTLDVCRRY 67

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
            +P  I+G GSN+LV D G RGV+++L               +   A      +A  AL 
Sbjct: 68  QLPYFILGNGSNLLVSDQGYRGVIIQLFRNMSQIDVQDER--IRAQAGALLSLVAKQALA 125

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
           H + GF F  GIPG++GGA  MNAGA   E    + EV  ++++G    IP E+L+  YR
Sbjct: 126 HSLTGFEFAGGIPGTLGGAVVMNAGAYGGELKDVLEEVTVLNQEGEILKIPFEKLEMGYR 185

Query: 181 SSEITK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
           +S + K + I+   VL+     ++ I   +  +   R + QP++  + GSTFK P G+ A
Sbjct: 186 TSIVKKKNYIVLEAVLKLRYGDEDKIRQTMRELTEKRTSKQPLELPSAGSTFKRPEGYFA 245

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LI  SG RG   GGA++SE HC F++N DNAT  D+  L   V  KV+ +  + LE E
Sbjct: 246 GKLIMDSGLRGYRVGGAQVSEKHCGFVVNIDNATAEDVRRLMRDVTDKVYEKFQVTLEPE 305

Query: 300 IKRLGDFFDHQ 310
           +K LG+F   +
Sbjct: 306 VKFLGNFSTGE 316


>gi|121601671|ref|YP_989226.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella
           bacilliformis KC583]
 gi|166222823|sp|A1UTC3|MURB_BARBK RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|120613848|gb|ABM44449.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella
           bacilliformis KC583]
          Length = 324

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 159/317 (50%), Positives = 214/317 (67%), Gaps = 5/317 (1%)

Query: 1   MIYGRI--SRLLRERGK---QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFL 55
           M +  I   +LL         ++GK   N  ++++TWFRTGG AE+ +QP D  DL  F 
Sbjct: 1   MNFQPIDGKKLLAWLQPVLSDIKGKITPNVEMRKVTWFRTGGLAELFYQPADEDDLALFF 60

Query: 56  TLLPSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLA 115
            +LP  +P+TIVG+GSN+LVRD GI GVV+RLS   F  I+  +    +VGA  + K LA
Sbjct: 61  KVLPEFVPVTIVGIGSNLLVRDGGIPGVVIRLSTKSFGQIKQVSSTRFLVGAATADKHLA 120

Query: 116 NSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQL 175
           ++AL   I GFHF++GIPG +GGA  MNAGAN  ET++ VVEV+ +DRKG +H++    +
Sbjct: 121 SAALEAEISGFHFYHGIPGGLGGALKMNAGANGVETAERVVEVYALDRKGERHILNLRDM 180

Query: 176 KYQYRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPT 235
            Y YR   I + L+ T  +L G   +++ I AA+  V  HRETVQPI+EKTGGSTF+N  
Sbjct: 181 NYAYRHCNIPEGLVFTAALLEGDVGNKDDIRAAMHEVALHRETVQPIREKTGGSTFRNLE 240

Query: 236 GHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGIL 295
             SAW++I+++GCRGL+ GGA++SE+HCNFMIN   ATGYDLE LGE VR +VFN S   
Sbjct: 241 DISAWKVIDEAGCRGLQIGGAQMSEMHCNFMINMGEATGYDLEKLGETVRARVFNHSAHH 300

Query: 296 LEWEIKRLGDFFDHQIV 312
           LEWEI+R+G F   +IV
Sbjct: 301 LEWEIQRIGQFEQDRIV 317


>gi|212639655|ref|YP_002316175.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Anoxybacillus
           flavithermus WK1]
 gi|254764132|sp|B7GGI1|MURB_ANOFW RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|212561135|gb|ACJ34190.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Anoxybacillus
           flavithermus WK1]
          Length = 302

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 95/302 (31%), Positives = 151/302 (50%), Gaps = 5/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           + +L  E  +   G  +EN  +   T  + GG A++  +P+ I  LK  + ++   ++P 
Sbjct: 1   MEKLREELLQANVGTVKENERMASHTTIKIGGPADLFVEPKHIDGLKKTMEIVRKYNVPW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
             +G GSN+LVRD GI GVV++L                 VG   S   LA    + G+ 
Sbjct: 61  RAIGRGSNLLVRDGGIEGVVIKLGEGLDDLYIHDTEVT--VGGGYSLIKLATVISKQGLS 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPG++GGA YMNAGA+  + S+ V +   +   G    +  E++++ YR+S +
Sbjct: 119 GLEFAGGIPGTVGGAVYMNAGAHGSDMSRIVKKAQILFEDGTIEWLTNEEMEFSYRTSVL 178

Query: 185 TKDLIITHVVLRGFPESQNIISAA--IANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
            K      +      +  N       +     +R   QP      GS F+NP    A QL
Sbjct: 179 QKKRKGICIAATLEMKKGNHDEIVAAMQKNKDYRRETQPWNYPCAGSIFRNPLPQYAGQL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IE++G +G   GGAKISE H NF++NA  AT  D+  L + V+K +++  G+ L+ E++ 
Sbjct: 239 IEQAGLKGYTIGGAKISEQHANFIVNAGGATANDVLELIDYVKKTIYDLYGVSLQTEVEI 298

Query: 303 LG 304
           +G
Sbjct: 299 VG 300


>gi|157827095|ref|YP_001496159.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia bellii
           OSU 85-389]
 gi|166222848|sp|A8GW95|MURB_RICB8 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|157802399|gb|ABV79122.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia bellii
           OSU 85-389]
          Length = 310

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 136/300 (45%), Positives = 180/300 (60%), Gaps = 1/300 (0%)

Query: 14  GKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNI 73
              ++G++++++ LK +TWF+ GGNAE+ F+P D  DL  FL      +PIT  G GSNI
Sbjct: 3   LPIVKGEYRKDYNLKHLTWFKVGGNAEIFFKPVDSEDLASFLVQNKQKLPITTFGAGSNI 62

Query: 74  LVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           ++RD GI GV ++L    FSNI   +   +IVG+ C   SLA     + I GF F  GIP
Sbjct: 63  IIRDGGIEGVTIKL-GQNFSNIGFTDDGHLIVGSSCLNFSLAKFCQVNAISGFEFLVGIP 121

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHV 193
           G+IGG   MNAGA  CE    +V +  ID  GN      E++ ++YR + + KDLII   
Sbjct: 122 GTIGGGVAMNAGAYGCEFKDILVRIEAIDFAGNFRTFTNEEIGFKYRGNNLPKDLIILKA 181

Query: 194 VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEF 253
           V +    +   I A +  +   R + QPIKE+TGGSTF NP G  +WQLI+K+G RG   
Sbjct: 182 VFKVNKGNSEDILARMNEINAARSSTQPIKERTGGSTFANPEGFKSWQLIDKAGLRGYRI 241

Query: 254 GGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVD 313
           G A ISELHCNFMIN  NAT  +LE LG  V++KVF  SGI L WEIKR+G       +D
Sbjct: 242 GDASISELHCNFMINNGNATAKELEDLGNFVQQKVFEDSGIKLNWEIKRIGKVSSRAWLD 301


>gi|227510618|ref|ZP_03940667.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus brevis
           subsp. gravesensis ATCC 27305]
 gi|227190270|gb|EEI70337.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus brevis
           subsp. gravesensis ATCC 27305]
          Length = 306

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 85/300 (28%), Positives = 148/300 (49%), Gaps = 6/300 (2%)

Query: 8   RLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITI 66
           + + +    +      N PL + T   TGG A+++  P+ +   +  L       IP+T+
Sbjct: 5   KEIADIYPNI--DILFNEPLSKYTHTLTGGPADILAFPESVRQTQELLAYANQYGIPVTV 62

Query: 67  VGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGF 126
           +G  SN++VRD GI G+ + L+    + I +R+H  ++  A  +   +  +A    + G 
Sbjct: 63  IGNASNLIVRDGGIHGLTMILTKM--NKIRIRHHNTIVADAGAALIDVTKAAQAQSLTGV 120

Query: 127 HFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK 186
            F  GIPGS+GGA +MNAGA   +    V     +        +   QL + YR   +  
Sbjct: 121 EFAAGIPGSVGGAIFMNAGAYGGDIDDVVTGAEVLTSDDKVIHLDFHQLDFGYRHCSVQD 180

Query: 187 DLII-THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEK 245
           +  I               I   + ++   RE+ QP++  + GS FK P G+ A +LI +
Sbjct: 181 NHQIVLSATFSLTSGIAEKIQKQMNHLNQLRESKQPLELPSCGSVFKRPKGYFAGKLIHE 240

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +G +G + GGA++S  H  F++N D+AT  D   +   V+K VF++ G+ LE E++ +G+
Sbjct: 241 AGLQGFQIGGAQVSTKHAGFIVNVDHATATDYLNVIAHVQKTVFDKFGVHLETEVRIIGE 300


>gi|253998174|ref|YP_003050237.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylovorus sp.
           SIP3-4]
 gi|253984853|gb|ACT49710.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylovorus sp.
           SIP3-4]
          Length = 310

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 97/313 (30%), Positives = 153/313 (48%), Gaps = 19/313 (6%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M+  +I          ++G+   N PL++   +R GG A+ ++ P  + DL+ F+  L  
Sbjct: 1   MMAQQIP---------MQGELMLNAPLERYNSWRVGGLADRLYIPAGLQDLQQFMRTLSK 51

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           D P+  +GLGSN+LVRD G+RG V+ + N       +  + E+   A  +   LA  + R
Sbjct: 52  DEPVHFIGLGSNLLVRDGGVRGTVIVMHNVLTGLEML--NGELYAEAGVTCAKLARFSAR 109

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
            G+ G  F  GIPG++GGA  MNAG +  ET   V  V  +DR+G  H   R +    YR
Sbjct: 110 QGLQGGEFMAGIPGTVGGALAMNAGCHGGETWDIVQRVLTMDREGELHKRSRAEFDASYR 169

Query: 181 SSEIT--------KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFK 232
              +         +                      I  +   R   QP+ +   GSTF+
Sbjct: 170 HVALAGQPEHWLGEQEWFIAAWFSLPAGDAEEAEQKIKQLLARRLATQPLNQPNAGSTFR 229

Query: 233 NPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQS 292
           NP G  A +LIE+ G +G + GGA++SE H NF++N   A   ++E L   +R+ V  + 
Sbjct: 230 NPPGDYAARLIEECGLKGYQIGGAQVSEKHANFIVNLGGARAAEIEQLIAHMRESVKAKF 289

Query: 293 GILLEWEIKRLGD 305
           GI L+ E++ +G+
Sbjct: 290 GIELQQEVRVIGE 302


>gi|238926815|ref|ZP_04658575.1| UDP-N-acetylmuramate dehydrogenase [Selenomonas flueggei ATCC
           43531]
 gi|238885347|gb|EEQ48985.1| UDP-N-acetylmuramate dehydrogenase [Selenomonas flueggei ATCC
           43531]
          Length = 303

 Score =  221 bits (562), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 101/307 (32%), Positives = 164/307 (53%), Gaps = 7/307 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    I    +E     R +  EN P++  T FR GG A+++F P +  +++  +     
Sbjct: 1   MNEAFIHSCYQEFE---RTRLFENAPMRFHTTFRIGGPADLLFYPHNTEEVRAIIQKAKH 57

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            DIP+TI+G GSN+L+RD GIRG+V+R S         +    +IV +    K +A+ A 
Sbjct: 58  YDIPVTILGNGSNLLIRDGGIRGLVIRFSRQMSGI--TQEGTTLIVCSGALLKDIASFAQ 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
           + G+ G  F  GIPGSIGGA +MNAGA + E    V+ V  I   G   +   ++L + Y
Sbjct: 116 KKGLSGLEFACGIPGSIGGAVFMNAGAYDGEVKSVVMAVKTISPDGEVRLYSADELDFGY 175

Query: 180 RSSEITKDLIITHV-VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S    +        L    +  + I   ++++   RE+ QP+   + GSTFK P G+ 
Sbjct: 176 RHSVFHTNNEAICEAHLCLRTDDPSSILERMSDLNQRRESKQPLSYPSAGSTFKRPPGYF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A  LI+++G +GL +GGA++S+ H  F+IN   AT  D++ L   V+ +V+ +  + L  
Sbjct: 236 AGTLIDQTGLKGLTYGGAQVSQKHAGFIINIGGATARDVQQLIHSVQNRVYAKHHVRLFP 295

Query: 299 EIKRLGD 305
           E++ +G+
Sbjct: 296 ELRIIGE 302


>gi|16126784|ref|NP_421348.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Caulobacter
           crescentus CB15]
 gi|221235564|ref|YP_002518001.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Caulobacter
           crescentus NA1000]
 gi|29336914|sp|Q9A5A7|MURB_CAUCR RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|254764141|sp|B8H085|MURB_CAUCN RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|13424108|gb|AAK24516.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Caulobacter
           crescentus CB15]
 gi|220964737|gb|ACL96093.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Caulobacter
           crescentus NA1000]
          Length = 301

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 121/296 (40%), Positives = 162/296 (54%), Gaps = 3/296 (1%)

Query: 11  RERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLG 70
           + +    RGK   +  L   TWFR GG A+V+F P D  DL  FL  L   +P+  +G+G
Sbjct: 4   KTQLPTARGKLLIDEALAPFTWFRVGGPADVVFLPADEQDLSDFLKGLDPSVPVMAIGVG 63

Query: 71  SNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFY 130
           SN+LVRD G+ GVV+RL     + +E      +  G+      LA  A   GI G  F+ 
Sbjct: 64  SNLLVRDGGVDGVVIRLGKGF-NGVEALGDNRIKAGSAVPDAILARKAAEAGIAGLEFYV 122

Query: 131 GIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLII 190
           G+PG+IGGA  MNAG    ET   V  V  ++R G    +  E L Y YR S +     +
Sbjct: 123 GVPGTIGGAVIMNAGCYGAETVNVVKSVRVMNRAGVVRELSVEDLHYTYRHSALQDGEPV 182

Query: 191 THVVLRGFPESQNIISAAIAN--VCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGC 248
             +            +       +   RET QPI+EKTGGSTFKNP GHS+W+L++++G 
Sbjct: 183 IVLDAIFEGTPDEPEAIKARMAEITARRETTQPIREKTGGSTFKNPPGHSSWKLVDEAGW 242

Query: 249 RGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           RG  +GGA  S LH NF+IN   AT  DLE LGE VR  V  ++G+ L+WEIKR+G
Sbjct: 243 RGKPYGGAMFSPLHSNFLINTGEATAADLEGLGEAVRADVLAKTGVQLDWEIKRIG 298


>gi|313200243|ref|YP_004038901.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylovorus sp.
           MP688]
 gi|312439559|gb|ADQ83665.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylovorus sp.
           MP688]
          Length = 310

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 98/313 (31%), Positives = 153/313 (48%), Gaps = 19/313 (6%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M+  +I          ++G+   N PL++   +R GG A+ ++ P  + DL+ F+  L  
Sbjct: 1   MMAQQIP---------MQGELMLNAPLERYNSWRVGGLADRLYIPAGLQDLQQFMRTLSK 51

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           D P+  +GLGSN+LVRD G+RG V+ + N       V  + E+   A  +   LA  + R
Sbjct: 52  DEPLHFIGLGSNLLVRDGGVRGTVIVMHNVLTGLEMV--NGELYAEAGVTCAKLARFSAR 109

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
            G+ G  F  GIPG++GGA  MNAG +  ET   V  V  +DR+G  H   R +    YR
Sbjct: 110 QGLQGGEFMAGIPGTVGGALAMNAGCHGGETWDIVQRVLTMDRQGELHERSRAEFDASYR 169

Query: 181 SSEIT--------KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFK 232
              +         +                      I  +   R   QP+ +   GSTF+
Sbjct: 170 HVALAGQPEHWLGEQEWFIAAWFSLPAGDAEEAEQKIKQLLARRLATQPLNQPNAGSTFR 229

Query: 233 NPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQS 292
           NP G  A +LIE+ G +G + GGA++SE H NF++N   A   ++E L   +R+ V  + 
Sbjct: 230 NPPGDYAARLIEECGLKGYQIGGAQVSEKHANFIVNLGGARAAEIEQLIAHMRESVKAKF 289

Query: 293 GILLEWEIKRLGD 305
           GI L+ E++ +G+
Sbjct: 290 GIELQQEVRVIGE 302


>gi|170756034|ref|YP_001783015.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           botulinum B1 str. Okra]
 gi|254764160|sp|B1IFW4|MURB_CLOBK RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|169121246|gb|ACA45082.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           botulinum B1 str. Okra]
          Length = 306

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 105/290 (36%), Positives = 155/290 (53%), Gaps = 5/290 (1%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVR 76
                 + P+K+ T F+ GG A+++  P  +  +K  + L  ++ IP  I+G GSN+LVR
Sbjct: 17  NNNVLIDEPMKKHTSFKVGGPADLLITPTTLEQVKDSIILCRNNSIPYYIIGNGSNLLVR 76

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GIRGVV++    G   +       +I  +     ++ N AL+  +GG  F  GIPGS+
Sbjct: 77  DGGIRGVVIKFLKLGDIKV---EGDRVIAQSGAPLTNICNEALKSNLGGLEFACGIPGSV 133

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLII-THVVL 195
           GGA  MNAGA N E SQ +     ID+ GN  ++ +EQL   YR S I K   I   V  
Sbjct: 134 GGAVTMNAGAYNGEISQVIESAKVIDKDGNVFLLNKEQLDLGYRMSAIQKYHYIVLEVTF 193

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           +      + I   I ++   R   QP++  + GSTFK P GH A +LIE +G +G   GG
Sbjct: 194 KLHNSEYDTIKNRIMDLNRRRIEKQPLEYPSAGSTFKRPEGHFAAKLIEDTGLKGESIGG 253

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           A++SE H  F+IN   AT  D+  L E V+ KV  +  + L  E++ +G+
Sbjct: 254 AQVSEKHSGFIINKGGATAGDILNLIEFVQNKVMEKFQVDLHTEVRIIGE 303


>gi|312877517|ref|ZP_07737478.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311795720|gb|EFR12088.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Caldicellulosiruptor
           lactoaceticus 6A]
          Length = 314

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 84/291 (28%), Positives = 134/291 (46%), Gaps = 7/291 (2%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDA 78
           +F ++ PLK+ T F+ GG A  +  P+    L   LTL   + I   +VG  SN+LV D 
Sbjct: 13  EFLKDHPLKEFTTFKIGGKARYIVFPKSTKQLIEILTLAKDEAINYIVVGNCSNVLVSDK 72

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           G       +      +    +   +          +A  A   G+ G  F  GIPG++GG
Sbjct: 73  GY---NGAIITTVKIDSFKIDGNLIEADCGAMLSQVARKACEAGLKGLEFAVGIPGTVGG 129

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITH---VVL 195
           A  MNAGA + E          +D   N+  + +  +++ YR S + ++ ++       L
Sbjct: 130 AVCMNAGAYDGEIKDIFEWAEVLDENLNRLKLSKSDMRFSYRHSRLKEERMVLIRAAFCL 189

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           +   +               R   QP+   + GS FK P  + A +LIE +G +G   GG
Sbjct: 190 KFADKEDIPPLQKANEFAKRRREKQPLSYPSAGSVFKRPPNNFAGKLIEDAGLKGYRIGG 249

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           A ISE H  F++N ++A   D+  L    +K V+ + GILLE EI+ +G+F
Sbjct: 250 ACISEKHAGFIVNVEDAKAEDVRKLIYLAQKTVYEKFGILLEPEIQFIGEF 300


>gi|58038645|ref|YP_190609.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Gluconobacter
           oxydans 621H]
 gi|81352634|sp|Q5FUJ3|MURB_GLUOX RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|58001059|gb|AAW59953.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Gluconobacter
           oxydans 621H]
          Length = 306

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 124/296 (41%), Positives = 178/296 (60%), Gaps = 2/296 (0%)

Query: 15  KQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNIL 74
           K LRG+   N PL    WFR GG A+ +F P+D  DL  FL   P+ +P+T++G  SN++
Sbjct: 10  KGLRGRLTPNAPLGPRAWFRVGGPADWLFVPEDQDDLALFLREKPATMPVTVLGACSNVI 69

Query: 75  VRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPG 134
           +RD GI G V+RL+              +IVGA     ++A  A   G+ G  F  GIPG
Sbjct: 70  IRDGGIAGTVIRLARGFADI--TVQGNSLIVGAAALDITVAEHAAAAGLAGLEFLAGIPG 127

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVV 194
           SIGGA  MNAGA   + +        +  +G    +  ++L + YR SE+ +  ++    
Sbjct: 128 SIGGAVRMNAGAYGSDINAVFEWADILTAEGELRRLSHDELGFAYRHSELPEGSVVIRAS 187

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
           LRG P++ + I + IA++   RE  QP++ +TGGSTF+NP GH AWQLI+++GCRGL+ G
Sbjct: 188 LRGTPDNADAIRSRIADIRASREASQPVRARTGGSTFRNPDGHKAWQLIDEAGCRGLQIG 247

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQ 310
            A++SE HCNF++N   A+  DLE LGE VR+KV  QSG+ L WEIKR+G   + +
Sbjct: 248 DAQVSEKHCNFLLNLGQASSADLETLGETVREKVLAQSGVDLHWEIKRIGRKSEGE 303


>gi|317132299|ref|YP_004091613.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Ethanoligenens
           harbinense YUAN-3]
 gi|315470278|gb|ADU26882.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Ethanoligenens
           harbinense YUAN-3]
          Length = 304

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 88/298 (29%), Positives = 135/298 (45%), Gaps = 4/298 (1%)

Query: 8   RLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITI 66
            +L     +      EN P+ + T F+ GG A +  +P +   L   + L     IP+  
Sbjct: 7   SILAAFASEQGADVLENEPMSRHTTFQIGGPARLFIRPHEEQVLGAIVGLCAKLGIPVLP 66

Query: 67  VGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGF 126
           +G GSN+L+ D G  G V+ L       +   +   +  GA    + +   A  HG+ G 
Sbjct: 67  LGNGSNLLIADDGFDGTVVSLERLSALQV---DGNGIRCGAGVKLEDVCLFARDHGLAGL 123

Query: 127 HFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK 186
            F YGIPG+ GGA YMNAGA   E    V     +D       +  E       S     
Sbjct: 124 EFAYGIPGTAGGAVYMNAGAYGGEMRDVVDRSWYLDGAVQGVYMRGEHAFSYRHSIYTNS 183

Query: 187 DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKS 246
             ++T V     P  +  I   +  +   R + QP++  + GS FK P GH A  LI++ 
Sbjct: 184 RKVVTGVRFALVPGDKAQIGRKMQELMDRRVSKQPLEYPSAGSVFKRPPGHFAGTLIDQC 243

Query: 247 GCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           G +G   GGA +S+ H  F++N   AT  D+  L  Q++  V  ++G+ LE EI+ +G
Sbjct: 244 GLKGTSVGGAAVSDKHAGFIVNMGGATCADVVALIRQIQAAVLQKTGVKLESEIRIIG 301


>gi|288958925|ref|YP_003449266.1| UDP-N-acetylmuramate dehydrogenase [Azospirillum sp. B510]
 gi|288911233|dbj|BAI72722.1| UDP-N-acetylmuramate dehydrogenase [Azospirillum sp. B510]
          Length = 324

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 127/302 (42%), Positives = 173/302 (57%), Gaps = 7/302 (2%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           L +R   +RG+   +  L  +TWFR GG AEVMF+P D  DL  FL  LP+++P+T++G+
Sbjct: 14  LIQRMPAVRGRLTADAALAPVTWFRVGGPAEVMFRPADADDLADFLAALPAEVPVTVIGV 73

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHG--IGGFH 127
            SN+LVRD G+ GV +RL               M + A  +   L  + +     I G  
Sbjct: 74  ASNLLVRDGGVPGVTIRLGRGFTDITAAGTGDGMTLAAGAAALDLNVAMVARDAGIAGLE 133

Query: 128 FFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD 187
           F  GIPG+IGGA  MN GA   E +  +V    + R G +       + + YR S   +D
Sbjct: 134 FLSGIPGTIGGALRMNGGAYGRELADVLVGASAVARDGRRLEFNHAAMGFTYRHSAAPED 193

Query: 188 LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPT-----GHSAWQL 242
            I T  VLRG P +   I+  +A +   R   QP++ +TGGSTFKNP      G  AW+L
Sbjct: 194 CIFTGAVLRGEPGNPLEIARRMAEISDKRADSQPVRSRTGGSTFKNPAPEISGGLKAWEL 253

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           I+K+GCRGL  G A++SE HCNF+IN   AT   LE LGE+VR++VF  SG+ LEWEIKR
Sbjct: 254 IDKAGCRGLSIGDAQVSEKHCNFLINNGAATAAQLEALGEEVRRRVFEASGVTLEWEIKR 313

Query: 303 LG 304
           +G
Sbjct: 314 IG 315


>gi|312792533|ref|YP_004025456.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312179673|gb|ADQ39843.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 314

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 85/291 (29%), Positives = 135/291 (46%), Gaps = 7/291 (2%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDA 78
           +F ++ PLK+ T F+ GG A  +  P+    L   LTL   + I   +VG  SN+LV D 
Sbjct: 13  EFLKDHPLKEFTTFKIGGKARYIVFPKSTKQLIEILTLAKDEAINYIVVGNCSNVLVSDK 72

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           G       +      +    +   +          +A  A   G+ G  F  GIPG++GG
Sbjct: 73  GY---NGAIITTVKIDSFKIDGNLIEAECGAMLSQVARKACEAGLKGLEFAVGIPGTVGG 129

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITH---VVL 195
           A YMNAGA + E          +D   N+  + +  +++ YR S + ++ ++       L
Sbjct: 130 AVYMNAGAYDGEIKDIFEWAEVLDENLNRLKLSKSDMRFSYRHSRLKEERMVLIRAAFCL 189

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           +   +               R   QP+   + GS FK P  + A +LIE +G +G   GG
Sbjct: 190 KFADKEDIPPLQKANEFAKRRREKQPLSYPSAGSVFKRPPNNFAGKLIEDAGLKGYRIGG 249

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           A ISE H  F++N ++A   D+  L    +K V+ + GILLE EI+ +G+F
Sbjct: 250 ACISEKHAGFIVNVEDAKAEDVRKLIYLAQKTVYEKFGILLEPEIQFIGEF 300


>gi|296331099|ref|ZP_06873573.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus subtilis
           subsp. spizizenii ATCC 6633]
 gi|305674254|ref|YP_003865926.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus subtilis
           subsp. spizizenii str. W23]
 gi|296151743|gb|EFG92618.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus subtilis
           subsp. spizizenii ATCC 6633]
 gi|305412498|gb|ADM37617.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus subtilis
           subsp. spizizenii str. W23]
          Length = 303

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 97/303 (32%), Positives = 163/303 (53%), Gaps = 5/303 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           + ++++E  ++  GK   N PL   T  + GG A+V+  P  +  +K  + ++   D+  
Sbjct: 1   MEKVIQELKEREVGKVLANEPLANHTTMKIGGPADVLVIPSSVDAVKDIMDVIKKYDVKW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T++G GSN+LV D GIRGVV++L      +       ++ VG   S   LA S  + G+ 
Sbjct: 61  TVIGRGSNLLVLDEGIRGVVIKLG--VGLDHLELEGEQVTVGGGYSVVRLATSLSKKGLS 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA+  + S+ +V+ H +   G    +  EQ+ + YR+S +
Sbjct: 119 GLEFAAGIPGSVGGAVYMNAGAHGSDMSEILVKAHILFEDGTIEWLTNEQMDFSYRTSVL 178

Query: 185 TKDLIITHVVL--RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
            K      +    +   + +  I   + +   +R+  QP      GS F+NP  + A  L
Sbjct: 179 QKKRPGVCLEAVLQLEQKDKESIVQQMQSNKDYRKNTQPYSSPCAGSIFRNPLPNHAGNL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           +EK+G +G + GGAKISE+H NF++NA  A+  D+  L + V+K +  +  I +  E++ 
Sbjct: 239 VEKAGLKGYQIGGAKISEMHGNFIVNAGGASAKDVLDLIDHVKKTIREKYEIDMHTEVEI 298

Query: 303 LGD 305
           +G+
Sbjct: 299 IGE 301


>gi|317121708|ref|YP_004101711.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermaerobacter
           marianensis DSM 12885]
 gi|315591688|gb|ADU50984.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermaerobacter
           marianensis DSM 12885]
          Length = 322

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 104/298 (34%), Positives = 149/298 (50%), Gaps = 4/298 (1%)

Query: 11  RERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGL 69
           RE    ++G  +   PL + T FR GG A+V+ +P D  DL   L       +P+T++G 
Sbjct: 3   RELQGVVKGLVKVAEPLARYTTFRIGGPADVLVEPADEEDLARALAWAQERGVPVTLLGG 62

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVG--ARCSGKSLANSALRHGIGGFH 127
           GSN+LV D G+ G+VLR+   G       +     V   A      L + A R G  G  
Sbjct: 63  GSNVLVPDEGLPGLVLRIGLDGIRWERPGDGGRRGVVVGAGTVLARLVHEAARRGCRGLE 122

Query: 128 FFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-K 186
              GIPG++GGA  MNAG  +    Q V  V  ++  G   V PREQ  + YRSS +  +
Sbjct: 123 PCAGIPGTVGGALVMNAGTRDGSIGQVVDWVRVVEPGGQLAVWPREQCGFAYRSSRMQAE 182

Query: 187 DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKS 246
            + +    L   P     I   I     +R+  QP++    GS FKNP G ++ +LIE  
Sbjct: 183 GIPVVAARLVLDPGDPQAILQEIRRHTAYRQRTQPLRYPNCGSVFKNPPGDASGRLIEAC 242

Query: 247 GCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           G +GL  G A+ISE H NF+IN   AT  D+  L     + V ++ G++LE E++ LG
Sbjct: 243 GLKGLRRGRAQISEQHANFIINLGGATAEDVLDLMTTAWRCVRDRFGVILEPEVRLLG 300


>gi|148381319|ref|YP_001255860.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           botulinum A str. ATCC 3502]
 gi|153933962|ref|YP_001385695.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           botulinum A str. ATCC 19397]
 gi|153934775|ref|YP_001389101.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           botulinum A str. Hall]
 gi|166222834|sp|A7FYX2|MURB_CLOB1 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|166222835|sp|A5I7A3|MURB_CLOBH RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|148290803|emb|CAL84937.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           botulinum A str. ATCC 3502]
 gi|152930006|gb|ABS35506.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           botulinum A str. ATCC 19397]
 gi|152930689|gb|ABS36188.1| UDP-N-acetylmuramate dehydrogenase [Clostridium botulinum A str.
           Hall]
          Length = 306

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 105/290 (36%), Positives = 153/290 (52%), Gaps = 5/290 (1%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVR 76
                 + P+K+ T F+ GG A+++  P  +  +K  + L  ++ IP  I+G GSN+LVR
Sbjct: 17  NNNVLIDEPMKKHTSFKVGGPADLLITPTTLEQVKDSIILCRNNSIPYYIIGNGSNLLVR 76

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GIRGVV++    G   +       +I  +     ++ N AL+  +GG  F  GIPGS+
Sbjct: 77  DGGIRGVVIKFLKLGDIKV---EGDRVIAQSGAPLTNICNEALKSNLGGLEFACGIPGSV 133

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGA N E SQ +     ID+ GN  ++ +EQL   YR S I K   I   V  
Sbjct: 134 GGAVTMNAGAYNGEISQVIESAKVIDKDGNVFLLNKEQLDLGYRMSAIQKYHYIVLEVTF 193

Query: 197 GFPESQNIISAAIANVCHHRET-VQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
               S+           + R T  QP++  + GSTFK P GH A +LIE +G +G   GG
Sbjct: 194 KLHNSEYDTIKNRIMDLNRRRTEKQPLEYPSAGSTFKRPEGHFAAKLIEDTGLKGESIGG 253

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           A++SE H  F+IN   AT  D+  L E V+ KV  +  + L  E++ +G+
Sbjct: 254 AQVSEKHSGFIINKGGATAGDILNLIEFVQNKVMEKFEVDLHTEVRIIGE 303


>gi|226313423|ref|YP_002773317.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brevibacillus brevis
           NBRC 100599]
 gi|226096371|dbj|BAH44813.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brevibacillus brevis
           NBRC 100599]
          Length = 301

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 100/302 (33%), Positives = 159/302 (52%), Gaps = 4/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPI 64
           + ++  E  +    K   + PL   T +R GG A+++ QP+D   L+  L ++   +IP 
Sbjct: 1   MKKIADELMQAGIEKVWTDEPLANHTTWRIGGPADLLIQPKDKASLQKALQIIHRHEIPW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           +++G GSN+LVRD GIRG VL+++                VGA  S   LA    + G+ 
Sbjct: 61  SVIGRGSNLLVRDRGIRGAVLKVAEGLSHCEFRGEEVC--VGAGYSMIRLAVETGKMGLT 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPG++GGA YMNAGA+  + S+ ++E   +   G   V+  E+L + YR+S +
Sbjct: 119 GMEFAGGIPGTVGGAVYMNAGAHGSDLSRILIEAEILFENGESKVLSNEELSFSYRTSLL 178

Query: 185 TK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            K   I+     +     +  I+A +A     R   QP++    GS F+NP    A +LI
Sbjct: 179 QKQKGIVLEARFQLRTGDRKEIAATLAVNKERRRNTQPLQMPCAGSVFRNPPNDHAGRLI 238

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           E +G +G + GGA++SE H NF++N   AT  D+  L   VR  +  ++GI L  E+  +
Sbjct: 239 EAAGLKGYQIGGAQVSEKHSNFIVNCGGATATDVLTLINHVRSTILEKNGIDLHPEVLVV 298

Query: 304 GD 305
           G+
Sbjct: 299 GE 300


>gi|225175496|ref|ZP_03729490.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Dethiobacter
           alkaliphilus AHT 1]
 gi|225168825|gb|EEG77625.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Dethiobacter
           alkaliphilus AHT 1]
          Length = 298

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 99/300 (33%), Positives = 146/300 (48%), Gaps = 4/300 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPI 64
           +  + +    ++ G  +   P+ + T F+ GG A++  +PQ   DL   L  L    IP+
Sbjct: 1   MKDIAQRLAAEITGDVKTAEPMSKHTTFKIGGPADLFVEPQTTEDLIRSLEFLRGQSIPV 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G GSN+LV D+G RG V+RL+              +  GA  S   LA  A   G+G
Sbjct: 61  FVMGNGSNLLVSDSGYRGAVIRLAGEFLRT--DYGPTTVDAGAAVSLPKLAREASARGLG 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIP +IGGA  MNAGA+ CE    + E   +D     H +  + L   YR S +
Sbjct: 119 GLEFAAGIPATIGGALMMNAGAHGCEIGGVIAEAEILDTDLKVHTLRHKDLGLSYRRSNL 178

Query: 185 TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIE 244
               ++  V L   P     + A   +    R   QP +    GS FKNP   +A +LI+
Sbjct: 179 APGAVVCRVRLELEPGESEALLAKCHHNLQVRRERQP-RLPNAGSIFKNPPEDAAGRLID 237

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            +G +G   GGA ISE+H NF++N  NAT  D+  L    +  V  Q G+ L+ E++ LG
Sbjct: 238 AAGLKGRRAGGAMISEVHANFIVNCGNATAEDVCTLINMAKTAVAEQFGMELKLEVRLLG 297


>gi|322385403|ref|ZP_08059048.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus cristatus ATCC
           51100]
 gi|321270662|gb|EFX53577.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus cristatus ATCC
           51100]
          Length = 300

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 97/302 (32%), Positives = 150/302 (49%), Gaps = 6/302 (1%)

Query: 7   SRLLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPI 64
            + L +   +L G   + N PL Q T+ + GG A+ +  P++ ++L   + L    +IP 
Sbjct: 1   MQNLEKFSAELEGIDIRFNEPLSQYTYTKVGGAADFLVFPRNRYELARIVKLANRENIPW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G  SNI+VRD GIRG V+         +   +   +   A  +       AL H + 
Sbjct: 61  LVLGNSSNIIVRDGGIRGFVIMFDKLNNVTV---DGYTIEAEAGANLTQTTRIALHHSLT 117

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           GF F  GIPGS+GGA +MNAGA   E +  +V    +  +G    +    +++ YR S I
Sbjct: 118 GFEFACGIPGSVGGAVFMNAGAYGGEIAHVLVSCKVLTPEGEIKTLDARDMRFGYRHSLI 177

Query: 185 TK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            +   I+        P     I   +  + + RE  QP++  + GS FK P GH A QLI
Sbjct: 178 QETGDIVISAKFGLAPGVHQNIRQEMERLTYLRELKQPLEYPSCGSVFKRPLGHFAGQLI 237

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
            ++G +G   GG ++SE H  FM+N D+ T  D E L   V K V   SG+ LE E++ +
Sbjct: 238 SEAGLKGYRIGGVEVSEKHAGFMVNVDHGTASDYEELIAHVIKTVEEHSGVTLEREVRII 297

Query: 304 GD 305
           G+
Sbjct: 298 GE 299


>gi|227513633|ref|ZP_03943682.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           buchneri ATCC 11577]
 gi|227083149|gb|EEI18461.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           buchneri ATCC 11577]
          Length = 306

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 85/300 (28%), Positives = 148/300 (49%), Gaps = 6/300 (2%)

Query: 8   RLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITI 66
           + + +    +      N PL + T   TGG A+++  P+ +   +  L       IP+T+
Sbjct: 5   KEIADIYPNI--DILFNEPLSKYTHTLTGGPADILAFPESVRQTQELLDYANQYGIPVTV 62

Query: 67  VGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGF 126
           +G  SN++VRD GI G+ + L+    + I +R+H  ++  A  +   +  +A    + G 
Sbjct: 63  IGNASNLIVRDGGIHGLTMILTKM--NKIRIRHHNTIVADAGAALIDVTKAAQAQSLTGV 120

Query: 127 HFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK 186
            F  GIPGS+GGA +MNAGA   +    V     +        +   QL + YR   +  
Sbjct: 121 EFAAGIPGSVGGAIFMNAGAYGGDIDDVVTGAEVLTSDDKVIHLDFHQLDFGYRHCSVQD 180

Query: 187 DLII-THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEK 245
           +  I               I   + ++   RE+ QP++  + GS FK P G+ A +LI +
Sbjct: 181 NHQIVLSATFSLTSGIAEKIQKQMNHLNQLRESKQPLELPSCGSVFKRPKGYFAGKLIHE 240

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +G +G + GGA++S  H  F++N D+AT  D   +   V+K VF++ G+ LE E++ +G+
Sbjct: 241 AGLQGFQIGGAQVSTKHAGFIVNVDHATATDYLNVIAHVQKTVFDKFGVHLETEVRIIGE 300


>gi|114777860|ref|ZP_01452791.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Mariprofundus
           ferrooxydans PV-1]
 gi|114551851|gb|EAU54391.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Mariprofundus
           ferrooxydans PV-1]
          Length = 303

 Score =  220 bits (560), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 95/307 (30%), Positives = 147/307 (47%), Gaps = 4/307 (1%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M   R     +    +L G  +E  P+ + T    GG A   F+P D   L   ++L P 
Sbjct: 1   MSALRQKTPWQIALGEL-GALREQEPMSRHTTLAVGGPARWFFRPTDRQALLTAVSLCPP 59

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           D+ I  +G GSN+L+ D G+  +V+ LS+         +   +  GA       A     
Sbjct: 60  DLSILPLGRGSNMLIPDGGLDSLVVDLSDLNELTF---DGYNVRAGAGVRMSRFARLCAE 116

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
           HG+ G  F   +PGSIGG   MNAGA   + S  +V V  + R G    +   +L   YR
Sbjct: 117 HGLSGCEFLATVPGSIGGGVMMNAGAFAQQLSDTLVTVEVLMRSGEVREMKAVELGMSYR 176

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
            S++ +  I+        P+  + +   +  +   R   QP+     GS FKNP G  A 
Sbjct: 177 HSQLPEQSIVLVAEFVLHPDHPDHVRERMRTMRRRRSATQPLTLPNCGSVFKNPPGDHAA 236

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LIE +G +GL  GGA+ISE H NF++N   A+  D+  L  ++R++V  +  I LE E+
Sbjct: 237 RLIEAAGLKGLAIGGARISEQHANFIVNEGEASSADIVALIGRIRREVKERFDIELEPEV 296

Query: 301 KRLGDFF 307
           + LG++ 
Sbjct: 297 RMLGEWL 303


>gi|255658212|ref|ZP_05403621.1| UDP-N-acetylmuramate dehydrogenase [Mitsuokella multacida DSM
           20544]
 gi|260849521|gb|EEX69528.1| UDP-N-acetylmuramate dehydrogenase [Mitsuokella multacida DSM
           20544]
          Length = 305

 Score =  220 bits (560), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 101/308 (32%), Positives = 167/308 (54%), Gaps = 7/308 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           MI     +  +   +    +F+ + P+K  T F+ GG A+ +  P  + + +  L L+ +
Sbjct: 1   MIDKNFIQKCQAFIEP--NRFRLDEPMKLHTTFKIGGPADCLIFPASMEETEKVLALVSA 58

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
             +P+TI+G GSN+LV+D GIRGVV++ +              +I GA    K ++ +A 
Sbjct: 59  YKLPLTILGNGSNVLVQDKGIRGVVVKFARPMAKI--RHEGTRIIAGAGALLKDVSEAAA 116

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
           +  + G  F  GIPGSIGGA +MNAGA + E       V  +DR+G  H   R++L   Y
Sbjct: 117 QSSLTGLEFACGIPGSIGGAIFMNAGAYDGEMKNVADTVRTVDREGKIHTYSRDELDLGY 176

Query: 180 RSSEITKDLI-ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S    +   I  V L   P     I A + +    RE+ QP++  + GSTFK P G+ 
Sbjct: 177 RHSRFQDNGEAIVEVELCLEPGDSEAIRAKMEDFTERRESKQPLEMPSAGSTFKRPKGYF 236

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMIN-ADNATGYDLEYLGEQVRKKVFNQSGILLE 297
           A  LI+++G +GL+ GGA++S  H  F++N   +AT  D+  L  +V+++V+ + G++L 
Sbjct: 237 AGTLIQETGLKGLQVGGAQVSTKHAGFVVNATGDATAADVRGLIHEVQQRVYKKHGVMLH 296

Query: 298 WEIKRLGD 305
            E++ +G+
Sbjct: 297 PEVRIIGE 304


>gi|153812857|ref|ZP_01965525.1| hypothetical protein RUMOBE_03264 [Ruminococcus obeum ATCC 29174]
 gi|149831069|gb|EDM86158.1| hypothetical protein RUMOBE_03264 [Ruminococcus obeum ATCC 29174]
          Length = 280

 Score =  220 bits (560), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 104/282 (36%), Positives = 152/282 (53%), Gaps = 4/282 (1%)

Query: 27  LKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAGIRGVVL 85
           +K+ T FR GG AEV   P ++ +++  L +    D+P  I+G GSN+LV D G RGVV+
Sbjct: 1   MKRHTTFRIGGPAEVFVMPGNLEEVQRILEICRTEDLPYFILGNGSNLLVSDRGYRGVVI 60

Query: 86  RLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAG 145
           +L              E+   A     ++A +A R  + GF F  GIPG++GGA  MNAG
Sbjct: 61  QLDRNFGEVKV--EGTEIHASAGALLSTIAVAARRASLTGFEFAGGIPGTLGGAVVMNAG 118

Query: 146 ANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLRGFPESQNI 204
           A   E    + +V  +D+ G    IP E+L+  YR+S I     I+   VL     +   
Sbjct: 119 AYGGEMKDVLRKVMVMDQSGKVFEIPAEELQMGYRTSIIKTAGYIVLGAVLSLKEGNLEE 178

Query: 205 ISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCN 264
           I      +   R + QP++  + GSTFK P G+ A +LI  SG RG   GGA++SE HC 
Sbjct: 179 IKMLTRKLSEQRTSKQPLEYPSAGSTFKRPEGYFAGKLIMDSGLRGYRVGGAQVSEKHCG 238

Query: 265 FMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           F+IN  +AT  D+  L + V + V+ + G+ LE E+K LG+F
Sbjct: 239 FVINTGDATAEDVRSLMKHVTEIVYAKFGVTLEPEVKFLGEF 280


>gi|240143362|ref|ZP_04741963.1| UDP-N-acetylmuramate dehydrogenase [Roseburia intestinalis L1-82]
 gi|257204735|gb|EEV03020.1| UDP-N-acetylmuramate dehydrogenase [Roseburia intestinalis L1-82]
 gi|291539850|emb|CBL12961.1| UDP-N-acetylmuramate dehydrogenase [Roseburia intestinalis XB6B4]
          Length = 302

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 102/291 (35%), Positives = 153/291 (52%), Gaps = 5/291 (1%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVR 76
             +   + P+K+ T FR GG A+++ QP+   +L   + L    D+P  ++G GSN+LV 
Sbjct: 15  ENRIFTDEPMKKHTTFRVGGPADILVQPKGT-ELAAVIRLCRKYDVPYQVIGNGSNLLVG 73

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GIR   L +      +        + VGA       AN A  HG+ G  F  GIPG I
Sbjct: 74  DRGIR--GLVIEMLSKEDEICVEDDCITVGAGMLLSKTANRAAEHGLTGMEFAAGIPGRI 131

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS-EITKDLIITHVVL 195
           GGA  MNAGA   E    +  V  +D++GN+ ++  E+L+  YR+S  + K  I+T   +
Sbjct: 132 GGAVVMNAGAYGGEMKDILTAVTVLDQEGNEKILSAEELELGYRTSCILKKGYIVTGAKI 191

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           +     +  I A +  +   R   QP++  + GSTFK P G+ A +LI  +G RG   G 
Sbjct: 192 KLKHGEETAIRARMEELKKQRVEKQPLEYPSAGSTFKRPEGYFAGKLIMDAGLRGYLVGE 251

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           A++SE HC F+IN  NAT  D+  L + V   V  + G+ LE E+K +G+F
Sbjct: 252 AQVSEKHCGFVINRGNATAADVRTLMQNVADIVEEKFGVRLEPEVKMIGEF 302


>gi|49474454|ref|YP_032496.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella quintana
           str. Toulouse]
 gi|49239958|emb|CAF26363.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella quintana
           str. Toulouse]
          Length = 348

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 160/313 (51%), Positives = 212/313 (67%)

Query: 4   GRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIP 63
             +   L+     ++GK   N  ++++TWFRTGG AE+ +QP D  DL  FL  LP  I 
Sbjct: 36  EALLAQLQPALGDIKGKLTPNVDMRKVTWFRTGGLAELFYQPADEADLALFLKTLPEFIS 95

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           +TIVG+GSN+LVRD GI GVV+RLS  GF  ++  +    +VGA  +GK LA +AL   I
Sbjct: 96  VTIVGIGSNLLVRDGGIPGVVIRLSAKGFGQVQQVSPKRFLVGAATAGKHLAAAALEAEI 155

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            GFHF++GIPG +GGA  MNAGAN  ET+  VVEV+ +DRKG  H++    + Y YR   
Sbjct: 156 TGFHFYHGIPGGLGGALKMNAGANGIETAARVVEVYALDRKGRHHILSLADMHYSYRHCA 215

Query: 184 ITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
           I KD I T  +L G P +++ I AA+  V  HRETVQP++EKTGGSTF+NP   SAW++I
Sbjct: 216 IPKDFIFTAALLEGEPGNRDDIRAAMDEVALHRETVQPVREKTGGSTFRNPENISAWRVI 275

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           +++GCRGL+ GGA++SE+HCNFMIN   ATGYDLE LGE VR +VF  S  LL+WEI+R+
Sbjct: 276 DEAGCRGLQIGGAQMSEMHCNFMINTGQATGYDLEALGETVRARVFAHSAHLLQWEIQRI 335

Query: 304 GDFFDHQIVDATK 316
           G F   +IV +  
Sbjct: 336 GQFEQSRIVPSFG 348


>gi|51892349|ref|YP_075040.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Symbiobacterium
           thermophilum IAM 14863]
 gi|81389143|sp|Q67Q47|MURB2_SYMTH RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase 2;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase 2
 gi|51856038|dbj|BAD40196.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Symbiobacterium
           thermophilum IAM 14863]
          Length = 308

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 101/305 (33%), Positives = 156/305 (51%), Gaps = 9/305 (2%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PS 60
           +  R+  ++R+      G+ +   PLK+ T  R GG A+ + +  D H+L   L L    
Sbjct: 4   MAERLRSIIRD-----PGRIRRAEPLKRHTSVRIGGPADYLVEVADRHELSRLLRLAGEE 58

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
            +P+ I+G GSN++V D G+RG+VLRL+          +     VG  CS   LA+ A R
Sbjct: 59  ALPVYILGSGSNLVVSDEGVRGLVLRLTGEFARIAVDGSTVR--VGGGCSLPKLAHQASR 116

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
            G+GG  F   IPG++G    MNAGA+  + +Q V E   I   G    +   ++ + YR
Sbjct: 117 RGLGGLEFACAIPGTVGAGLVMNAGAHGGDMAQVVAEATVIWGDGRMERLCPGEIGFAYR 176

Query: 181 SSEITKDLIITHVVLR-GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
           S+ +     I   V+    P  +  +  A+    + R   QP++    GS FKNP G  A
Sbjct: 177 STRLQGTSAIVAEVVMALRPADRAALEGAMRQHLNRRRATQPLQYPNAGSVFKNPPGDYA 236

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LIE++G +G   G A++SE H NF++N   AT  D+  L ++VR  V  + G+ LE E
Sbjct: 237 GRLIEQAGLKGERVGDAQVSEKHANFIVNLGQATARDVLTLMDRVRSTVERRFGVRLEAE 296

Query: 300 IKRLG 304
           +K  G
Sbjct: 297 VKIWG 301


>gi|189183855|ref|YP_001937640.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Orientia
           tsutsugamushi str. Ikeda]
 gi|254765516|sp|B3CSQ9|MURB_ORITI RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|189180626|dbj|BAG40406.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Orientia
           tsutsugamushi str. Ikeda]
          Length = 303

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 126/294 (42%), Positives = 182/294 (61%), Gaps = 2/294 (0%)

Query: 14  GKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNI 73
             ++ G++++NF L  +TWF+ GG ++V ++P+D HDL YFL  L S+I IT++G GSN+
Sbjct: 7   LPKVNGEYRKNFKLSHLTWFKVGGISQVFYKPKDEHDLSYFLANLQSNIKITVLGAGSNL 66

Query: 74  LVRDAGIRGVVLRLSNAGF--SNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYG 131
           L+RD GI GV ++L  +    + ++  ++  + VGA      +A   L+H +GG  F  G
Sbjct: 67  LIRDNGIDGVTIKLGRSFNEINFVKNNHYNIISVGAGTLNYDVAKFCLQHNLGGLEFLVG 126

Query: 132 IPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIIT 191
           IPG+IGG   MNAGA   E    V  V  +DR GN+H+   + L ++YR   +   LI T
Sbjct: 127 IPGTIGGGIAMNAGAYGQEFKDVVYSVEALDRSGNKHIFLSKDLNFEYRQCIVNGFLIFT 186

Query: 192 HVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGL 251
              L  + +S+  IS  +  +   R+  QPI +KT GS F+N   + AWQLI+K G RG 
Sbjct: 187 KTNLICYNDSKPSISQKLQKIQTVRKLTQPINQKTAGSAFRNTNNYKAWQLIDKVGLRGH 246

Query: 252 EFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
             GGA++S LHCNF+IN  NAT  D+E LGE +RKKVF+ +GI LEWEIK +G 
Sbjct: 247 SIGGAQVSNLHCNFLINNGNATASDIENLGELIRKKVFDHTGITLEWEIKIVGK 300


>gi|115311588|sp|Q6G126|MURB_BARQU RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
          Length = 321

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 160/313 (51%), Positives = 212/313 (67%)

Query: 4   GRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIP 63
             +   L+     ++GK   N  ++++TWFRTGG AE+ +QP D  DL  FL  LP  I 
Sbjct: 9   EALLAQLQPALGDIKGKLTPNVDMRKVTWFRTGGLAELFYQPADEADLALFLKTLPEFIS 68

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           +TIVG+GSN+LVRD GI GVV+RLS  GF  ++  +    +VGA  +GK LA +AL   I
Sbjct: 69  VTIVGIGSNLLVRDGGIPGVVIRLSAKGFGQVQQVSPKRFLVGAATAGKHLAAAALEAEI 128

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            GFHF++GIPG +GGA  MNAGAN  ET+  VVEV+ +DRKG  H++    + Y YR   
Sbjct: 129 TGFHFYHGIPGGLGGALKMNAGANGIETAARVVEVYALDRKGRHHILSLADMHYSYRHCA 188

Query: 184 ITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
           I KD I T  +L G P +++ I AA+  V  HRETVQP++EKTGGSTF+NP   SAW++I
Sbjct: 189 IPKDFIFTAALLEGEPGNRDDIRAAMDEVALHRETVQPVREKTGGSTFRNPENISAWRVI 248

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           +++GCRGL+ GGA++SE+HCNFMIN   ATGYDLE LGE VR +VF  S  LL+WEI+R+
Sbjct: 249 DEAGCRGLQIGGAQMSEMHCNFMINTGQATGYDLEALGETVRARVFAHSAHLLQWEIQRI 308

Query: 304 GDFFDHQIVDATK 316
           G F   +IV +  
Sbjct: 309 GQFEQSRIVPSFG 321


>gi|87199157|ref|YP_496414.1| UDP-N-acetylmuramate dehydrogenase [Novosphingobium aromaticivorans
           DSM 12444]
 gi|123490035|sp|Q2G993|MURB_NOVAD RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|87134838|gb|ABD25580.1| UDP-N-acetylmuramate dehydrogenase [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 297

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 121/289 (41%), Positives = 175/289 (60%), Gaps = 1/289 (0%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
            +RGK   + PL  + WF++GG A+ +F+P+D+ DL+ FL  L  ++P+  +GLGSN++V
Sbjct: 8   SVRGKLTPDAPLAPLVWFKSGGTADWLFEPRDVADLQDFLAGLAPEVPVMALGLGSNLIV 67

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD G+ GVV+RL  A     +V            SG  ++++A  +GI G  F   IPG+
Sbjct: 68  RDGGVPGVVIRLGKAFAKVAKVDEVTLDCG-GGASGILVSSTARDNGIAGLEFLRSIPGT 126

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           +GG   MN GA   E    +V+   + R G    +P  +L Y YR S +T   I+     
Sbjct: 127 VGGFVRMNGGAYGREVKDVLVDCDVVIRSGEIVTLPLSELGYTYRHSNLTDGSIVVAARF 186

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           RG P +   I A +  +   RE  QP++ KTGGSTFKNP G  AW+L++K+GCRGL+ GG
Sbjct: 187 RGHPGNPEAIQAEMDRISAAREASQPLRSKTGGSTFKNPDGGKAWELVDKAGCRGLQIGG 246

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           A++SE H NF+IN   AT  ++E LGE+VR++V   SG+ LEWEIKR+G
Sbjct: 247 AQVSEKHTNFLINTGTATSAEIEGLGEEVRRRVKASSGVDLEWEIKRIG 295


>gi|146296184|ref|YP_001179955.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|187609714|sp|A4XIM9|MURB_CALS8 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|145409760|gb|ABP66764.1| UDP-N-acetylmuramate dehydrogenase [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 310

 Score =  219 bits (558), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 88/302 (29%), Positives = 140/302 (46%), Gaps = 7/302 (2%)

Query: 9   LLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIV 67
                 ++L  +F ++ PLK  T F+ GG A  +  P++I +L   + L+    I   IV
Sbjct: 2   KFERGLEKLNIEFLKDKPLKDFTTFKIGGKARYIVFPKNIDELIEIIKLVKESGINWRIV 61

Query: 68  GLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFH 127
           G  SN+LV D G  G ++  +              +     C    +A  A  +G+ G  
Sbjct: 62  GNCSNVLVSDKGFDGAIITTTKMD---FFKTEENLIEAECGCMISQVARKACENGLKGLE 118

Query: 128 FFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD 187
           F  GIPG++GGA YMNAGA + E          +D   N   + +  +++ YR S + ++
Sbjct: 119 FAVGIPGTVGGAVYMNAGAYDSEIKDVFECAEVLDEDLNIFKLGKSDMRFSYRHSRLKEE 178

Query: 188 LIIT---HVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIE 244
            +I       L+   E               R   QP++  + GS FK P G+ A +LIE
Sbjct: 179 KLILLKATFRLQYAREEDVPPIEKANEYNQRRREKQPLQYPSAGSIFKRPPGNFAGKLIE 238

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            +G +G   G A IS  H  F++N  +A   D+  L    +K V+ + G+LLE EI+ +G
Sbjct: 239 DAGLKGYRVGNACISGKHAGFIVNLGDALAEDVRKLIYHTQKSVYEKFGVLLEPEIEFIG 298

Query: 305 DF 306
           +F
Sbjct: 299 EF 300


>gi|116872853|ref|YP_849634.1| UDP-N-acetylenolpyruvylglucosamine reductase [Listeria welshimeri
           serovar 6b str. SLCC5334]
 gi|123466273|sp|A0AIM3|MURB_LISW6 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|116741731|emb|CAK20855.1| UDP-N-acetylenolpyruvylglucosamine reductase [Listeria welshimeri
           serovar 6b str. SLCC5334]
          Length = 297

 Score =  219 bits (558), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 100/301 (33%), Positives = 158/301 (52%), Gaps = 7/301 (2%)

Query: 7   SRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPIT 65
              L+++   +    + N PL + T+ +TGGNA++   P+ I + +  ++    + IP+T
Sbjct: 1   MNNLQKQFPHIS--IKLNEPLSKYTYTKTGGNADIFVMPKSIEETQEIVSYCYQNTIPLT 58

Query: 66  IVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGG 125
           ++G GSN++++D GIRGV++ L          R + ++I  +       A  AL   + G
Sbjct: 59  VLGNGSNLIIKDGGIRGVIVHLDLLQTI---ERKNTQIIAMSGAKLIDTAKFALGESLSG 115

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI- 184
             F  GIPGSIGGA +MNAGA   E S  +     +   G    + R +LK  YR S I 
Sbjct: 116 LEFACGIPGSIGGALHMNAGAYGGEISDVLEAATVLTPYGELKKLKRSELKAAYRFSTIA 175

Query: 185 TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIE 244
            K+ I+         E +NII A +  +   RE+ QP++  + GS FK P GH A +LI+
Sbjct: 176 EKNYIVLDATFSLELEDKNIIQAKMDELTAARESKQPLEYPSCGSVFKRPPGHFAGKLIQ 235

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            SG +G   GGA++S  H  F++N  NAT  D   L   V++ V  +  + LE E+K +G
Sbjct: 236 DSGLQGHIIGGAQVSLKHAGFIVNIGNATATDYMNLIAHVQQTVREKFDVELETEVKIIG 295

Query: 305 D 305
           +
Sbjct: 296 E 296


>gi|22537270|ref|NP_688121.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           agalactiae 2603V/R]
 gi|25011230|ref|NP_735625.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           agalactiae NEM316]
 gi|76788612|ref|YP_329818.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           agalactiae A909]
 gi|76797915|ref|ZP_00780177.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           agalactiae 18RS21]
 gi|77405843|ref|ZP_00782926.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           agalactiae H36B]
 gi|77408717|ref|ZP_00785449.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           agalactiae COH1]
 gi|77410500|ref|ZP_00786861.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           agalactiae CJB111]
 gi|77413034|ref|ZP_00789236.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           agalactiae 515]
 gi|54037853|sp|P65465|MURB_STRA5 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|54041503|sp|P65464|MURB_STRA3 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|109915414|sp|Q3K0Y5|MURB_STRA1 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|22534138|gb|AAM99993.1|AE014242_22 UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           agalactiae 2603V/R]
 gi|23095654|emb|CAD46838.1| Unknown [Streptococcus agalactiae NEM316]
 gi|76563669|gb|ABA46253.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           agalactiae A909]
 gi|76586752|gb|EAO63248.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           agalactiae 18RS21]
 gi|77160932|gb|EAO72041.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           agalactiae 515]
 gi|77163448|gb|EAO74398.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           agalactiae CJB111]
 gi|77172692|gb|EAO75829.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           agalactiae COH1]
 gi|77175553|gb|EAO78339.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           agalactiae H36B]
 gi|319745102|gb|EFV97427.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus agalactiae ATCC
           13813]
          Length = 300

 Score =  219 bits (558), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 91/300 (30%), Positives = 149/300 (49%), Gaps = 6/300 (2%)

Query: 9   LLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITI 66
           +++   K+L G   + + PLK+ T+ + GG A+ +  P++  +L   +      +IP  +
Sbjct: 1   MIKTIQKELEGLDIRFDEPLKKYTYTKVGGPADYLAFPRNRLELSRIVKFANSQNIPWMV 60

Query: 67  VGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGF 126
           +G  SNI+VRD GIRG V+         +   N   +   A  +       A  H + GF
Sbjct: 61  LGNASNIIVRDGGIRGFVIMFDKLSTVTV---NGYVIEAEAGANLIETTRIARYHSLTGF 117

Query: 127 HFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK 186
            F  GIPGS+GGA +MNAGA   E +  ++    +  +G    I    +++ YR S I +
Sbjct: 118 EFACGIPGSVGGAVFMNAGAYGGEIAHILLSAQVLTPQGELKTIEARNMQFGYRHSVIQE 177

Query: 187 -DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEK 245
              I+        P    +I+  +  + + RE  QP++  + GS FK P GH A QLI +
Sbjct: 178 SGDIVISAKFALKPGDHLMITQEMDRLTYLRELKQPLEYPSCGSVFKRPPGHFAGQLISE 237

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +  +G   GG ++S+ H  FM+N    +  D E L E V   V + SG+ LE E++ +G+
Sbjct: 238 AHLKGQRIGGVEVSQKHAGFMVNIAEGSAQDYENLIEHVINTVESTSGVHLEPEVRIIGE 297


>gi|325662597|ref|ZP_08151197.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lachnospiraceae
           bacterium 4_1_37FAA]
 gi|325471094|gb|EGC74320.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lachnospiraceae
           bacterium 4_1_37FAA]
          Length = 303

 Score =  219 bits (558), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 106/305 (34%), Positives = 160/305 (52%), Gaps = 6/305 (1%)

Query: 6   ISRLLRERGKQL--RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DI 62
           + +   +   QL        + PLK    FR GG A+    P+   +++  + L     +
Sbjct: 1   MKKEFYDALIQLTEEKNVLTDEPLKNHVTFRVGGAADYFVSPESAEEVQKIILLCKEAGM 60

Query: 63  PITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHG 122
           P  I+G GSN+LV D G RGV++++  +            +   A     ++A  A    
Sbjct: 61  PYYILGNGSNLLVSDQGYRGVIIQIYKSMSEI--SVKGEFVTAQAGALLSAIAAKAAGES 118

Query: 123 IGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS 182
           + GF F  GIPG+IGGAA MNAGA   E    + +V  + ++G    IPRE+L   YR+S
Sbjct: 119 LAGFEFASGIPGTIGGAAVMNAGAYGGEMKDVLEQVTVLTKEGELLTIPREELDMGYRTS 178

Query: 183 EITKDLII-THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
           ++ K+  I    V+      Q  I   +  +   R T QP++  + GSTFK P G+ A +
Sbjct: 179 KVAKNQYIVLEAVIHLAHGEQEKIREKMNELKEKRTTKQPLEYPSAGSTFKRPEGYFAGK 238

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           LIE++G RG + GGA++SE HC F+IN DNAT  ++  L  QV ++V   SG+ LE E+K
Sbjct: 239 LIEEAGLRGFQVGGAQVSEKHCGFVINKDNATAAEVRELIRQVSERVKANSGVTLEPEVK 298

Query: 302 RLGDF 306
            LG+F
Sbjct: 299 MLGEF 303


>gi|167647624|ref|YP_001685287.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Caulobacter sp. K31]
 gi|189028919|sp|B0T826|MURB_CAUSK RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|167350054|gb|ABZ72789.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Caulobacter sp. K31]
          Length = 307

 Score =  219 bits (558), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 127/302 (42%), Positives = 174/302 (57%), Gaps = 9/302 (2%)

Query: 11  RERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLG 70
           + +   +RGK   +  L   TWFR GG A+V+F P D  DL  FL  L   +P+  +G+G
Sbjct: 4   KTQLPPVRGKLLVDEALAPFTWFRVGGPADVVFLPADEQDLADFLKALDPAVPVLAIGVG 63

Query: 71  SNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFY 130
           SN+LVRD G+ GVV+RL   GF+ +E      +  G+      LA  A   GI G  F+ 
Sbjct: 64  SNLLVRDGGVEGVVIRLGK-GFNTVEALGDNRIKAGSAVPDAILARKAAEAGIAGLEFYA 122

Query: 131 GIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLI 189
           GIPG++GGA  MNAG    ET+  ++    +DR+G    +   +L + YR S +    LI
Sbjct: 123 GIPGTVGGATIMNAGCYGSETANILISARVMDRRGQVRELTAAELHFTYRHSALQDAGLI 182

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
           +   V  G  +    I A +A +   RET QPI+EKTGGSTFKNP GHS+W+L++++G R
Sbjct: 183 VLDAVFEGLADDPAAIKARMAEITSRRETTQPIREKTGGSTFKNPPGHSSWKLVDEAGWR 242

Query: 250 GLEF-------GGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           G  F       GGA  S LH NF+IN   AT  DLE LG+ VR  V  ++G+ L+WEIKR
Sbjct: 243 GKRFSASGKEGGGAMFSPLHSNFLINTGEATAADLEGLGDTVRADVLAKTGVQLDWEIKR 302

Query: 303 LG 304
           +G
Sbjct: 303 IG 304


>gi|332976295|gb|EGK13153.1| UDP-N-acetylmuramate dehydrogenase [Desmospora sp. 8437]
          Length = 302

 Score =  219 bits (557), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 87/288 (30%), Positives = 151/288 (52%), Gaps = 5/288 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAG 79
            + N PL + T ++ GG A+++  P D  +L+  ++++    +P  ++G GSN+LVRD G
Sbjct: 16  VRINEPLSRHTTWKVGGPADLLVYPADKGELERAMSVIRKHGLPWRVIGRGSNLLVRDGG 75

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRG V+++ N             +  G   S   L+    RHG+ G  F  GIPG++GGA
Sbjct: 76  IRGAVIKMGNGLD--HLQVEGDRVTAGGGYSFVKLSVMVARHGLTGLEFAGGIPGTVGGA 133

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHV--VLRG 197
            +MNAGA+  E  + + +   +   G   V   E+L++ YR+S + K+          + 
Sbjct: 134 VFMNAGAHGAEVCEVLEKAEVLLENGEWAVFHNEELQFSYRTSILQKERRGVVTEATFQL 193

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
              ++  ++A +A     R   QP++++  GS F+NP G  + +LIE +G +G   G A+
Sbjct: 194 KEGNREEVAAVMARFKDRRRQTQPLQDRCAGSVFRNPPGDHSGRLIEAAGLKGYRIGDAE 253

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S  H NF+IN  NAT  D+  L   +   +  + G+ L  E++ +G+
Sbjct: 254 VSTRHANFIINRGNATANDVLTLIRHIIGTIEQKYGVTLVPEVQVVGE 301


>gi|332982391|ref|YP_004463832.1| UDP-N-acetylmuramate dehydrogenase [Mahella australiensis 50-1 BON]
 gi|332700069|gb|AEE97010.1| UDP-N-acetylmuramate dehydrogenase [Mahella australiensis 50-1 BON]
          Length = 305

 Score =  219 bits (557), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 95/307 (30%), Positives = 151/307 (49%), Gaps = 6/307 (1%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-P 59
           M   +I RLL      +    + + P+K  T F+ GG A++   P  ++++   L +   
Sbjct: 1   MDKEQIYRLLCTEIDPV--NIKVDEPMKAHTSFKIGGPADIFVTPDKLNEIYGVLRICGE 58

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
             +P+ ++G G+++LV D GIRGVV+++++          +  + V +      L     
Sbjct: 59  HGVPLLVMGNGTDLLVLDGGIRGVVMQIAHKWAKV--DIENTLVTVQSGILLSRLCRVLA 116

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
           + G+GG  F  GIPG++GGA  MNAGA   E    V  VH ID  GN      E+LKY Y
Sbjct: 117 KRGLGGMEFAAGIPGTLGGALVMNAGAYGGEMKDVVQSVHAIDANGNDRWFRSEELKYGY 176

Query: 180 RSSEITKDLIIT-HVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           RSS             L   P    +    I ++   R   QP++  + GS FK P G  
Sbjct: 177 RSSIFRNGRYTLLEAKLCLEPREPQVCMDNINDLNLRRRAKQPLEYPSAGSVFKRPCGCY 236

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
              +IE++G +G+  G A++SE H  F+IN  NAT  D+  L   V++++     + LE 
Sbjct: 237 VGPMIEQAGLKGMCVGDAQVSEKHAGFIINRGNATAKDVLELINIVKQRIKELFAVELEL 296

Query: 299 EIKRLGD 305
           EI+ +G+
Sbjct: 297 EIQVVGE 303


>gi|160893087|ref|ZP_02073875.1| hypothetical protein CLOL250_00632 [Clostridium sp. L2-50]
 gi|156865170|gb|EDO58601.1| hypothetical protein CLOL250_00632 [Clostridium sp. L2-50]
          Length = 302

 Score =  219 bits (557), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 98/291 (33%), Positives = 149/291 (51%), Gaps = 4/291 (1%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVR 76
             + +   PL + T FR GG A+ M +P+    +   + L    ++P  I+G GSN+LV 
Sbjct: 14  ENRIKTKEPLNRYTTFRIGGEADFMAEPEKPEQIAELVDLCKEENVPFFIMGNGSNLLVS 73

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G RG+++ +++     +       +   A  S    A +A +H + G  F  GIPGS+
Sbjct: 74  DNGYRGMIIHIADGMSKIMVD--GTRITAQAGASLIKAAVTAKQHELTGMEFASGIPGSV 131

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL-IITHVVL 195
           GGA YMNAGA   E    +  V  +D+ G  + I    +++ YR S+  KD  ++     
Sbjct: 132 GGAVYMNAGAYGGEMKHIISSVKVLDQNGQIYDISGSDMEFGYRHSKAEKDGLVVLEAEF 191

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
                    I A +  +   R + QP++  + GSTFK P G+ A +LI  +G RG   GG
Sbjct: 192 ELQTGDAAQIDAEMKRLAESRISKQPLEYPSAGSTFKRPEGYFAGKLIMDAGLRGYTVGG 251

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           A++SE HC F++N   AT  D+  L   V+K V + SG+ LE EIK LG F
Sbjct: 252 AQVSEKHCGFVVNKGGATAADVMQLVNDVKKMVKDSSGVDLELEIKTLGAF 302


>gi|312134279|ref|YP_004001617.1| udp-n-acetylenolpyruvoylglucosamine reductase [Caldicellulosiruptor
           owensensis OL]
 gi|311774330|gb|ADQ03817.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Caldicellulosiruptor
           owensensis OL]
          Length = 317

 Score =  219 bits (557), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 87/306 (28%), Positives = 137/306 (44%), Gaps = 7/306 (2%)

Query: 5   RISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IP 63
            I        K L  +F ++ PLK  T F+ GG A  +  P++   L   LTL   + I 
Sbjct: 1   MIKMEFELYLKNLNIEFLKDHPLKDFTTFKIGGKARYIVFPRNTKQLVEVLTLAKDEAIN 60

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
             +VG  SN+L+ D G       +      +    +   +          +A  A   G+
Sbjct: 61  YIVVGNCSNVLISDKGF---NGAIITTVKIDSFKIDGNLIEADCGAMLSQVARKACEKGL 117

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            G  F  GIPG++GGA YMNAGA + E          +D+  N   + + ++K+ YR S 
Sbjct: 118 KGLEFAVGIPGTVGGAVYMNAGAYDGEIKDVFEWAEVLDKNLNILKLSKSEMKFSYRHSR 177

Query: 184 ITKDLIIT---HVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
           + ++ ++       L    +               R   QP+   + GS FK P  + A 
Sbjct: 178 LKEEKMVLLRAVFSLEFASKEDISPLQKAIEFSKRRREKQPLSYPSAGSVFKRPPNNFAG 237

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LIE +  +G   GGA ISE H  F++N ++A   D+  L    +K V+ + GILLE EI
Sbjct: 238 KLIEDASLKGYRIGGACISEKHAGFIVNVEDAKAEDVRKLIYLAQKTVYEKFGILLEPEI 297

Query: 301 KRLGDF 306
           + +G+F
Sbjct: 298 QFIGEF 303


>gi|302873285|ref|YP_003841918.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           cellulovorans 743B]
 gi|307688548|ref|ZP_07630994.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           cellulovorans 743B]
 gi|302576142|gb|ADL50154.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           cellulovorans 743B]
          Length = 305

 Score =  219 bits (557), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 96/306 (31%), Positives = 158/306 (51%), Gaps = 7/306 (2%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD 61
           +Y   ++ L     +     + N  +K  T F+ GG+ +++  P +I ++   + L  +D
Sbjct: 3   VYKDFAKKLGSVLDK--ENIKVNEYMKNHTSFKVGGSVDILVTPTNIEEIIEVIKLCKAD 60

Query: 62  -IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
            IP  ++G GSN+L++D GIRGVV++L       +   N  E+ V +    K L+ +AL 
Sbjct: 61  RIPFFVMGNGSNLLIKDGGIRGVVIKLEKLNHVEV---NGNEIKVESGVLMKDLSKAALE 117

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             + G  F  GIPG++GGA  MNAGA N E    +     +D  G    +   +L+  YR
Sbjct: 118 ARLTGLEFICGIPGTVGGAIAMNAGAYNGEIKDVIDSAVVLDEDGKILTLTNRELELGYR 177

Query: 181 SSE-ITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
           +S  + +  I           + + I A I ++   RE  QP++  + GSTFK PTG+ A
Sbjct: 178 TSSVLKRHYIALSATFILKNGNYDEIKAIIDDLTRRREEKQPLEYASAGSTFKRPTGYFA 237

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LI+ SG +G   G A++SE H  F+IN   AT  D+  +   V+K V  +  + LE E
Sbjct: 238 GKLIQDSGLKGYSVGDAQVSEKHSGFVINKGTATAKDVLAVIAHVQKVVKEKFSVELETE 297

Query: 300 IKRLGD 305
           ++ +G+
Sbjct: 298 VRIMGE 303


>gi|239947810|ref|ZP_04699563.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia
           endosymbiont of Ixodes scapularis]
 gi|239922086|gb|EER22110.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia
           endosymbiont of Ixodes scapularis]
          Length = 305

 Score =  219 bits (557), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 133/292 (45%), Positives = 183/292 (62%), Gaps = 1/292 (0%)

Query: 13  RGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSN 72
               ++G++++++ LK +TWF+ GGNAE+ F+P D  DL  FL      +PIT  G GSN
Sbjct: 3   ILPIVKGEYKKDYNLKHLTWFKVGGNAEIFFKPLDSEDLASFLIQNKQKLPITTFGAGSN 62

Query: 73  ILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGI 132
           I++RD  I GVV++L    FSNIE  +   ++VG+ C   +LA     + I GF F  GI
Sbjct: 63  IIIRDGSIEGVVIKL-GQNFSNIEFIDDNHLVVGSSCLNYNLAKFCQVNAISGFEFLVGI 121

Query: 133 PGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITH 192
           PG+IGG   MNAGA + E    +V++  ID  GN      E++ ++YRS+ + KDLII  
Sbjct: 122 PGTIGGGVAMNAGAYDSEFKDIIVKIEAIDFAGNFRAFTNEEIGFKYRSNNLPKDLIILK 181

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
            V +        I   +  + + R + QPIKE+TGGSTF NP G  +W+LI+K+G RG  
Sbjct: 182 AVFKINKGDSENILLRMNEINNARSSTQPIKERTGGSTFANPEGLKSWELIDKAGLRGYR 241

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            GGA +SELHCNFMIN  +AT  DLE LG+ VR+KVF  SG+ LEWEIKR+G
Sbjct: 242 IGGASMSELHCNFMINNGDATAKDLEDLGDFVRQKVFENSGVKLEWEIKRIG 293


>gi|322373441|ref|ZP_08047977.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sp. C150]
 gi|321278483|gb|EFX55552.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sp. C150]
          Length = 300

 Score =  219 bits (557), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 95/300 (31%), Positives = 148/300 (49%), Gaps = 6/300 (2%)

Query: 9   LLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITI 66
           +L E  K L G   + N PLK+ T+ + GG A+ +  P++ ++L   +       IP  +
Sbjct: 1   MLDELKKDLVGIDIRFNEPLKRYTYTKVGGPADYLAFPRNRYELSRIVKFANKQGIPWMV 60

Query: 67  VGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGF 126
           +G  SN++VRD GIRG V+         +   N  ++   A  +  +    A    + GF
Sbjct: 61  LGNASNLIVRDGGIRGFVIMFDKLNGIAV---NGYQIEAEAGANLIATTKVARFQSLTGF 117

Query: 127 HFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK 186
            F  GIPGS+GGA +MNAGA   E +  +V    + + G+   I    +++ YR S + +
Sbjct: 118 EFAAGIPGSVGGAVFMNAGAYGGEIAHILVSAQVLTKDGDIRTIAARDMRFGYRRSVLQE 177

Query: 187 -DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEK 245
              ++        P   + I   +  + H RE  QP++  + GS FK P GH A QLI +
Sbjct: 178 TGEVVISAKFNLHPGDYHQIKNEMNRLNHLRELKQPLEYPSCGSVFKRPPGHFAGQLITE 237

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +  +G   GG ++S  H  FM+N D  T  D E L   V  KV   SG+ LE E++ +GD
Sbjct: 238 ANLKGHRIGGVEVSTKHAGFMVNVDQGTAKDYEDLIADVIAKVKENSGVTLEPEVRIIGD 297


>gi|15604118|ref|NP_220633.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia
           prowazekii str. Madrid E]
 gi|3860810|emb|CAA14710.1| UDP-N-ACETYLENOLPYRUVOYLGLUCOSAMINE REDUCTASE (murB) [Rickettsia
           prowazekii]
 gi|292571844|gb|ADE29759.1| UDP-N-acetylenol pyruvoyl glucosamine reductase [Rickettsia
           prowazekii Rp22]
          Length = 310

 Score =  218 bits (556), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 132/311 (42%), Positives = 182/311 (58%), Gaps = 7/311 (2%)

Query: 1   MIYGRISRLLRE-----RGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFL 55
           MI   + +L  E         ++G++++++ LK +TWF+ GGNAE+ F+P D  DLK FL
Sbjct: 1   MIQNPMIKLCNESNNMSILPIIKGEYKKDYNLKHLTWFKVGGNAEIFFKPFDFADLKSFL 60

Query: 56  TLLPSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLA 115
                 +PIT  G GSNI++RD GI GVV++L         +     +IVG+ C   +LA
Sbjct: 61  IQNKQKLPITTFGSGSNIIIRDGGIEGVVIKLGQNFNKIEFLD--NHLIVGSSCLNYNLA 118

Query: 116 NSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQL 175
                + I GF F  GIPG+IGG   MNAGA        +V+V  +D  GN      +++
Sbjct: 119 RFCQANAISGFEFLVGIPGTIGGGVIMNAGAYGSAFQDIIVQVEALDFSGNFLTFTNKEI 178

Query: 176 KYQYRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPT 235
            ++YR + + KDLI+   V +        I   +  + + R + QPIKE+TGGSTF NP 
Sbjct: 179 GFKYRGNNLPKDLILLKAVFKVNKGDSQNILLKMNKINNTRSSTQPIKERTGGSTFINPE 238

Query: 236 GHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGIL 295
           G  +W+LI+K+G RG   GGA ISELHCNFMIN  NAT  DLE LG  VR+KVF  SG+ 
Sbjct: 239 GRKSWELIDKAGLRGYRIGGASISELHCNFMINNGNATAKDLEDLGNFVRQKVFEDSGVE 298

Query: 296 LEWEIKRLGDF 306
           L WEIKR+G +
Sbjct: 299 LNWEIKRIGKY 309


>gi|166031416|ref|ZP_02234245.1| hypothetical protein DORFOR_01105 [Dorea formicigenerans ATCC
           27755]
 gi|166028821|gb|EDR47578.1| hypothetical protein DORFOR_01105 [Dorea formicigenerans ATCC
           27755]
          Length = 303

 Score =  218 bits (556), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 102/290 (35%), Positives = 151/290 (52%), Gaps = 4/290 (1%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVR 76
           +     + P+ + T FR GG A+    P+   +++  + +     +P  I+G GSN+LV 
Sbjct: 15  KDSILIDEPMSRHTTFRVGGPADFFVTPKAKEEVRDVIRICKEAGMPYYIIGNGSNLLVS 74

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           DAG RGV++++               +   A      +A  AL   + GF F  GIPG+I
Sbjct: 75  DAGYRGVIVQIYKEMNEVKV--EGDLVKAQAGALLSGIAAKALGAELSGFEFASGIPGTI 132

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVL 195
           GGA  MNAGA   E    +  V  +  +G    + R +L+  YR+S I  K  I+   VL
Sbjct: 133 GGACVMNAGAYGGEMKDVLEFVTVLTGEGKIIELGRNELELGYRTSVIAKKGYIVLGAVL 192

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           +        I   +  +   R T QP++  + GSTFK P G+ A +LIE +G RG + GG
Sbjct: 193 KLERGDGEKIKTYMDELKEKRVTKQPLEYPSAGSTFKRPEGYFAGKLIEDAGLRGFQVGG 252

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           A++SE HC F+IN D+AT  D+  L  QV+ +V   SG+ LE E+KRLGD
Sbjct: 253 AQVSEKHCGFVINRDHATAADIMELMRQVQIRVKENSGVDLEPEVKRLGD 302


>gi|313637866|gb|EFS03196.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria seeligeri
           FSL S4-171]
          Length = 298

 Score =  218 bits (556), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 98/301 (32%), Positives = 154/301 (51%), Gaps = 7/301 (2%)

Query: 7   SRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPIT 65
              ++ +   +    + N PL   T+ +TGGNA++   P+ I + +  ++    ++IP+T
Sbjct: 1   MNDIQAKFPHIS--IKLNEPLSNYTYTKTGGNADIFVMPKTIEETQAIVSYCYQNNIPLT 58

Query: 66  IVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGG 125
           I+G GSN++++D GIRGV++ L          RN+ ++I  +       A  AL   + G
Sbjct: 59  ILGNGSNLIIKDGGIRGVIVHLDLLQSIK---RNNTQVIAMSGAKLIDTAKFALDESLSG 115

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI- 184
             F  GIPGSIGGA +MNAGA   E S  +     + + G    + R +LK  YR S I 
Sbjct: 116 LEFACGIPGSIGGALHMNAGAYGGEISDVLEAATVLTQAGELKKLKRSELKAAYRFSTIA 175

Query: 185 TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIE 244
            K  I+         + +N I   +  +   RE  QP++  + GS FK P GH A +LI+
Sbjct: 176 EKKYIVLEATFALQLDDKNTIQVKMDELTAAREAKQPLEYPSCGSVFKRPPGHFAGKLIQ 235

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            SG +G   GGA++S  H  F++N   AT  D   L   V+K V  +  + LE E+K +G
Sbjct: 236 DSGLQGHIIGGAQVSSKHAGFIVNIGGATATDYMNLIAHVQKTVREKFDVELETEVKIIG 295

Query: 305 D 305
           +
Sbjct: 296 E 296


>gi|319408822|emb|CBI82479.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella
           schoenbuchensis R1]
          Length = 325

 Score =  218 bits (556), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 164/307 (53%), Positives = 218/307 (71%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPIT 65
           +   L+   K +RGKF  N  ++++TWFRTGG AE+ +QP D  DL  FL +LP  IPIT
Sbjct: 12  LLAQLQPALKNIRGKFTPNVEMRKVTWFRTGGLAELFYQPSDEADLALFLQVLPESIPIT 71

Query: 66  IVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGG 125
           IVG+GSN+LVRD G+ GVV+RLS  GF  +E  +   ++VGA  + K LA +AL   + G
Sbjct: 72  IVGIGSNLLVRDGGVPGVVIRLSAKGFGQLEQVSPKHLLVGAATADKHLAAAALEAELSG 131

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT 185
           FHF+YGIPG++GGA  MNAGAN  ET++ VVEV+ +DRKG +HV+    + Y YR   ++
Sbjct: 132 FHFYYGIPGNLGGALKMNAGANGIETAERVVEVYALDRKGERHVLSVNDMHYSYRHCNVS 191

Query: 186 KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEK 245
           ++LI T  VL G P +++ I AA+  V  HRE VQP++EKTGGSTF+NP G SAW++I++
Sbjct: 192 EELIFTAAVLEGKPGNKDNIHAAMNEVVLHREKVQPVREKTGGSTFRNPKGTSAWRVIDE 251

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +GCRGL+ GGA++S++HCNFMIN   ATGYDLE LGE VR +VF  S   LEWEI+RLG 
Sbjct: 252 AGCRGLQIGGAQMSKMHCNFMINTGEATGYDLEQLGETVRARVFAHSAHYLEWEIQRLGQ 311

Query: 306 FFDHQIV 312
           F    IV
Sbjct: 312 FEQDHIV 318


>gi|320120630|gb|EFE28006.2| UDP-N-acetylmuramate dehydrogenase [Filifactor alocis ATCC 35896]
          Length = 311

 Score =  218 bits (556), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 102/307 (33%), Positives = 166/307 (54%), Gaps = 6/307 (1%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    I ++L+   K+   +  E   +K+ T FR GG+A+ +  P  I +L+  + +L  
Sbjct: 8   MNRQEIRKMLKTVLKE--DQISEKESMKKHTSFRIGGDADFLVLPSSIAELQQLMRMLNE 65

Query: 61  D-IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
             IP  ++G G+N+LVRD GIR VV++L+    +        ++   A  S  +L+   L
Sbjct: 66  KQIPFFVMGNGTNLLVRDKGIRSVVIKLARNISNY--GIRGTDIFAEAGLSLSALSRIIL 123

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
              + GF F  GIPG++GGA  MNAGA   E    V  V  +D KG    +  E +++ Y
Sbjct: 124 EEELTGFEFASGIPGTVGGAMVMNAGAYGGEMKDIVKSVLVMDEKGLIFEMKGEDMEFGY 183

Query: 180 RSSEITKDLI-ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R+S ++K  + +          ++  I   + +    R T QPI+E + GSTFK P G+ 
Sbjct: 184 RTSILSKQRLLVLGATFSLEKGNRQEIQEKMDDYALRRNTKQPIQEASAGSTFKRPEGYF 243

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LIE SG RG+   GA++S+LHC F+IN  +AT  D+  L   ++K V+++  + LE 
Sbjct: 244 AGKLIEDSGLRGVSHRGAQVSQLHCGFVINKGDATCEDVLELINMIKKTVYDKFQVSLEE 303

Query: 299 EIKRLGD 305
           E++ +G+
Sbjct: 304 EVRLVGE 310


>gi|16078587|ref|NP_389406.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|221309397|ref|ZP_03591244.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|221313722|ref|ZP_03595527.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus subtilis
           subsp. subtilis str. NCIB 3610]
 gi|221318646|ref|ZP_03599940.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus subtilis
           subsp. subtilis str. JH642]
 gi|221322919|ref|ZP_03604213.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus subtilis
           subsp. subtilis str. SMY]
 gi|321315288|ref|YP_004207575.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus subtilis
           BSn5]
 gi|140583|sp|P18579|MURB_BACSU RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|142833|gb|AAA83969.1| ORF2 [Bacillus subtilis]
 gi|1195557|gb|AAB35538.1| orf2 3' of murG=putative UDP-N-acetylenolpyruvoylglucosamine
           reductase [Bacillus subtilis, Peptide, 303 aa]
 gi|2633894|emb|CAB13396.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|291484074|dbj|BAI85149.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus subtilis
           subsp. natto BEST195]
 gi|320021562|gb|ADV96548.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus subtilis
           BSn5]
          Length = 303

 Score =  218 bits (556), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 97/302 (32%), Positives = 161/302 (53%), Gaps = 5/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           + ++++E  ++  GK   N PL   T  + GG A+V+  P  +  +K  + ++   D+  
Sbjct: 1   MEKVIQELKEREVGKVLANEPLANHTTMKIGGPADVLVIPSSVDAVKDIMDVIKKYDVKW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T++G GSN+LV D GIRGVV++L              ++ VG   S   LA S  + G+ 
Sbjct: 61  TVIGRGSNLLVLDEGIRGVVIKLGAGLD--HLELEGEQVTVGGGYSVVRLATSLSKKGLS 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA+  + S+ +V+ H +   G    +  EQ+ + YR+S +
Sbjct: 119 GLEFAAGIPGSVGGAVYMNAGAHGSDMSEILVKAHILFEDGTIEWLTNEQMDFSYRTSVL 178

Query: 185 TKDLIITHVVL--RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
            K      +    +   + +  I   + +   +R+  QP      GS F+NP  + A  L
Sbjct: 179 QKKRPGVCLEAVLQLEQKDKESIVQQMQSNKDYRKNTQPYSSPCAGSIFRNPLPNHAGNL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           +EK+G +G + GGAKISE+H NF++NA  A+  D+  L + V+K +  +  I +  E++ 
Sbjct: 239 VEKAGLKGYQIGGAKISEMHGNFIVNAGGASAKDVLDLIDHVKKTIREKYEIDMHTEVEI 298

Query: 303 LG 304
           +G
Sbjct: 299 IG 300


>gi|310642986|ref|YP_003947744.1| udp-n-acetylenolpyruvoylglucosamine reductase [Paenibacillus
           polymyxa SC2]
 gi|309247936|gb|ADO57503.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Paenibacillus
           polymyxa SC2]
          Length = 301

 Score =  218 bits (556), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 98/289 (33%), Positives = 148/289 (51%), Gaps = 4/289 (1%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRD 77
           GK  E+ PL + T ++ GG A+ +  P     L   L L     IP   +G GSN+LV D
Sbjct: 14  GKVLEHEPLSKYTTWKIGGPADALVIPDTKEQLAKILKLASEHGIPWMQLGRGSNMLVSD 73

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            GIRG+V++L              +++ G   S   L   A + G+ G  F  GIPGS+G
Sbjct: 74  KGIRGLVIKLGPGFD--YVRFEDEQIVAGGGVSLVKLCVMASKQGLSGLEFAGGIPGSVG 131

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL-IITHVVLR 196
           GA YMNAGA+  + SQ       +   G   V   E + + YR S + +   ++T  V +
Sbjct: 132 GAVYMNAGAHGSDVSQIFQSAEIVLDTGELAVYNAEDMHFSYRHSVLHEQRGMVTEAVFQ 191

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
                +  ISAA+A     R   QP++    GS F+NP G  A +LIE +G +GL+ GGA
Sbjct: 192 MKRGDREEISAALAAFKDRRRLTQPLQLACAGSVFRNPPGDYAARLIESAGLKGLKAGGA 251

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           ++S  H NF++N   AT  D+  L + ++  + +Q+GI L  E+  +G+
Sbjct: 252 EVSVQHANFIVNTGQATAEDVLTLMKHIQSTISSQTGIKLVPEVFVVGE 300


>gi|300112945|ref|YP_003759520.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrosococcus
           watsonii C-113]
 gi|299538882|gb|ADJ27199.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrosococcus
           watsonii C-113]
          Length = 299

 Score =  218 bits (555), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 97/292 (33%), Positives = 143/292 (48%), Gaps = 1/292 (0%)

Query: 14  GKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNI 73
               RG+ Q +  +   T +R GG A  +++P    DL  FL  LP D P+  +GLGSN+
Sbjct: 7   IPSARGRLQHHVAMANHTSWRVGGPARCLYRPAGRDDLITFLRFLPRDEPLFWLGLGSNL 66

Query: 74  LVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           LVRD GI G V+ ++ A  + IE R    + V A      LA    R G+ G  F  GIP
Sbjct: 67  LVRDGGISGTVIAIAGAL-NKIERRTVTTVWVEAGVPCAKLAKFCAREGLRGAEFLAGIP 125

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHV 193
           G++GGA  MNAGA      + V  V  +   G       ++ +  YR     +       
Sbjct: 126 GTVGGALAMNAGAFGGAMWELVTAVEVVGVGGENRRRLPQEYQVSYREVHGPEREWFLAA 185

Query: 194 VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEF 253
            L   P +  +    I  +   R   QP ++   GS F+NP    A +LIE  G +G   
Sbjct: 186 ELCLTPGNSQVAQQQIRRLLRQRNGCQPTRQPCAGSVFRNPRNDKAGRLIEACGLKGASI 245

Query: 254 GGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           GGA++SE H NF++N  NA+  D+EYL + V + V  ++G+ L  E+  +G+
Sbjct: 246 GGARVSERHANFIVNTGNASAADVEYLIQWVAETVARRAGVSLVPEVHMVGE 297


>gi|239826523|ref|YP_002949147.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus sp.
           WCH70]
 gi|239806816|gb|ACS23881.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus sp.
           WCH70]
          Length = 303

 Score =  218 bits (555), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 93/302 (30%), Positives = 144/302 (47%), Gaps = 5/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           +  ++ E      GK +E  PL   T  + GG A+V+ +P  +  LK  + ++   ++P 
Sbjct: 1   MKAMVNELLSANVGKVKEMEPLSNHTTIKVGGPADVLIEPDSVESLKKAMAIIKKHEVPW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
             +G GSN+LV D G+ GVV+++                 VG   S   LA    + G+ 
Sbjct: 61  RAIGRGSNLLVSDEGVEGVVIKIGEGLDELHVDGETVT--VGGGYSLVRLATLMSKQGLS 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA+  + SQ V     +   G    +  E++++ YR+S +
Sbjct: 119 GLEFAGGIPGSVGGAVYMNAGAHGSDMSQIVKRALILFPDGMMEWLTNEEMQFAYRTSVL 178

Query: 185 TKDLIITHVVLRGFPESQNIISA--AIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
                   +       S N       +     +R   QP  +   GS F+NP    A +L
Sbjct: 179 QTKRRGICIAAELQLTSGNREEIVAKMRKNKDYRRETQPWDKPCAGSIFRNPLPQYAGKL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IE++G +G   GGAKISE H NF++N   A   D+  L + V+K +    GI L  E++ 
Sbjct: 239 IEEAGLKGYTIGGAKISEQHANFIVNTGKAKAKDVLDLIQFVKKTIHELHGIHLRTEVEI 298

Query: 303 LG 304
           +G
Sbjct: 299 IG 300


>gi|154484302|ref|ZP_02026750.1| hypothetical protein EUBVEN_02015 [Eubacterium ventriosum ATCC
           27560]
 gi|149734779|gb|EDM50696.1| hypothetical protein EUBVEN_02015 [Eubacterium ventriosum ATCC
           27560]
          Length = 300

 Score =  218 bits (555), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 97/302 (32%), Positives = 156/302 (51%), Gaps = 6/302 (1%)

Query: 6   ISRLLRERGKQLRGK--FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-I 62
           +     E+ K++ G+   +EN  +     FR GGNAE+   P  I +L   + L   + +
Sbjct: 1   MDNAFIEKIKEVVGEKYVKENESMASHCTFRCGGNAELFVTPGSIDELTQVVALCRENDV 60

Query: 63  PITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHG 122
              ++G GSN+LV+D G +   + +      +       +++  A     ++A +A+ + 
Sbjct: 61  EFLVIGNGSNLLVKDEGYK--GVIIEVNSRISFIDVIGEDIVADAGAKLSAVAVTAMEND 118

Query: 123 IGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS 182
           +GGF F +GIPG+IGGA  MNAGA   E  Q +  V  +D +GN   +   +L+  YR+S
Sbjct: 119 LGGFEFAHGIPGNIGGAVMMNAGAYGGEMKQVLKWVKVLDNEGNIITLDASELEMGYRTS 178

Query: 183 EI-TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
            I  K  I+    +    E    I   +      R   QP++  + GSTFK P G+ A +
Sbjct: 179 IIEKKGYIVLQARIGLNIEFSEDIGLIMQMFMQKRRASQPLEYPSAGSTFKRPEGYFAGK 238

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           LI+ +G RG + GGA +SE HC F+IN DNAT  D+  L + V+ KV  +  + LE E++
Sbjct: 239 LIDDAGLRGYKVGGAMVSEKHCGFVINYDNATATDVINLMKDVQAKVKEKFDVQLEPEVR 298

Query: 302 RL 303
            +
Sbjct: 299 II 300


>gi|292490626|ref|YP_003526065.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrosococcus
           halophilus Nc4]
 gi|291579221|gb|ADE13678.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrosococcus
           halophilus Nc4]
          Length = 298

 Score =  218 bits (555), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 103/292 (35%), Positives = 152/292 (52%), Gaps = 1/292 (0%)

Query: 14  GKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNI 73
           G   RG+ Q+   +   T +R GG A  +++P D+ DL  FL  LP D P++ +GLGSN+
Sbjct: 6   GASFRGQLQQQVSMGGYTSWRVGGPARCLYRPADVDDLMAFLGSLPEDEPLSWLGLGSNL 65

Query: 74  LVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           LVRD GI G V+ ++ A  + IE R+   + V A      LA    R G+ G  F  GIP
Sbjct: 66  LVRDGGIEGTVIAIAGAL-NRIERRSATTVWVEAGVPCAKLAKFCAREGLRGAEFMAGIP 124

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHV 193
           G++GGA  MNAGA   ET + V  V  +   G +H    ++ +  YR     K       
Sbjct: 125 GTVGGALAMNAGAFGRETWELVTAVETVGVGGRRHRRRPQEYQVGYREVHRPKGEWFIAA 184

Query: 194 VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEF 253
            LR            I ++  HR + QP ++   GS F+NP    A +LIE  G +G+  
Sbjct: 185 ELRLAQGDSQAAQQQIRHLLRHRNSCQPTQQPCAGSVFRNPPNDKAGRLIESCGLKGVSI 244

Query: 254 GGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           GGA++SE H NF++N  +A   D+E+L + V + V  + G+ L  E+  +GD
Sbjct: 245 GGAQVSEKHANFIVNTGDAAAADIEHLIQLVAETVARRRGVTLVPEVHVVGD 296


>gi|152977322|ref|YP_001376839.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           subsp. cytotoxis NVH 391-98]
 gi|152026074|gb|ABS23844.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cytotoxicus
           NVH 391-98]
          Length = 304

 Score =  218 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 90/307 (29%), Positives = 153/307 (49%), Gaps = 7/307 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-P 59
           M    + + L E   +     +++  LK  T  + GG A+V   P    +++  +     
Sbjct: 1   MNMQEVYKYLSEILPE--NHVKQDEMLKNHTHIKVGGKADVFIMPTSYTEIQKVVKYASE 58

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +IPIT +G GSN++++D GIRG+ L L++     ++      +I  +  +   ++ +AL
Sbjct: 59  HNIPITFLGNGSNVIIKDGGIRGITLSLTHITDITVQ---GTSIIAQSGAAIIDVSRTAL 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            + + G  F  GIPGS+GGA YMNAGA   E S  + +   +   G    + ++  ++ Y
Sbjct: 116 EYSLTGLEFACGIPGSVGGALYMNAGAYGGEISYVLTKALVMTEAGELITLTKDDFEFGY 175

Query: 180 RSSEITKDLII-THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S    +  I           +   I A + ++ + RE+ QP++  + GS FK P  H 
Sbjct: 176 RKSTFANNHYIILEGTFELEKGNYAEIKAKMDDLTYKRESKQPLEYPSCGSVFKRPPNHF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI+ SG +G   GG ++S  H  FM+N DN T  D   L   V+K V  + G+ LE 
Sbjct: 236 AGKLIQDSGLQGKRIGGVEVSTKHAGFMVNVDNGTAQDYIDLIHFVQKTVEEKFGVKLER 295

Query: 299 EIKRLGD 305
           E++ +G+
Sbjct: 296 EVRIIGE 302


>gi|157825460|ref|YP_001493180.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia akari
           str. Hartford]
 gi|166222847|sp|A8GMP7|MURB_RICAH RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|157799418|gb|ABV74672.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia akari
           str. Hartford]
          Length = 295

 Score =  218 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 126/294 (42%), Positives = 174/294 (59%), Gaps = 2/294 (0%)

Query: 13  RGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSN 72
               ++G++Q+++ LK +TWF+ GG+AE+ F+P D  DL  FL      +PIT  G GSN
Sbjct: 3   ILPTVKGEYQKDYNLKHLTWFKVGGDAEIFFKPLDSEDLASFLIQNRQKLPITTFGAGSN 62

Query: 73  ILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGI 132
           I++RD GI GVV++L     +   +     +IVG+ C   +LA     + I GF F  GI
Sbjct: 63  IIIRDGGIEGVVIKLGQNFSNIEFID--NHLIVGSSCLNYNLAKFCQANDISGFEFLVGI 120

Query: 133 PGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITH 192
           PG+IGG   MNAGA   E    +V +  ID  GN       +  ++YR + + KDLII  
Sbjct: 121 PGTIGGGVAMNAGAYGSEFKDIIVRIEAIDFAGNFRTFTNAESGFKYRGNNLPKDLIILK 180

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
            V +        I   +  + + R   QPIKE+TGGSTF NP G  +W+LI+K+G RG  
Sbjct: 181 AVFKVNKGDSENILLRMNEINNTRSLTQPIKERTGGSTFANPEGLKSWELIDKAGLRGYR 240

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
            GGA +SELHCNFMIN  +AT  DLE LG+ VR+KVF  SG+ L+WEIK +G +
Sbjct: 241 IGGASMSELHCNFMINNGDATSKDLEDLGDFVRQKVFEDSGVELKWEIKIIGKY 294


>gi|255657354|ref|ZP_05402763.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           difficile QCD-23m63]
          Length = 304

 Score =  218 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 105/306 (34%), Positives = 166/306 (54%), Gaps = 10/306 (3%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD 61
           IY  +  +L       +   + + P+K+   FR GG A+++ +P+    LK  L L+  +
Sbjct: 6   IYINLLNILS------KEDIKVDEPMKKHISFRVGGPADILVRPRTEEQLKNVLKLVKKE 59

Query: 62  -IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
            IP  I+G GSNIL++D GIRGVV+ L++   S     N   M   +      L  +  +
Sbjct: 60  SIPYLIIGNGSNILIKDGGIRGVVIELADNFNSY--EINDTRMTAQSGALLSVLGKALQK 117

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             + GF F  GIPG++GGA  MNAGA   E    V  V  +D +GN   +  +Q+++ YR
Sbjct: 118 QELKGFEFASGIPGTLGGALAMNAGAYGGEMKDIVKSVRVMDMEGNIFELSNKQMEFGYR 177

Query: 181 SSEITKD-LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
            S I+K+  I     L     + + I + + ++   R T QP+   + GSTFK PTG+ A
Sbjct: 178 KSIISKNGYIALSAELELQEGNYDEIKSLMDDLATRRITKQPLNFASAGSTFKRPTGYFA 237

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LIE++G RGL   GA++SE HC F++N   A+  D+  L   ++  V+ + G++LE E
Sbjct: 238 GKLIEETGLRGLTLRGAQVSEKHCGFVVNQGEASAKDILDLIYVIKSAVYAKFGVMLEEE 297

Query: 300 IKRLGD 305
           +K LG+
Sbjct: 298 VKILGE 303


>gi|47605861|sp|Q82VS1|MURB_NITEU RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
          Length = 322

 Score =  218 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 97/298 (32%), Positives = 146/298 (48%), Gaps = 10/298 (3%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRG+ +++ P+K+   +R GG+A   +QP D+ DL  FL   P D P+ ++GLGSN+LVR
Sbjct: 18  LRGELRQHEPMKRHVSWRAGGHAACFYQPADLEDLALFLRHWPKDEPVVMIGLGSNLLVR 77

Query: 77  DAGIRGVVLRLSNAGFS---NIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           D G+ GVV+ L           +  +   +  GA      LA  A  H + G  F  GIP
Sbjct: 78  DGGLPGVVITLHAKLNDLSLVEQNESGGLIYAGAGVPCAKLARFAASHNLTGAEFLAGIP 137

Query: 134 GSIGGAAYMNAGANNCETSQYV-------VEVHGIDRKGNQHVIPREQLKYQYRSSEITK 186
           G++GGA  MNAG    ET   V             +R    + +    ++ Q   S  T 
Sbjct: 138 GTVGGALAMNAGCYGAETWDRVERVTTIDRSGIVRERTPEDYQVGYRHVELQRTPSSDTP 197

Query: 187 DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKS 246
           D+  T    R  P        A+  +   R   QP+   + GS F+NP G  A +LIE+ 
Sbjct: 198 DVWFTGGWFRLRPGKMESSRQAVRTLLTARIKTQPLGFPSAGSVFRNPPGDHAARLIEQC 257

Query: 247 GCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           G +G   G A +S LH NF++N  +AT  ++E + + V+  V   +GI L  E++ +G
Sbjct: 258 GLKGFRIGDAMVSTLHANFIVNCGHATASEIEAIIDTVQNAVHQATGIRLITEVRIIG 315


>gi|30248996|ref|NP_841066.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrosomonas
           europaea ATCC 19718]
 gi|30138613|emb|CAD84904.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrosomonas
           europaea ATCC 19718]
          Length = 331

 Score =  218 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 97/298 (32%), Positives = 146/298 (48%), Gaps = 10/298 (3%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRG+ +++ P+K+   +R GG+A   +QP D+ DL  FL   P D P+ ++GLGSN+LVR
Sbjct: 27  LRGELRQHEPMKRHVSWRAGGHAACFYQPADLEDLALFLRHWPKDEPVVMIGLGSNLLVR 86

Query: 77  DAGIRGVVLRLSNAGFS---NIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           D G+ GVV+ L           +  +   +  GA      LA  A  H + G  F  GIP
Sbjct: 87  DGGLPGVVITLHAKLNDLSLVEQNESGGLIYAGAGVPCAKLARFAASHNLTGAEFLAGIP 146

Query: 134 GSIGGAAYMNAGANNCETSQYV-------VEVHGIDRKGNQHVIPREQLKYQYRSSEITK 186
           G++GGA  MNAG    ET   V             +R    + +    ++ Q   S  T 
Sbjct: 147 GTVGGALAMNAGCYGAETWDRVERVTTIDRSGIVRERTPEDYQVGYRHVELQRTPSSDTP 206

Query: 187 DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKS 246
           D+  T    R  P        A+  +   R   QP+   + GS F+NP G  A +LIE+ 
Sbjct: 207 DVWFTGGWFRLRPGKMESSRQAVRTLLTARIKTQPLGFPSAGSVFRNPPGDHAARLIEQC 266

Query: 247 GCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           G +G   G A +S LH NF++N  +AT  ++E + + V+  V   +GI L  E++ +G
Sbjct: 267 GLKGFRIGDAMVSTLHANFIVNCGHATASEIEAIIDTVQNAVHQATGIRLITEVRIIG 324


>gi|312278853|gb|ADQ63510.1| UDP-N-acetylenolpyruvoylglucosamine reductase MurB [Streptococcus
           thermophilus ND03]
          Length = 300

 Score =  218 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 96/300 (32%), Positives = 149/300 (49%), Gaps = 6/300 (2%)

Query: 9   LLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITI 66
           +L E  + L G   + + PLK+ T+ + GG A+ +  P++ ++L   +      +IP  +
Sbjct: 1   MLDELKEDLVGIDIRFDEPLKRYTYTKVGGPADYLAFPRNRYELSRIVKFANKHNIPWMV 60

Query: 67  VGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGF 126
           +G  SN++VRD GIRG V+         +   N  ++   A  +  +    A  H + GF
Sbjct: 61  LGNASNLIVRDGGIRGFVIMFDKLNGIAV---NGYQVEAEAGANLIATTKVACFHSLTGF 117

Query: 127 HFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK 186
            F  GIPGSIGGA +MNAGA   E +  +V    + + G+   I    +++ YR S + +
Sbjct: 118 EFAAGIPGSIGGAVFMNAGAYGGEIAHILVSAQVLTKDGDIRTIDARDMRFGYRRSVLQE 177

Query: 187 -DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEK 245
              +I        P     I   +  + H RE  QP++  + GS FK P GH A QLI +
Sbjct: 178 TGEVIISAKFNLKPGDYEQIKHEMNRLNHLRELKQPLEYPSCGSVFKRPPGHFAGQLIME 237

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +  +G   GG ++S  H  FM+N D  T  D E L   V  KV   SG+ LE E++ +GD
Sbjct: 238 ANLKGHRIGGVEVSTKHAGFMVNVDQGTAKDYEDLIADVIAKVKENSGVTLEPEVRIIGD 297


>gi|77166310|ref|YP_344835.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrosococcus oceani
           ATCC 19707]
 gi|254435175|ref|ZP_05048682.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrosococcus oceani
           AFC27]
 gi|115311641|sp|Q3J791|MURB_NITOC RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|76884624|gb|ABA59305.1| UDP-N-acetylmuramate dehydrogenase [Nitrosococcus oceani ATCC
           19707]
 gi|207088286|gb|EDZ65558.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrosococcus oceani
           AFC27]
          Length = 298

 Score =  218 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 97/292 (33%), Positives = 145/292 (49%), Gaps = 1/292 (0%)

Query: 14  GKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNI 73
              +RG  + +  +   T +R GG A+ +++P D  DL  FL  LP + P+  +GLGSN+
Sbjct: 6   AASVRGWLRHHVVMASHTSWRVGGPAQRLYRPADRDDLIAFLRFLPRNEPLLWLGLGSNL 65

Query: 74  LVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           LVRD GI G V+ ++    + IE R    + V A  S   LA    R G+ G  F  GIP
Sbjct: 66  LVRDGGISGTVIAIAGVL-NRIERRTDTTVWVEAGVSCAKLAKFCAREGLRGAEFLAGIP 124

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHV 193
           G++GGA  MNAGA      + V  V      G       ++ +  YR     +       
Sbjct: 125 GTVGGALAMNAGAFGGTMWELVTAVEVAGIGGEHCRRLPQEYQVSYREVHGPEREWFLAA 184

Query: 194 VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEF 253
            LR    +  +    I  +   R   QPI++   GS F+NP    A +LIE  G +G   
Sbjct: 185 ELRLTLGNSQVAQQQIRRLLRQRNGCQPIRQPCAGSVFRNPWNDKAGRLIEACGLKGASI 244

Query: 254 GGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           GGA++SE H NF++N  NA+  D+E+L + V + V  Q+G+ L  E+  +G+
Sbjct: 245 GGARVSERHANFIVNTGNASAADVEHLIQWVAETVARQAGVSLVPEVHMVGE 296


>gi|296451831|ref|ZP_06893550.1| UDP-N-acetylmuramate dehydrogenase [Clostridium difficile NAP08]
 gi|296879773|ref|ZP_06903747.1| UDP-N-acetylmuramate dehydrogenase [Clostridium difficile NAP07]
 gi|296259310|gb|EFH06186.1| UDP-N-acetylmuramate dehydrogenase [Clostridium difficile NAP08]
 gi|296429244|gb|EFH15117.1| UDP-N-acetylmuramate dehydrogenase [Clostridium difficile NAP07]
          Length = 317

 Score =  218 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 105/306 (34%), Positives = 166/306 (54%), Gaps = 10/306 (3%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD 61
           IY  +  +L       +   + + P+K+   FR GG A+++ +P+    LK  L L+  +
Sbjct: 19  IYINLLNILS------KEDIKVDEPMKKHISFRVGGPADILVRPRTEEQLKNVLKLVKKE 72

Query: 62  -IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
            IP  I+G GSNIL++D GIRGVV+ L++   S     N   M   +      L  +  +
Sbjct: 73  SIPYLIIGNGSNILIKDGGIRGVVIELADNFNSY--EINDTRMTAQSGALLSVLGKALQK 130

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             + GF F  GIPG++GGA  MNAGA   E    V  V  +D +GN   +  +Q+++ YR
Sbjct: 131 QELKGFEFASGIPGTLGGALAMNAGAYGGEMKDIVKSVRVMDMEGNIFELSNKQMEFGYR 190

Query: 181 SSEITKD-LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
            S I+K+  I     L     + + I + + ++   R T QP+   + GSTFK PTG+ A
Sbjct: 191 KSIISKNGYIALSAELELQEGNYDEIKSLMDDLATRRITKQPLNFASAGSTFKRPTGYFA 250

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LIE++G RGL   GA++SE HC F++N   A+  D+  L   ++  V+ + G++LE E
Sbjct: 251 GKLIEETGLRGLTLRGAQVSEKHCGFVVNQGEASAKDILDLIYVIKSAVYAKFGVMLEEE 310

Query: 300 IKRLGD 305
           +K LG+
Sbjct: 311 VKILGE 316


>gi|291520855|emb|CBK79148.1| UDP-N-acetylmuramate dehydrogenase [Coprococcus catus GD/7]
          Length = 305

 Score =  218 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 89/290 (30%), Positives = 134/290 (46%), Gaps = 4/290 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAG 79
              + P+   T FR GG A+   +P D   L   + L    D+   + G GSN+LV D G
Sbjct: 16  VLRDEPMAVHTTFRIGGPADYFVEPADASALAKGIALCREVDVDYFVTGNGSNLLVGDGG 75

Query: 80  IRGVVLRLSNAGFSNIEVRNHCE--MIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            RGV+  + +            E  +  GA      LA      G  GF +  GIPG++G
Sbjct: 76  YRGVIFHICHTMDHIQYEEQEGELLVEAGAGVMLSRLARQVSSMGYTGFEYATGIPGTLG 135

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL-IITHVVLR 196
           G   MNAGA   E S  ++    +D  G    + +E LK  YR S + +   ++      
Sbjct: 136 GGVTMNAGAYGGEISDNILWAELMDETGAILKLEKEHLKLSYRHSVMMEHPLVVLRAGFS 195

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
                   IS  +  +   R   QP++  + GSTFK P G+ A +LI+  G +G   G A
Sbjct: 196 FKKGDAAAISDRVTELSRLRREKQPLEYPSAGSTFKRPEGYFAGKLIQDCGLKGFRVGDA 255

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
            +SE H  F+INA  AT  D+  L   V+++V  +  + +E E++ LG+F
Sbjct: 256 VVSEKHSGFVINAGQATAADVMALIRYVQQEVEEKFHVRIEPEVRLLGEF 305


>gi|294012775|ref|YP_003546235.1| UDP-N-acetylmuramate dehydrogenase [Sphingobium japonicum UT26S]
 gi|292676105|dbj|BAI97623.1| UDP-N-acetylmuramate dehydrogenase [Sphingobium japonicum UT26S]
          Length = 315

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 122/291 (41%), Positives = 175/291 (60%), Gaps = 1/291 (0%)

Query: 14  GKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNI 73
              +RG  + + PL  + WF+ GG A+ +F+P+D  DL  FL  L   IP+  +GLGSN+
Sbjct: 8   LPAVRGSLKADAPLGPLVWFKAGGVAQWLFEPKDADDLSDFLARLDPAIPVMALGLGSNL 67

Query: 74  LVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           +VRD G+ GVV+RL        +V     +  G   SG  ++++A   GI G  F   IP
Sbjct: 68  IVRDGGVPGVVVRLGKPFARVEQVDA-TSLRCGGGASGILVSSTARDAGIAGLEFLRSIP 126

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHV 193
           G++GG   MN GA   ET   ++E   + R G +  +P + L Y YR S + +  ++   
Sbjct: 127 GTVGGFVRMNGGAYGRETCDILLECGVVLRSGERVTMPLDALGYTYRHSILPEGAVVVSA 186

Query: 194 VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEF 253
           V RG P     I A +  +   RE  QP++ KTGGSTFKNP GH AWQL++++GCRGL  
Sbjct: 187 VFRGVPGEPAAIQAEMDRIAAAREESQPLRSKTGGSTFKNPDGHKAWQLVDEAGCRGLRL 246

Query: 254 GGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           GGA++SE H NF++N  +AT  D+E LGE+VR++V  +SGI LEWEI+R+G
Sbjct: 247 GGAQVSEKHTNFLLNLGDATSADIEALGEEVRRRVKAKSGIDLEWEIQRVG 297


>gi|20141623|sp|Q9ZDS7|MURB_RICPR RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
          Length = 295

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 128/294 (43%), Positives = 176/294 (59%), Gaps = 2/294 (0%)

Query: 13  RGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSN 72
               ++G++++++ LK +TWF+ GGNAE+ F+P D  DLK FL      +PIT  G GSN
Sbjct: 3   ILPIIKGEYKKDYNLKHLTWFKVGGNAEIFFKPFDFADLKSFLIQNKQKLPITTFGSGSN 62

Query: 73  ILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGI 132
           I++RD GI GVV++L         +     +IVG+ C   +LA     + I GF F  GI
Sbjct: 63  IIIRDGGIEGVVIKLGQNFNKIEFLD--NHLIVGSSCLNYNLARFCQANAISGFEFLVGI 120

Query: 133 PGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITH 192
           PG+IGG   MNAGA        +V+V  +D  GN      +++ ++YR + + KDLI+  
Sbjct: 121 PGTIGGGVIMNAGAYGSAFQDIIVQVEALDFSGNFLTFTNKEIGFKYRGNNLPKDLILLK 180

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
            V +        I   +  + + R + QPIKE+TGGSTF NP G  +W+LI+K+G RG  
Sbjct: 181 AVFKVNKGDSQNILLKMNKINNTRSSTQPIKERTGGSTFINPEGRKSWELIDKAGLRGYR 240

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
            GGA ISELHCNFMIN  NAT  DLE LG  VR+KVF  SG+ L WEIKR+G +
Sbjct: 241 IGGASISELHCNFMINNGNATAKDLEDLGNFVRQKVFEDSGVELNWEIKRIGKY 294


>gi|319406004|emb|CBI79635.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella sp. AR
           15-3]
          Length = 325

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 155/309 (50%), Positives = 214/309 (69%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPIT 65
           + + L+   + ++GK   N  ++++TWFRTGG AE+ +QP D  DL  F   LP  IP+T
Sbjct: 12  LLKKLQPALRGIQGKLTPNVDMRKVTWFRTGGLAEIFYQPSDEADLVLFFQSLPESIPVT 71

Query: 66  IVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGG 125
           IVG+GSN+LVRD GI GVV+RLS  GF  ++  +    +VGA  +GK LA +AL   + G
Sbjct: 72  IVGIGSNLLVRDGGIPGVVIRLSAKGFGQLKQVSSKRFLVGAAVAGKHLAAAALEAELSG 131

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT 185
           FHF++GIPG  GGA  MNAGAN  ET++ VVEV+ +DRKG +H++  + + Y YR  ++ 
Sbjct: 132 FHFYHGIPGCCGGALKMNAGANGIETAERVVEVYALDRKGQRHILSVKDIHYSYRCCDVP 191

Query: 186 KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEK 245
            D +    +L G   ++N I  A+  V  HR+ VQPI+EKTGGSTF+NP G  AW++I++
Sbjct: 192 DDFVFIAALLEGEQGNRNYIRTAMDEVALHRQKVQPIREKTGGSTFRNPVGTFAWRVIDE 251

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +GCRGL+ GGA++SE+HCNFMIN D ATGYDLE LGE VR +VF  SG LL+WEI+R+G 
Sbjct: 252 AGCRGLKIGGAQMSEMHCNFMINIDQATGYDLEKLGETVRARVFAHSGHLLQWEIQRIGQ 311

Query: 306 FFDHQIVDA 314
           F   +IV +
Sbjct: 312 FEQGRIVSS 320


>gi|228477041|ref|ZP_04061679.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           salivarius SK126]
 gi|228251060|gb|EEK10231.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           salivarius SK126]
          Length = 300

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 94/300 (31%), Positives = 149/300 (49%), Gaps = 6/300 (2%)

Query: 9   LLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITI 66
           +L E  + L G   + + PLK+ T+ + GG A+ +  P++ ++L   +      DIP  +
Sbjct: 1   MLDELKEDLVGIDIRFDEPLKRYTYTKVGGPADYLAFPRNRYELSRIVKFANKHDIPWMV 60

Query: 67  VGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGF 126
           +G  SN++VRD GIRG V+         +   N  ++   A  +  +    A    + GF
Sbjct: 61  LGNASNLIVRDGGIRGFVIMFDRLNGIAV---NGYQIEAEAGANLIATTKVARFQSLTGF 117

Query: 127 HFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK 186
            F  GIPGS+GGA +MNAGA   E +  +V    + + G+   I    +++ YR S + +
Sbjct: 118 EFAAGIPGSVGGAVFMNAGAYGGEIAHILVSAQVLTKDGDIRTIDARDMRFGYRRSVLQE 177

Query: 187 -DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEK 245
              ++        P     I   +  + H RE  QP++  + GS FK P GH A QLI +
Sbjct: 178 TGEVVISAKFNLKPGDYEQIKNEMNRLNHLRELKQPLEYPSCGSVFKRPPGHFAGQLIME 237

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +  +G   GG ++S  H  FM+N D+ T  D E L   V  KV   SG+ LE E++ +GD
Sbjct: 238 ANLKGHRIGGVEVSTKHAGFMVNVDHGTAKDYEDLIADVIAKVKENSGVKLEPEVRIIGD 297


>gi|167464922|ref|ZP_02330011.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Paenibacillus larvae
           subsp. larvae BRL-230010]
 gi|322384119|ref|ZP_08057837.1| UDP-N-acetylenolpyruvoylglucosamine reductase-like protein
           [Paenibacillus larvae subsp. larvae B-3650]
 gi|321151199|gb|EFX44508.1| UDP-N-acetylenolpyruvoylglucosamine reductase-like protein
           [Paenibacillus larvae subsp. larvae B-3650]
          Length = 301

 Score =  217 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 102/302 (33%), Positives = 162/302 (53%), Gaps = 4/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPI 64
           + +++ +  +   G+   +  L   T ++ GG A+V+  P+   +L   + +L     P 
Sbjct: 1   MQQVIADLQEADAGEICPDEVLAPYTTWKIGGPADVLVIPESKEELAAAIAVLHRHRTPW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            I+G GSN+LV D GIRG V++L N+  +      +  +   A  S   L+  A + G+ 
Sbjct: 61  MILGRGSNLLVCDKGIRGAVIKLGNSFDTV--RLENHLIYADAAYSIIKLSVMAGKAGLT 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA+  + S+ + +   I   G    + +E L+Y YR S +
Sbjct: 119 GLEFAGGIPGSVGGAVYMNAGAHGSDVSRILKQADVILDTGELVTMQQEDLQYAYRHSIL 178

Query: 185 TK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
                I+T  V    P  +  I+AA+A     R   QP+     GS F+NP  H A +LI
Sbjct: 179 HTLPGIVTEAVFELEPGDRKEIAAALAAYKDRRLRTQPLGLACAGSVFRNPDKHYAAKLI 238

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           E+SG +G   GGA+IS LH NF++N  NAT  D+  L +++++ V++  GI LE E+  +
Sbjct: 239 EESGLKGTSVGGAEISPLHANFIVNTGNATAEDVLTLIQKIQQTVWDHHGIGLEPEVLVV 298

Query: 304 GD 305
           G+
Sbjct: 299 GE 300


>gi|116628229|ref|YP_820848.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           thermophilus LMD-9]
 gi|122267175|sp|Q03JH0|MURB_STRTD RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|116101506|gb|ABJ66652.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus thermophilus
           LMD-9]
          Length = 304

 Score =  217 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 96/301 (31%), Positives = 149/301 (49%), Gaps = 6/301 (1%)

Query: 8   RLLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPIT 65
            +L E  + L G   + + PLK+ T+ + GG A+ +  P++ ++L   +      +IP  
Sbjct: 4   NMLDELKEDLVGIDIRFDEPLKRYTYTKVGGPADYLAFPRNRYELSRIVKFANKHNIPWM 63

Query: 66  IVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGG 125
           ++G  SN++VRD GIRG V+         +   N  ++   A  +  +    A  H + G
Sbjct: 64  VLGNASNLIVRDGGIRGFVIMFDKLNGIAV---NGYQVEAEAGANLIATTKVACFHSLTG 120

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT 185
           F F  GIPGSIGGA +MNAGA   E +  +V    + + G+   I    +++ YR S + 
Sbjct: 121 FEFAAGIPGSIGGAVFMNAGAYGGEIAHILVSAQVLTKDGDIRTIDARDMRFGYRRSVLQ 180

Query: 186 K-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIE 244
           +   +I        P     I   +  + H RE  QP++  + GS FK P GH A QLI 
Sbjct: 181 ETGEVIISAKFNLKPGDYEQIKHEMNRLNHLRELKQPLEYPSCGSVFKRPPGHFAGQLIM 240

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           ++  +G   GG ++S  H  FM+N D  T  D E L   V  KV   SG+ LE E++ +G
Sbjct: 241 EANLKGHRIGGVEVSTKHAGFMVNVDQGTAKDYEDLIADVIAKVKENSGVTLEPEVRIIG 300

Query: 305 D 305
           D
Sbjct: 301 D 301


>gi|209963944|ref|YP_002296859.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodospirillum
           centenum SW]
 gi|209957410|gb|ACI98046.1| UDP-N-acetylenolpyruvoylglucosamine reductase, putative
           [Rhodospirillum centenum SW]
          Length = 317

 Score =  217 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 132/300 (44%), Positives = 184/300 (61%), Gaps = 7/300 (2%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGL 69
           L +R  ++RG+   + PL  +TWFR GG A+V+F+P D  DL  FL   P+D+P+T++G+
Sbjct: 12  LIDRLPRVRGRLTADAPLGPMTWFRVGGTADVLFRPADADDLAGFLAGCPADVPVTVIGV 71

Query: 70  GSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFF 129
            SN+LVRD G+ GVV+RL               ++ GA     ++A +A   G+ G  F 
Sbjct: 72  ASNLLVRDGGVPGVVIRLGGPFAEIAV--EGDRLVAGAGALDYNVALTAQHEGLAGLEFL 129

Query: 130 YGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLI 189
            GIPG+IGGA  MNAGA   ET+  VV   GIDR G +    R  L   YR   + +D+I
Sbjct: 130 SGIPGTIGGALRMNAGAYGRETADLVVTAEGIDRAGRRLRFDRAGLHLGYRHCGVPEDVI 189

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPT-----GHSAWQLIE 244
            T  VL+G P  +  I+ A+  +   R   QP++ +TGGSTF NP      G  AWQLI+
Sbjct: 190 FTGAVLQGTPGDKAAIATAMDAIQKARADSQPVRARTGGSTFANPDPELSGGAKAWQLID 249

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           ++GCRGL+ GGA++SE HCNF++N  +AT  DLE LGE+VR++V   SGI L WEI+R+G
Sbjct: 250 RAGCRGLQIGGAQVSEKHCNFLLNLGDATAADLEGLGEEVRRRVLETSGIELRWEIRRIG 309


>gi|89895652|ref|YP_519139.1| hypothetical protein DSY2906 [Desulfitobacterium hafniense Y51]
 gi|89335100|dbj|BAE84695.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 288

 Score =  217 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 93/288 (32%), Positives = 151/288 (52%), Gaps = 4/288 (1%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYF-LTLLPSDIPITIVGLGSNILV 75
           +RG+ +  +PLK++  +R GG AE +  P+   +L+   L      IP  + G GSNIL 
Sbjct: 1   MRGRVEHQYPLKKLNTWRIGGLAETVCWPESEEELREIWLKCQEQGIPFRLFGRGSNILF 60

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
            D G+ GV +  +    S  +      + VGA  S   L+  A   G+ G  F  GIPG+
Sbjct: 61  PDEGLTGVTVISTGLAQSAWDSE---WVSVGAGYSLARLSQEAADRGLTGLEFARGIPGT 117

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           +GGA  MNAGA+       + EV  +   G    I ++ +++ YR   +   +I+   V 
Sbjct: 118 VGGAVVMNAGAHGGSIQDILEEVTILTPDGEVQQIAKQDIQFGYRECSLRDQVIVLAGVF 177

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           R      ++I A ++     R+  QP++    GS F+NP G SA +LIE++G +G   GG
Sbjct: 178 RLKAGDPDVIQATMSENLAKRKAAQPLELPNAGSVFRNPPGDSAGRLIEEAGWKGKRLGG 237

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           A++S  H NF++N  NAT  D+  L  +++K V +Q G+ L+ E++ +
Sbjct: 238 AQVSSKHANFIVNQGNATARDVLALIREIQKDVHHQFGVELKTEVRYI 285


>gi|126658805|ref|ZP_01729949.1| hypothetical protein CY0110_08136 [Cyanothece sp. CCY0110]
 gi|126619903|gb|EAZ90628.1| hypothetical protein CY0110_08136 [Cyanothece sp. CCY0110]
          Length = 311

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 92/292 (31%), Positives = 142/292 (48%), Gaps = 4/292 (1%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRD 77
           GK   NF L   T +R GG A     P++  +L+         DIP+ ++G GSN+L+ D
Sbjct: 19  GKIYPNFSLAPHTSYRVGGQARWYAAPRNWDELQGIFEWFQKQDIPLMLLGAGSNLLISD 78

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            GI G+VL                 + V A     S+A  A + G  G  +  GIPG++G
Sbjct: 79  RGIDGLVLSTRYLRHRQF-DEETGRITVAAGQPIVSVAWQAAKRGWRGLEWAVGIPGTVG 137

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRG 197
           GA  MNAGA+N   +  +V    +   G    +  E L Y YR+S +     +       
Sbjct: 138 GAVVMNAGAHNQCAADCLVSAVVVSPDGKVETLTPEDLNYSYRTSALQGGQRLVIEATFQ 197

Query: 198 FPE--SQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
                S+ +++A   +    R++ QP  + + GS F+NPT ++A  LIE+ G +G   G 
Sbjct: 198 LQPGFSREVVTATTQDNLWQRKSSQPYDKPSCGSVFRNPTPYAAGWLIEQLGLKGYRVGD 257

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFF 307
           A++S+ H NF++N   A   D+  L   V++KV     +LLE E+K LG+F 
Sbjct: 258 AEVSQRHANFILNCGQAKAEDIFRLIHHVQEKVQAHWSLLLEPEVKILGEFS 309


>gi|148284351|ref|YP_001248441.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Orientia
           tsutsugamushi str. Boryong]
 gi|187609733|sp|A5CD21|MURB_ORITB RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|146739790|emb|CAM79665.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Orientia
           tsutsugamushi str. Boryong]
          Length = 303

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 124/294 (42%), Positives = 179/294 (60%), Gaps = 2/294 (0%)

Query: 14  GKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNI 73
             ++ G++++NF L Q+TWF+ GG ++V ++P+D  DL  FL  L  DI IT++G GSN+
Sbjct: 7   LPKINGEYRKNFKLSQLTWFKVGGISQVFYKPKDEEDLSCFLKNLQFDIQITVLGAGSNL 66

Query: 74  LVRDAGIRGVVLRLSNAGF--SNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYG 131
           L+RD GI GV ++L  +    + ++  ++  + VGA      +A   L+H +GG  F  G
Sbjct: 67  LIRDNGIDGVTIKLGRSFNEINFVKNNHYNIISVGAGTLNYDVAKFCLQHNLGGLEFLVG 126

Query: 132 IPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIIT 191
           IPG+IGG   MNAGA   E    V  V  +DR GN+H+   + L ++YR   +   LI T
Sbjct: 127 IPGTIGGGIAMNAGAYGQEFKDVVYSVEALDRLGNKHIFLSKDLNFEYRQCIVNGFLIFT 186

Query: 192 HVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGL 251
              L  + +S+  IS  +  +   R+  QPI +KT GS F+N   + AWQLI+K G RG 
Sbjct: 187 KTNLICYNDSKTSISQKLQKIQTVRKLTQPINQKTAGSAFRNTNNYKAWQLIDKVGLRGH 246

Query: 252 EFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
             GGA++S LHCNF+IN  NAT  D+E LGE +RK VF+ +GI LEWEIK +G 
Sbjct: 247 SIGGAQVSNLHCNFLINNGNATASDIENLGELIRKNVFDHTGITLEWEIKIVGK 300


>gi|315923982|ref|ZP_07920210.1| UDP-N-acetylmuramate dehydrogenase [Pseudoramibacter alactolyticus
           ATCC 23263]
 gi|315622822|gb|EFV02775.1| UDP-N-acetylmuramate dehydrogenase [Pseudoramibacter alactolyticus
           ATCC 23263]
          Length = 306

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 102/303 (33%), Positives = 152/303 (50%), Gaps = 7/303 (2%)

Query: 7   SRLLRERGKQLRGK--FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIP 63
            + +R+R   L G      +  +K  T FR GG A+ + +P+ I      +       IP
Sbjct: 3   KQTIRDRLMSLLGSDHVLTDTLMKDHTSFRVGGPADFLVRPETIEQFIDVMCFCRTEKIP 62

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
             ++G GSN+LVRD G RGV+++          V +   + V A    + +A  AL HG+
Sbjct: 63  SYLIGNGSNLLVRDGGFRGVIIQTRGMDQI---VTSGDRVTVYAGALLRRVAAEALAHGL 119

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            G  F  GIPGS+GGA  MNAGA   E    V  +  +   GN   I      + YR S 
Sbjct: 120 SGMEFAAGIPGSMGGAIVMNAGAYGGEMKDIVESITVLTETGNLRTIAGADCDFGYRHSV 179

Query: 184 ITK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
           +   D I+   VL+        I+A + +    R   QP+   + GSTF+ P GH A +L
Sbjct: 180 VQDYDWIVVSTVLKLAAGDPEAIAARMKDFNRRRRDKQPLNFPSAGSTFRRPEGHFAGKL 239

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           I+ +G +G   GGA++SE H  F+INADNAT  D+  L  QV+  V ++ G+ L+ E+  
Sbjct: 240 IQDAGMKGYRVGGAQVSEKHSGFVINADNATAADILALIGQVQAAVRDRFGVELKTEVIT 299

Query: 303 LGD 305
           +G+
Sbjct: 300 IGE 302


>gi|126701025|ref|YP_001089922.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           difficile 630]
 gi|254977024|ref|ZP_05273496.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           difficile QCD-66c26]
 gi|255094351|ref|ZP_05323829.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           difficile CIP 107932]
 gi|255316104|ref|ZP_05357687.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           difficile QCD-76w55]
 gi|255518765|ref|ZP_05386441.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           difficile QCD-97b34]
 gi|255651943|ref|ZP_05398845.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           difficile QCD-37x79]
 gi|123173714|sp|Q180P9|MURB_CLOD6 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|115252462|emb|CAJ70305.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           difficile]
          Length = 304

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 106/306 (34%), Positives = 166/306 (54%), Gaps = 10/306 (3%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD 61
           IY  +  +L       +   + + P+K+   FR GG A+++ +P+    LK  L L+  +
Sbjct: 6   IYINLLNILS------KEDIKVDEPMKKHISFRVGGPADILVRPRTEEQLKNVLKLVKEE 59

Query: 62  -IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
            IP  I+G GSNIL++D GIRGVV+ L++   S     N   M   +      L  +  +
Sbjct: 60  SIPYLIIGNGSNILIKDGGIRGVVIELADNFNSY--EINDTRMTAQSGALLSVLGKALQK 117

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             + GF F  GIPG++GGA  MNAGA   E    V  V  +D +GN   +  EQ+++ YR
Sbjct: 118 QELKGFEFASGIPGTLGGALAMNAGAYGGEMKDIVKSVRLMDMEGNIFELSNEQMEFGYR 177

Query: 181 SSEITKD-LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
            S I+K+  I     L     + + I + + ++   R T QP+   + GSTFK PTG+ A
Sbjct: 178 KSIISKNGYIALSAELELQEGNYDEIKSLMDDLATRRITKQPLNFASAGSTFKRPTGYFA 237

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LIE++G RGL   GA++SE HC F++N   A+  D+  L   ++  V+ + G++LE E
Sbjct: 238 GKLIEETGLRGLTLRGAQVSEKHCGFVVNQGEASAKDILDLIYVIKSAVYAKFGVMLEEE 297

Query: 300 IKRLGD 305
           +K LG+
Sbjct: 298 VKILGE 303


>gi|260439216|ref|ZP_05793032.1| UDP-N-acetylmuramate dehydrogenase [Butyrivibrio crossotus DSM
           2876]
 gi|292808231|gb|EFF67436.1| UDP-N-acetylmuramate dehydrogenase [Butyrivibrio crossotus DSM
           2876]
          Length = 305

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 100/298 (33%), Positives = 148/298 (49%), Gaps = 6/298 (2%)

Query: 14  GKQLRGK--FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKY-FLTLLPSDIPITIVGLG 70
            K + G+     N  +   T F+ GG A+    P    D+K   L      IP  ++G G
Sbjct: 7   IKSIAGEECIFCNEMMSDHTTFKVGGPAKYFVVPYRAEDIKKYILAAEEYKIPYYVIGNG 66

Query: 71  SNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFY 130
           SN+LV D G  G+++ L     +     N   +   A  S   L N+A RH + G  F  
Sbjct: 67  SNLLVSDKGYDGMIIMLGRDLGNI--TVNGDRITAEAGTSLARLFNTARRHSLSGLEFAA 124

Query: 131 GIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLI 189
           GIPG++GGA YMNAGA   E    + +V  IDR+GN H   + +++  YR+S    K  I
Sbjct: 125 GIPGTLGGACYMNAGAYGGEMKDVLTKVITIDRQGNTHEYKQGEMELSYRNSIFIRKQEI 184

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
           I    ++        ++  +  +   R+  QP++  + GSTFK P G  A +LIE+ G +
Sbjct: 185 ILSAEMKLCKGDVEKMTHKVNELLEKRKEKQPLEYPSAGSTFKRPEGDFAGRLIEECGLK 244

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFF 307
           G    GA++SE H  F+IN +NAT  D+      V   V  ++GI LE E++ LGDF 
Sbjct: 245 GKGVNGAEVSEKHAGFIINRNNATARDIYDTINLVTDTVLEKTGIKLEPEVRLLGDFS 302


>gi|260684907|ref|YP_003216192.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           difficile CD196]
 gi|260688565|ref|YP_003219699.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           difficile R20291]
 gi|260211070|emb|CBA66437.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           difficile CD196]
 gi|260214582|emb|CBE07144.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           difficile R20291]
          Length = 317

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 106/306 (34%), Positives = 166/306 (54%), Gaps = 10/306 (3%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD 61
           IY  +  +L       +   + + P+K+   FR GG A+++ +P+    LK  L L+  +
Sbjct: 19  IYINLLNILS------KEDIKVDEPMKKHISFRVGGPADILVRPRTEEQLKNVLKLVKEE 72

Query: 62  -IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
            IP  I+G GSNIL++D GIRGVV+ L++   S     N   M   +      L  +  +
Sbjct: 73  SIPYLIIGNGSNILIKDGGIRGVVIELADNFNSY--EINDTRMTAQSGALLSVLGKALQK 130

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             + GF F  GIPG++GGA  MNAGA   E    V  V  +D +GN   +  EQ+++ YR
Sbjct: 131 QELKGFEFASGIPGTLGGALAMNAGAYGGEMKDIVKSVRLMDMEGNIFELSNEQMEFGYR 190

Query: 181 SSEITKD-LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
            S I+K+  I     L     + + I + + ++   R T QP+   + GSTFK PTG+ A
Sbjct: 191 KSIISKNGYIALSAELELQEGNYDEIKSLMDDLATRRITKQPLNFASAGSTFKRPTGYFA 250

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LIE++G RGL   GA++SE HC F++N   A+  D+  L   ++  V+ + G++LE E
Sbjct: 251 GKLIEETGLRGLTLRGAQVSEKHCGFVVNQGEASAKDILDLIYVIKSAVYAKFGVMLEEE 310

Query: 300 IKRLGD 305
           +K LG+
Sbjct: 311 VKILGE 316


>gi|331086349|ref|ZP_08335429.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lachnospiraceae
           bacterium 9_1_43BFAA]
 gi|330406115|gb|EGG85638.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lachnospiraceae
           bacterium 9_1_43BFAA]
          Length = 303

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 105/305 (34%), Positives = 159/305 (52%), Gaps = 6/305 (1%)

Query: 6   ISRLLRERGKQL--RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DI 62
           + +   +   QL        + PLK    FR GG A+    P+   +++  + L     +
Sbjct: 1   MKKEFYDALIQLTEEKNVLTDEPLKNHVTFRVGGAADYFVSPESAEEVQKIILLCKEAGM 60

Query: 63  PITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHG 122
           P  I+G GSN+LV D G RGV++++  +            +   A     ++A  A    
Sbjct: 61  PYYILGNGSNLLVSDQGYRGVIIQIYKSMSEI--SVKGEFVTAQAGALLSAIAAKAAGES 118

Query: 123 IGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS 182
           + GF F  GIPG+IGGAA MNAGA   E    + +V  + ++G    IPRE+L   YR+S
Sbjct: 119 LAGFEFASGIPGTIGGAAVMNAGAYGGEMKDVLEQVTVLTKEGELLTIPREELDMGYRTS 178

Query: 183 EITKDLII-THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
           ++ K+  I    V+      Q  I   +  +   R T QP++  + GSTFK P G+ A +
Sbjct: 179 KVAKNQYIVLEAVIHLAHGEQEKIREKMNELKEKRTTKQPLEYPSAGSTFKRPEGYFAGK 238

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           LI ++G RG + GGA++SE HC F+IN DNAT  ++  L  QV ++V   SG+ LE E+K
Sbjct: 239 LIAEAGLRGFQVGGAQVSEKHCGFVINKDNATAAEVRELIRQVSERVKANSGVTLEPEVK 298

Query: 302 RLGDF 306
            LG+F
Sbjct: 299 MLGEF 303


>gi|289434704|ref|YP_003464576.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria seeligeri
           serovar 1/2b str. SLCC3954]
 gi|289170948|emb|CBH27490.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria seeligeri
           serovar 1/2b str. SLCC3954]
          Length = 298

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 98/287 (34%), Positives = 151/287 (52%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAG 79
            + N PL   T+ +TGGNA++   P+ I + +  ++    ++IP+TI+G GSN++++D G
Sbjct: 13  IKLNEPLSNYTYTKTGGNADIFVMPKTIEETQAIVSYCHQNNIPLTILGNGSNLIIKDGG 72

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRGV++ L+         RN+ ++I  +       A  AL   + G  F  GIPGSIGGA
Sbjct: 73  IRGVIVHLALLQSIK---RNNTQVIAMSGAKLIDTAKFALDESLSGLEFACGIPGSIGGA 129

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLRGF 198
            +MNAGA   E S  +     + + G    + R +LK  YR S I  K  I+        
Sbjct: 130 LHMNAGAYGGEISDVLEAATVLTQAGELKKLKRSELKAAYRFSTIAEKKYIVLDATFALQ 189

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
            + +N I   +  +   RE  QP++  + GS FK P GH A +LI+ SG +G   GGA++
Sbjct: 190 LDDKNTIQVKMDELTAAREAKQPLEYPSCGSVFKRPPGHFAGKLIQDSGLQGHIIGGAQV 249

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           S  H  F++N   AT  D   L   V+K V  +  + LE E+K +G+
Sbjct: 250 SLKHAGFIVNIGGATATDYMNLIAHVQKTVREKFDVELETEVKIIGE 296


>gi|118443439|ref|YP_877366.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium novyi
           NT]
 gi|166222837|sp|A0PYB4|MURB_CLONN RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|118133895|gb|ABK60939.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium novyi
           NT]
          Length = 307

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 97/306 (31%), Positives = 157/306 (51%), Gaps = 7/306 (2%)

Query: 5   RISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIP 63
            I++ L     +   + + N  +K  T F+ GG A++   P     +K  + +   ++IP
Sbjct: 6   DINKKLESILDK--EEIKNNILMKNYTSFKVGGPADIFVTPNSYEKVKGVINICKENNIP 63

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
             I+G GSN+LVRD GIRGVV+  +             ++I  +      +AN+AL+  +
Sbjct: 64  YFILGNGSNVLVRDGGIRGVVVSFNKLNKVY---AEGNKVIAESGTLLSMVANTALKSDL 120

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            G  F +GIPGS+GGA  MNAGA N E SQ +     ID  G    + +E+L   YR+S 
Sbjct: 121 TGLEFAHGIPGSVGGAVTMNAGAYNGEISQVIESATVIDNNGKIIKLSKEELDLSYRNSI 180

Query: 184 ITKD-LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
           I K+  ++ +          + I   + ++   R+  QP++  + GSTFK P G+ A +L
Sbjct: 181 ILKNGYVVLNATFALQKGDHDAIKGRMDDLMRRRKEKQPLEYPSAGSTFKRPEGYFAAKL 240

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IE SG +G   G A++S  H  F+IN   A+  D+  L E V+K V  +  + L  E++ 
Sbjct: 241 IEDSGLKGTHVGDAEVSIKHSGFLINKGKASAKDILDLIEVVKKTVKEKFNVELNTEVRI 300

Query: 303 LGDFFD 308
           +G+  +
Sbjct: 301 VGEESE 306


>gi|255102605|ref|ZP_05331582.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           difficile QCD-63q42]
 gi|255308431|ref|ZP_05352602.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           difficile ATCC 43255]
          Length = 304

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 106/306 (34%), Positives = 166/306 (54%), Gaps = 10/306 (3%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD 61
           IY  +  +L       +   + + P+K+   FR GG A+++ +P+    LK  L L+  +
Sbjct: 6   IYINLLNILS------KEDIKVDEPMKKHISFRVGGPADILVRPRTEEQLKNVLKLVKKE 59

Query: 62  -IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
            IP  I+G GSNIL++D GIRGVV+ L++   S     N   M   +      L  +  +
Sbjct: 60  SIPYLIIGNGSNILIKDGGIRGVVIELADNFNSY--EINDTRMTAQSGALLSVLGKALQK 117

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             + GF F  GIPG++GGA  MNAGA   E    V  V  +D +GN   +  EQ+++ YR
Sbjct: 118 QELKGFEFASGIPGTLGGALAMNAGAYGGEMKDIVKSVRLMDMEGNIFELSNEQMEFGYR 177

Query: 181 SSEITKD-LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
            S I+K+  I     L     + + I + + ++   R T QP+   + GSTFK PTG+ A
Sbjct: 178 KSIISKNGYIALSAELELQEGNYDEIKSLMDDLATRRITKQPLNFASAGSTFKRPTGYFA 237

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LIE++G RGL   GA++SE HC F++N   A+  D+  L   ++  V+ + G++LE E
Sbjct: 238 GKLIEETGLRGLTLRGAQVSEKHCGFVVNQGEASAKDILDLIYVIKSAVYAKFGVMLEEE 297

Query: 300 IKRLGD 305
           +K LG+
Sbjct: 298 VKILGE 303


>gi|291561485|emb|CBL40284.1| UDP-N-acetylmuramate dehydrogenase [butyrate-producing bacterium
           SS3/4]
          Length = 289

 Score =  216 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 98/287 (34%), Positives = 153/287 (53%), Gaps = 3/287 (1%)

Query: 22  QENFPLKQITWFRTGGNAEVMFQPQDIHDLKY-FLTLLPSDIPITIVGLGSNILVRDAGI 80
           + N P+ + T FR GG A+    P+   +L+   L    S  P  ++G GSN+LV D G 
Sbjct: 4   RTNEPMARHTSFRVGGPADRFVIPESETELREAVLDCKKSGQPWYMIGNGSNLLVGDKGF 63

Query: 81  RGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAA 140
           RG ++         ++ +N   +I GA      LAN+A R  + G  F  GIPG++GGA 
Sbjct: 64  RGTIISTERLAELEVQ-KNENIIIAGAGVMLSKLANTAAREELTGLEFAAGIPGTVGGAV 122

Query: 141 YMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGFP 199
            MNAGA   E    ++    +D+ GN  ++  E+L+  YR+S + +  L       +  P
Sbjct: 123 MMNAGAYGSEMKNVLLWADVMDQDGNVKLMKNEELELGYRTSCLERLGLFTVRAAFKLTP 182

Query: 200 ESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKIS 259
               +I + +  +   R+  QP++  + GSTFK P G+ A +LIE +G +G   GGA +S
Sbjct: 183 GDPEVIRSQMEELARKRKEKQPLEYPSAGSTFKRPEGYFAGKLIEDAGLKGFSVGGAAVS 242

Query: 260 ELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           E H  F+IN D+ T  D+  L  +V+++V   SG+ LE E+K LG+F
Sbjct: 243 EKHAGFVINKDHGTAADILGLCNEVKRRVKASSGVDLELEVKLLGEF 289


>gi|78044048|ref|YP_360886.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|90109774|sp|Q3AAE8|MURB_CARHZ RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|77996163|gb|ABB15062.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 302

 Score =  216 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 94/303 (31%), Positives = 152/303 (50%), Gaps = 4/303 (1%)

Query: 5   RISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IP 63
             ++L  E  K++     EN PL Q T ++ GG A+ + +PQ I +L   +  L  + + 
Sbjct: 2   DKAKLKEELTKRISSPVLENEPLAQHTTWKIGGPADFLIEPQSIEELSLVIRFLTENAVN 61

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
             ++G GSNILV D G R   + +     + +E+    ++   A     +LA  AL+ G+
Sbjct: 62  FRVIGNGSNILVLDRGFR--GVIIKTKKINKVEITAGGQVFAEAGVLLPALAARALKVGL 119

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            G      IPGS+GGA   NAGA+  E    +  V  I+ +G        +  ++YRSS 
Sbjct: 120 SGLEELCAIPGSVGGAIRQNAGAHGKEIKDVLKRVWTINERGELKEFFANECGFKYRSSR 179

Query: 184 ITKD-LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
             ++   I        P  +  I   I      R   QP++    GS FKNP G  AW+L
Sbjct: 180 FKEEKQWIVKAEFSLNPGDKKEILKKIREFREKRLASQPLEFPNAGSVFKNPEGIPAWKL 239

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           I+++G +GL+ GGA +SE H NF+IN   A+  D+ YL  ++++ V+ +  + L  E++ 
Sbjct: 240 IKEAGAQGLKKGGAMVSEKHANFIINTGGASAADVIYLINKIQELVWKKFSVKLLLEVEV 299

Query: 303 LGD 305
           LG+
Sbjct: 300 LGE 302


>gi|296116439|ref|ZP_06835053.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295977032|gb|EFG83796.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 339

 Score =  216 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 119/302 (39%), Positives = 167/302 (55%), Gaps = 6/302 (1%)

Query: 7   SRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITI 66
              L       RG+   + PL   TWFR GG AE++ QP D  DL   L  +P ++P+ +
Sbjct: 18  REDLIRALVDFRGRLTPDAPLGPRTWFRVGGAAELLVQPADARDLALALRHIPLEVPVRV 77

Query: 67  VGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGF 126
           +G  SN ++RD GI GVV+RL               +I GA C   ++A  A   G+ G 
Sbjct: 78  LGACSNTIIRDGGIDGVVIRLGRGFADIAHD--GNGLIAGAACLDMTVAEHAATCGLAGM 135

Query: 127 HFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK 186
            F  GIPG++GGA  MNAGA   + S  +  V  I R G    +P   LK+ YR + + +
Sbjct: 136 EFLAGIPGALGGAVSMNAGAYGSDISNILDWVEIITRDGEALRLPGGALKFSYRHALVPQ 195

Query: 187 DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGH----SAWQL 242
             ++    L G P +   I   IA +   RE  QP++ +TGGSTF+NP        AW+L
Sbjct: 196 GAVVVRTRLCGQPSNGTAIRERIAQIRAAREAAQPVRARTGGSTFRNPAPDISDRKAWEL 255

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           I+ +GCRGL  GGA++SE HCNF++N   AT  +LE LGE+VR +V   +G+ LEWEI+R
Sbjct: 256 IDAAGCRGLTLGGAQVSEKHCNFLLNTGAATAAELEELGERVRARVREHTGVTLEWEIRR 315

Query: 303 LG 304
           +G
Sbjct: 316 IG 317


>gi|67459428|ref|YP_247052.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia felis
           URRWXCal2]
 gi|75536157|sp|Q4UKP0|MURB_RICFE RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|67004961|gb|AAY61887.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia felis
           URRWXCal2]
          Length = 295

 Score =  216 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 129/294 (43%), Positives = 179/294 (60%), Gaps = 2/294 (0%)

Query: 13  RGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSN 72
               ++G++++++ LK +TWF+ GGNAE+ F+P D  DL  FL      +PIT  G GSN
Sbjct: 3   ILPIVKGEYKKDYSLKHLTWFKVGGNAEIFFKPFDSEDLASFLIQNKQKLPITTFGAGSN 62

Query: 73  ILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGI 132
           I++RD GI GV ++L     +   +     +IVG+ C   +LA     + I GF F  GI
Sbjct: 63  IIIRDGGIEGVTIKLGQNFSNIEFIDE--HLIVGSSCLNYNLAKFCQANAITGFEFLVGI 120

Query: 133 PGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITH 192
           PG+IGG   MNAGA + E    +V++  ID  GN      E++ ++YRS+ + KDLII  
Sbjct: 121 PGTIGGGVVMNAGAYDSEFKDIIVKIEAIDFAGNFLTFTNEEIGFKYRSNNLPKDLIILK 180

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
            V +        I   +  + + R   QPIKE+TGGSTF NP G  +W+LI+K+G RG  
Sbjct: 181 AVFKVNKGDSENILLRMNEINNARSATQPIKERTGGSTFANPEGLKSWELIDKAGLRGYR 240

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
            GGA +SELHCNFMIN  +AT  DLE LG+ VR+KVF  SG+ L+WEIKRLG +
Sbjct: 241 IGGASMSELHCNFMINNGDATAKDLEDLGDFVRQKVFEDSGVELKWEIKRLGRY 294


>gi|157964318|ref|YP_001499142.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia massiliae
           MTU5]
 gi|157844094|gb|ABV84595.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia massiliae
           MTU5]
          Length = 325

 Score =  216 bits (551), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 129/292 (44%), Positives = 178/292 (60%), Gaps = 2/292 (0%)

Query: 13  RGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSN 72
               ++G++++++ LK +TWF+ GGNAE+ F+P D  DLK FL      +PI   G GSN
Sbjct: 33  ILPIVKGEYKKDYNLKHLTWFKVGGNAEIFFKPLDREDLKSFLIQNKQKLPIKTFGAGSN 92

Query: 73  ILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGI 132
           I++RD GI GVV++L     +   +     +IVG+ C   +LA     + I GF F  GI
Sbjct: 93  IIIRDGGIEGVVIKLGQNFSNIEFID--NHLIVGSSCLNYNLAKFCQANAISGFEFLVGI 150

Query: 133 PGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITH 192
           PG+IGG   MNAGA   E    +V++  ID  GN      E++ ++YRS+ + K+LII  
Sbjct: 151 PGTIGGGVAMNAGAYGSEFKDIIVQIEAIDFAGNFLTFTNEEIGFKYRSNNLPKNLIILK 210

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
            V +        I   +  + + R + QPIKE+TGGSTF NP G  +W+LI+K G RG  
Sbjct: 211 AVFKINKGDSENILLRMNEINNARSSTQPIKERTGGSTFANPAGRKSWELIDKVGLRGYR 270

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            GGA +SELHCNFMIN  +AT  DLE LG+ VR+KVF  SG+ LEWEIKR+G
Sbjct: 271 IGGASMSELHCNFMINNGDATAKDLEDLGDFVRQKVFEDSGVKLEWEIKRIG 322


>gi|295696462|ref|YP_003589700.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus tusciae DSM
           2912]
 gi|295412064|gb|ADG06556.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus tusciae DSM
           2912]
          Length = 307

 Score =  216 bits (551), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 89/310 (28%), Positives = 156/310 (50%), Gaps = 7/310 (2%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PS 60
           +   +  +L        G+   + P+ + T +R GG A+V+  P++   ++  + L+   
Sbjct: 1   MKEEMWSILSRVDV---GRVLRDEPMARHTTWRIGGPADVLVLPEEQDQIRRLMALVGER 57

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
             P  ++G GSN+LVRD GIRGVV++L++   +    R    ++  +     S AN A+R
Sbjct: 58  GWPWLVIGKGSNLLVRDGGIRGVVVKLADNWSAM--ERKETTVVAQSGRLIVSAANHAIR 115

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
            G+ G  F  GIPGS+GGA  MNAGA+  E    +     +   G+      E+L + YR
Sbjct: 116 WGLSGLEFATGIPGSVGGAVRMNAGAHGGEIRDVLEWADLVFPDGSLIRKSNEELGFGYR 175

Query: 181 SSEITKDLIITHVVLR-GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
           +S + +   +         P     + + +      R   QP+ + + GS F+NP  H A
Sbjct: 176 TSRVAEWGALVVRAAFGLAPGDTAAMVSRVKAWTERRRQTQPLAQASAGSVFRNPVNHYA 235

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LIE++G +G   GGA+IS +H NF++N   AT  D+  L    +++V+ +  + L  E
Sbjct: 236 ARLIEEAGLKGRRVGGAQISPVHANFIVNLGGATAGDVLALIHLAQEEVYRKFAVRLTPE 295

Query: 300 IKRLGDFFDH 309
           ++ +G+  + 
Sbjct: 296 VRIVGEDVET 305


>gi|319404508|emb|CBI78113.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella
           rochalimae ATCC BAA-1498]
          Length = 325

 Score =  216 bits (551), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 156/307 (50%), Positives = 214/307 (69%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPIT 65
           + + L+   + +RGK   N  ++++TWFRTGG AE+ +QP D  DL  F   LP  IP+T
Sbjct: 12  LLKKLQPALRGIRGKLMPNVNMRKVTWFRTGGLAEIFYQPSDEADLVLFFQSLPETIPVT 71

Query: 66  IVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGG 125
           IVG+GSN+LVRD GI G+V+RLS  GF  ++  +    +VGA  +GK LA +AL   + G
Sbjct: 72  IVGIGSNLLVRDGGIPGIVVRLSAKGFGQLKQVSSKRFLVGAAVAGKHLAAAALEAELSG 131

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT 185
           FHF++GIPG  GGA  MNAGAN  ET++ VVEV+ +DRKG +H++    + Y YR  ++ 
Sbjct: 132 FHFYHGIPGGCGGALKMNAGANGIETAERVVEVYALDRKGQRHILSVNDIHYSYRCCDVP 191

Query: 186 KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEK 245
            D +    +L G   +++ I AA+  V  HR+ VQPI+EKTGGSTF+NP G SAW++I++
Sbjct: 192 DDFVFVAALLEGEQGNRHHIRAAMEEVALHRQKVQPIREKTGGSTFRNPVGTSAWRVIDE 251

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +GCRGL+ GGA++SE+HCNFMIN D ATGYDLE LGE VR +VF  SG LL+WEI+R+G 
Sbjct: 252 AGCRGLKIGGAQMSEMHCNFMINIDQATGYDLEKLGETVRARVFAHSGHLLQWEIQRIGQ 311

Query: 306 FFDHQIV 312
           F   +IV
Sbjct: 312 FEQDRIV 318


>gi|51473446|ref|YP_067203.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia typhi
           str. Wilmington]
 gi|81390202|sp|Q68XC1|MURB_RICTY RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|51459758|gb|AAU03721.1| UDP-GlcNAc-enoylpyruvate reductase [Rickettsia typhi str.
           Wilmington]
          Length = 295

 Score =  216 bits (551), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 126/294 (42%), Positives = 177/294 (60%), Gaps = 2/294 (0%)

Query: 13  RGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSN 72
               ++G++++++ LK +TWF+ GGNAE+ F+P D  DLK FL      +PIT  G GSN
Sbjct: 3   ILPIIKGEYKKDYNLKHLTWFKVGGNAEIFFKPFDSADLKSFLIQNNKKLPITTFGSGSN 62

Query: 73  ILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGI 132
           I++RD GI GVV++L     +   +     +IVG+ C   +LA     + I GF F  GI
Sbjct: 63  IIIRDGGIEGVVIKLGKNFNNIEFLD--NHLIVGSSCLNYNLAKFCQANAISGFEFLVGI 120

Query: 133 PGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITH 192
           PG+IGG   MNAGA        +V++  +D  GN      +++ ++YR + + KDLI+  
Sbjct: 121 PGTIGGGVVMNAGAYGSAFQDIIVQIEALDFLGNFLTFTNKEIGFKYRGNNLPKDLILLK 180

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
            + +        I   +  +   R + QPIKE+TGGSTFKNP G  +W+LI+K+G RG  
Sbjct: 181 AIFKANKGDSQNILLKMNKINTTRSSTQPIKERTGGSTFKNPVGCKSWELIDKAGLRGYR 240

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
            GGA +SELHCNFMIN  NAT  DLE LG  VR+KVF  SG+ L WEIKR+G +
Sbjct: 241 IGGASMSELHCNFMINNGNATAKDLEDLGNFVRQKVFEDSGVELNWEIKRIGKY 294


>gi|324990788|gb|EGC22723.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK353]
 gi|325687982|gb|EGD30002.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK72]
 gi|327459738|gb|EGF06078.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK1057]
 gi|332361377|gb|EGJ39181.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK1056]
          Length = 301

 Score =  216 bits (551), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 98/302 (32%), Positives = 151/302 (50%), Gaps = 6/302 (1%)

Query: 7   SRLLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPI 64
            + L +   +L G   + N PL Q T+ + GG A+ +  P++ ++L   +      DIP 
Sbjct: 1   MQKLEKLKSELEGIDIRFNEPLSQYTYTKVGGAADFLVFPRNRYELARIVNFANQEDIPW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G  SNI+VRD GIRG V+         +   +   +   A  +     + AL++ + 
Sbjct: 61  MVLGNASNIIVRDGGIRGFVIMFDKLNNVAV---DGYMIEAEAGANLIQTTHIALQNSLT 117

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           GF F  GIPGS+GGA +MNAGA   E +  +V    +  +G    +    +K+ YR S +
Sbjct: 118 GFEFACGIPGSVGGAVFMNAGAYGGEIAHVLVSCKVLTPQGQVKTLDVRDMKFGYRHSLV 177

Query: 185 TK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            +   I+        P     I   +  + H RE  QP++  + GS FK P GH A QLI
Sbjct: 178 QETGDIVISAKFALSPGVHRTIRQEMERLTHLRELKQPLEYPSCGSVFKRPLGHFAGQLI 237

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
            ++G +G   GG ++SE H  FMIN D  T  D E L   V ++V   SGI LE E++ +
Sbjct: 238 SEAGLKGHRIGGVEVSEKHAGFMINVDKGTAQDYENLIAHVIERVRENSGITLEREVRII 297

Query: 304 GD 305
           G+
Sbjct: 298 GE 299


>gi|187609765|sp|A8F109|MURB_RICM5 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
          Length = 295

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 129/292 (44%), Positives = 178/292 (60%), Gaps = 2/292 (0%)

Query: 13  RGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSN 72
               ++G++++++ LK +TWF+ GGNAE+ F+P D  DLK FL      +PI   G GSN
Sbjct: 3   ILPIVKGEYKKDYNLKHLTWFKVGGNAEIFFKPLDREDLKSFLIQNKQKLPIKTFGAGSN 62

Query: 73  ILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGI 132
           I++RD GI GVV++L     +   +     +IVG+ C   +LA     + I GF F  GI
Sbjct: 63  IIIRDGGIEGVVIKLGQNFSNIEFID--NHLIVGSSCLNYNLAKFCQANAISGFEFLVGI 120

Query: 133 PGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITH 192
           PG+IGG   MNAGA   E    +V++  ID  GN      E++ ++YRS+ + K+LII  
Sbjct: 121 PGTIGGGVAMNAGAYGSEFKDIIVQIEAIDFAGNFLTFTNEEIGFKYRSNNLPKNLIILK 180

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
            V +        I   +  + + R + QPIKE+TGGSTF NP G  +W+LI+K G RG  
Sbjct: 181 AVFKINKGDSENILLRMNEINNARSSTQPIKERTGGSTFANPAGRKSWELIDKVGLRGYR 240

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            GGA +SELHCNFMIN  +AT  DLE LG+ VR+KVF  SG+ LEWEIKR+G
Sbjct: 241 IGGASMSELHCNFMINNGDATAKDLEDLGDFVRQKVFEDSGVKLEWEIKRIG 292


>gi|283470031|emb|CAQ49242.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus ST398]
          Length = 307

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 97/307 (31%), Positives = 160/307 (52%), Gaps = 7/307 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-P 59
           MI   I + L++       K + + PLK+ T+ +TGGNA+    P    +++  +     
Sbjct: 1   MINKDIYQALQQLIPN--EKIKVDEPLKRYTYTKTGGNADFYITPTKNEEVQAVVKYAYQ 58

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
           ++IP+T +G GSNI++R+ GIRG+V+ L +     +       +I G+  +   ++  A 
Sbjct: 59  NEIPVTYLGNGSNIIIREGGIRGIVISLLSLDHIEVSDDA---IIAGSGAAIIDVSRVAR 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            + + G  F  GIPGSIGGA YMNAGA   E    +     ++ +G+      ++L+  Y
Sbjct: 116 DYALTGLEFACGIPGSIGGAVYMNAGAYGGEVKDCIDYALCVNEQGSLIKFTTKELELDY 175

Query: 180 RSSEITKDL-IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R+S I K+  ++        P     I A + ++   RE+ QP++  + GS F+ P GH 
Sbjct: 176 RNSIIQKEHLVVLEAAFTLAPGKMTEIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI+ S  +G   GG ++S  H  FM+N DN T  D E L   V+K V  + GI L  
Sbjct: 236 AGKLIQDSNLQGHRIGGVEVSTKHAGFMVNVDNGTATDYENLIHYVQKTVKEKFGIELNR 295

Query: 299 EIKRLGD 305
           E++ +G+
Sbjct: 296 EVRIIGE 302


>gi|227891146|ref|ZP_04008951.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           salivarius ATCC 11741]
 gi|227867020|gb|EEJ74441.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           salivarius ATCC 11741]
          Length = 299

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 88/307 (28%), Positives = 148/307 (48%), Gaps = 11/307 (3%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP- 59
           M    +  L  +         + +  LK+ T  +TGG A+V+  P  I + +  + +   
Sbjct: 1   MTTNDLRELFLDL------NVKFDEELKKYTNTKTGGKADVLAFPDSIEETEKLIKIAKK 54

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
           +++P+TI+G  SN++V+D GIRG+V+ L +     +   +  ++   A  S       A 
Sbjct: 55  NNVPLTILGNASNLIVKDGGIRGLVVILQHLNQITV---DGTKVTAQAGASLIGTTRVAA 111

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
           +H + G  F  GIPGSIGGA +MNAGA   E    V  V  + R G       ++L + Y
Sbjct: 112 KHSLTGMEFASGIPGSIGGAIFMNAGAYGGEIKNIVESVKLLTRNGEYKTYTVDELDFGY 171

Query: 180 RSSEIT-KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S +  +D I+     +        I   +  +   R + QP++  + GS FK P GH 
Sbjct: 172 RHSRLQSEDDIVVAATFKLEHGDIKKIRERMEELSFLRASKQPLEYPSCGSVFKRPAGHF 231

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
             +L+  SG +G   GG ++S+ H  F++N  N TG D   +   V+  V  +  + LE 
Sbjct: 232 TGKLVHDSGLQGYTVGGVQVSKKHAGFIVNIGNGTGKDYLDVIHHVQAVVKEKFDVELET 291

Query: 299 EIKRLGD 305
           E++ +G+
Sbjct: 292 EVRIIGE 298


>gi|332366598|gb|EGJ44342.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK1059]
          Length = 301

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 98/302 (32%), Positives = 151/302 (50%), Gaps = 6/302 (1%)

Query: 7   SRLLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPI 64
            + L +   +L G   + N PL Q T+ + GG A+ +  P++ ++L   +      DIP 
Sbjct: 1   MQKLEKLKSELEGIDIRFNEPLSQYTYTKVGGAADFLVFPRNRYELARIVNFANQEDIPW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G  SNI+VRD GIRG V+         +   +   +   A  +     + AL++ + 
Sbjct: 61  MVLGNASNIIVRDGGIRGFVIMFDKLNNVAV---DGYMIEAEAGANLIQTTHIALQNSLT 117

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           GF F  GIPGS+GGA +MNAGA   E +  +V    +  +G    +    +K+ YR S +
Sbjct: 118 GFEFACGIPGSVGGAVFMNAGAYGGEIAHVLVSCKVLTPQGQLKTLDVRDMKFGYRHSLV 177

Query: 185 TK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            +   I+        P     I   +  + H RE  QP++  + GS FK P GH A QLI
Sbjct: 178 QETGDIVISAKFALSPGVHRTIRQEMERLTHLRELKQPLEYPSCGSVFKRPLGHFAGQLI 237

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
            ++G +G   GG ++SE H  FMIN D  T  D E L   V ++V   SGI LE E++ +
Sbjct: 238 SEAGLKGHRIGGVEVSEKHAGFMINVDKGTAQDYENLIAHVIERVRENSGITLEREVRII 297

Query: 304 GD 305
           G+
Sbjct: 298 GE 299


>gi|311068044|ref|YP_003972967.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus atrophaeus
           1942]
 gi|310868561|gb|ADP32036.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus atrophaeus
           1942]
          Length = 303

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 101/303 (33%), Positives = 165/303 (54%), Gaps = 5/303 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           + ++++E   +  GK  EN PL   T  + GG A+++  P  +  +K  + ++   DI  
Sbjct: 1   MEKVIQELKDREVGKVLENEPLANHTTMKIGGPADILVIPNRVEAVKDIMDIIKKHDIKW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T++G GSN+LV D GIRGVV++L           N  ++ VG   S   LA S  + G+ 
Sbjct: 61  TVIGRGSNLLVLDEGIRGVVIKLGAGLD--HLELNEDQVAVGGGYSVVRLATSMSKKGLS 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGSIGGA YMNAGA+  + S+ +V+ H +   G    + +E++++ YR+S +
Sbjct: 119 GLEFAAGIPGSIGGAVYMNAGAHGSDMSEILVKAHILFEDGTIKWLTKEEMEFSYRTSVL 178

Query: 185 TKDLIITHVVL--RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
            K      +    +   + +  I   + N   +R+  QP      GS F+NP  + A  L
Sbjct: 179 QKKRPGVCLEAVLQLEQKDREGIVQQMQNNKDYRKNTQPYSSPCAGSIFRNPLPNHAGNL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           +EK+G +G + GGAKISE+H NF++NA  A+  D+  L + V+K +  Q  I +  E++ 
Sbjct: 239 VEKAGLKGYQIGGAKISEMHGNFIVNAGGASAKDVLDLIDYVKKTIREQYEIDMHTEVEI 298

Query: 303 LGD 305
           +G+
Sbjct: 299 VGE 301


>gi|170744730|ref|YP_001773385.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacterium sp.
           4-46]
 gi|168199004|gb|ACA20951.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Methylobacterium sp.
           4-46]
          Length = 304

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 130/287 (45%), Positives = 185/287 (64%), Gaps = 1/287 (0%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRD 77
           RG+   + PL  +TWFR GG A+++F P D  DL   L  LP+++P+T++GLGSN++VRD
Sbjct: 16  RGRLLPDHPLADLTWFRVGGPADLLFTPADEEDLAAALRALPAEVPVTVIGLGSNLIVRD 75

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G+RG+V+RL    F +IE+     +  GA      LA +A   G+ G  F+ GIPGS+G
Sbjct: 76  GGVRGLVIRLGGRAFGSIEIEGDT-VRAGAAVPDVRLARAAAEAGLDGMAFYRGIPGSVG 134

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRG 197
           GA  MNAGA+  ET+  +VE  G+ R+G        ++ + YR + + + ++ T  + RG
Sbjct: 135 GALRMNAGAHGGETTDVLVEARGVTREGEIRRFGHAEMGFSYRHAAVPESVVFTGALFRG 194

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P  +  I A +  V   RE  QPI+E+TGGSTFKNP G  AWQLI+ +GCRGL  GGA+
Sbjct: 195 RPGDRAAILAEMDRVTAAREAAQPIRERTGGSTFKNPEGRKAWQLIDAAGCRGLRRGGAQ 254

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           +SE+HCNF+IN   A+  ++E LGE+VR +V  QSG+ L WEIKR+G
Sbjct: 255 VSEMHCNFLINTGGASAAEIEGLGEEVRARVRAQSGVELHWEIKRIG 301


>gi|300214809|gb|ADJ79225.1| UDP-N-acetylenolpyruvoylglucosamine reductase (UDP-N-acetylmuramate
           dehydrogenase) [Lactobacillus salivarius CECT 5713]
          Length = 299

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 88/307 (28%), Positives = 148/307 (48%), Gaps = 11/307 (3%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP- 59
           M    +  L  +         + +  LK+ T  +TGG A+V+  P  I + +  + +   
Sbjct: 1   MTTNDLRELFLDL------NVKFDEELKKYTNTKTGGKADVLAFPDSIEETEKLIKIAKK 54

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
           +++P+TI+G  SN++V+D GIRG+V+ L +     +   +  ++   A  S       A 
Sbjct: 55  NNVPLTILGNASNLIVKDGGIRGLVVILQHLDQITV---DGTKVTAQAGASLIGTTRVAA 111

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
           +H + G  F  GIPGSIGGA +MNAGA   E    V  V  + R G       ++L + Y
Sbjct: 112 KHSLTGMEFASGIPGSIGGAIFMNAGAYGGEIKNIVESVKLLTRNGEYKTYTVDELDFGY 171

Query: 180 RSSEIT-KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S +  +D I+     +        I   +  +   R + QP++  + GS FK P GH 
Sbjct: 172 RHSRLQSEDDIVVAATFKLEHGDIKKIRERMEELSFLRASKQPLEYPSCGSVFKRPAGHF 231

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
             +L+  SG +G   GG ++S+ H  F++N  N TG D   +   V+  V  +  + LE 
Sbjct: 232 TGKLVHDSGLQGYTVGGVQVSKKHAGFIVNIGNGTGKDYLDVIHHVQAVVKEKFDVELET 291

Query: 299 EIKRLGD 305
           E++ +G+
Sbjct: 292 EVRIIGE 298


>gi|15923728|ref|NP_371262.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus Mu50]
 gi|15926415|ref|NP_373948.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus N315]
 gi|148267198|ref|YP_001246141.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus JH9]
 gi|150393247|ref|YP_001315922.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus JH1]
 gi|156979066|ref|YP_001441325.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus Mu3]
 gi|253315829|ref|ZP_04839042.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus str. CF-Marseille]
 gi|255005529|ref|ZP_05144130.2| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus Mu50-omega]
 gi|257794941|ref|ZP_05643920.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A9781]
 gi|258418257|ref|ZP_05682522.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A9763]
 gi|258421554|ref|ZP_05684479.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A9719]
 gi|258430749|ref|ZP_05688461.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus A9299]
 gi|258441759|ref|ZP_05691031.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus A8115]
 gi|258445800|ref|ZP_05693977.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A6300]
 gi|258449611|ref|ZP_05697713.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A6224]
 gi|258454011|ref|ZP_05701983.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus A5937]
 gi|269202358|ref|YP_003281627.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus ED98]
 gi|282894507|ref|ZP_06302736.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A8117]
 gi|282926604|ref|ZP_06334234.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A10102]
 gi|295406460|ref|ZP_06816266.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A8819]
 gi|297245186|ref|ZP_06929060.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A8796]
 gi|54037852|sp|P65463|MURB_STAAN RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|54041502|sp|P65462|MURB_STAAM RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|166222851|sp|A7WZM9|MURB_STAA1 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|189028928|sp|A6TZL7|MURB_STAA2 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|189028929|sp|A5IQU2|MURB_STAA9 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|13700629|dbj|BAB41926.1| SA0693 [Staphylococcus aureus subsp. aureus N315]
 gi|14246507|dbj|BAB56900.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus Mu50]
 gi|147740267|gb|ABQ48565.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus JH9]
 gi|149945699|gb|ABR51635.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus JH1]
 gi|156721201|dbj|BAF77618.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu3]
 gi|257788913|gb|EEV27253.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A9781]
 gi|257839050|gb|EEV63529.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A9763]
 gi|257842480|gb|EEV66904.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A9719]
 gi|257849421|gb|EEV73391.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus A9299]
 gi|257852228|gb|EEV76155.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus A8115]
 gi|257855376|gb|EEV78314.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A6300]
 gi|257857119|gb|EEV80018.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A6224]
 gi|257863876|gb|EEV86632.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus A5937]
 gi|262074648|gb|ACY10621.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus ED98]
 gi|282591497|gb|EFB96569.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A10102]
 gi|282763220|gb|EFC03351.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A8117]
 gi|285816440|gb|ADC36927.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus 04-02981]
 gi|294968605|gb|EFG44628.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A8819]
 gi|297177857|gb|EFH37106.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A8796]
 gi|312829230|emb|CBX34072.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus ECT-R 2]
 gi|315129421|gb|EFT85414.1| hypothetical protein CGSSa03_00430 [Staphylococcus aureus subsp.
           aureus CGS03]
 gi|329724631|gb|EGG61138.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus 21172]
          Length = 307

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 97/307 (31%), Positives = 162/307 (52%), Gaps = 7/307 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-P 59
           MI   I + L++       K + + PLK+ T+ +TGGNA+    P    +++  +     
Sbjct: 1   MINKDIYQALQQLIPN--EKIKVDEPLKRYTYTKTGGNADFYITPTKNEEVQAVVKYAYQ 58

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
           ++IP+T +G GSNI++R+ GIRG+V+ L +    ++       +I G+  +   ++  A 
Sbjct: 59  NEIPVTYLGNGSNIIIREGGIRGIVISLLSLDHIDVSDDA---IIAGSGAAIIDVSRVAR 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            + + G  F  GIPGSIGGA YMNAGA   E    +     ++ +G+   +  ++L+  Y
Sbjct: 116 DYALTGLEFACGIPGSIGGAVYMNAGAYGGEVKDCIDYALCVNEQGSLIKLTTKELELDY 175

Query: 180 RSSEITKDL-IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R+S I K+  ++        P     I A + ++   RE+ QP++  + GS F+ P GH 
Sbjct: 176 RNSIIQKEHLVVLEAAFTLAPGKMTEIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI+ S  +G   GG ++S  H  FM+N DN T  D E L   V+K V  + GI L  
Sbjct: 236 AGKLIQDSNLQGHRIGGVEVSTKHAGFMVNVDNGTATDYENLIHYVQKTVKEKFGIELNR 295

Query: 299 EIKRLGD 305
           E++ +G+
Sbjct: 296 EVRIIGE 302


>gi|57651576|ref|YP_185675.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus COL]
 gi|71151972|sp|Q5HHT2|MURB_STAAC RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|57285762|gb|AAW37856.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus COL]
          Length = 307

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 98/307 (31%), Positives = 162/307 (52%), Gaps = 7/307 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-P 59
           MI   I + L++       K + + PLK+ T+ +TGGNA+    P    +++  +     
Sbjct: 1   MINKDIYQALQQLIPN--EKIKVDEPLKRYTYTKTGGNADFYITPTKNEEVQAVVKYAYQ 58

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
           ++IP+T +G GSNI++R+ GIRG+V+ L +     +       +I G+  +   ++  AL
Sbjct: 59  NEIPVTYLGNGSNIIIREGGIRGIVISLLSLDHIEVSDDA---IIAGSGAAIIDVSRVAL 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            + + G  F  GIPGSIGGA YMNAGA   E    +     ++ +G+   +  ++L+  Y
Sbjct: 116 DYALTGLEFACGIPGSIGGAVYMNAGAYGGEVKDCIDYALCVNEQGSLIKLTTKELELDY 175

Query: 180 RSSEITKDL-IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R+S I K+  ++        P     I A + ++   RE+ QP++  + GS F+ P GH 
Sbjct: 176 RNSIIQKEHLVVLEAAFTLAPGKMTEIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI+ S  +G   GG ++S  H  FM+N DN T  D E L   V+K V  + GI L  
Sbjct: 236 AGKLIQDSNLQGHRIGGVEVSTKHAGFMVNVDNGTATDYENLIHYVQKTVKEKFGIELNR 295

Query: 299 EIKRLGD 305
           E++ +G+
Sbjct: 296 EVRIIGE 302


>gi|326388920|ref|ZP_08210502.1| UDP-N-acetylmuramate dehydrogenase [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326206520|gb|EGD57355.1| UDP-N-acetylmuramate dehydrogenase [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 298

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 119/293 (40%), Positives = 176/293 (60%), Gaps = 1/293 (0%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRD 77
           RGK   + PL  + WF+ GG A+ +F+P D  DL+ FL  L  +IP+  +GLGSN++VRD
Sbjct: 5   RGKLTADAPLAPLVWFKAGGAAQWLFEPADTADLQDFLAFLAPEIPVMALGLGSNLIVRD 64

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G+ GVV+RL  A  + ++  +   +  G   SG  ++++A  +GI G  F   IPG++G
Sbjct: 65  GGVPGVVVRLGKAF-AGVKALDGVTLECGGGASGVLVSSTARDNGIAGLEFLRSIPGTVG 123

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRG 197
           G   MN GA   E    +V+   + R G    +    L Y YR S++ +  I+     RG
Sbjct: 124 GFVRMNGGAYGREVKDILVDCDVVLRSGALVTLSLADLGYAYRHSDLAEGAIVVAARFRG 183

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P     I A +  +   RE  QP++ +TGGSTFKNP GH AW+L++++GCRGLE GGA+
Sbjct: 184 EPGDPAAIQAEMERIAAAREASQPLRTRTGGSTFKNPDGHRAWELVDRAGCRGLELGGAQ 243

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQ 310
           +SE H NF+IN   AT  ++E LGE VR++V + +G+ L WEIKR+G+  + Q
Sbjct: 244 VSEKHTNFLINTGEATSAEIEALGELVRQRVKDATGVELHWEIKRVGNKSEDQ 296


>gi|332360328|gb|EGJ38140.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK49]
          Length = 301

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 98/302 (32%), Positives = 151/302 (50%), Gaps = 6/302 (1%)

Query: 7   SRLLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPI 64
            + L +   +L G   + N PL Q T+ + GG A+ +  P++ ++L   +      DIP 
Sbjct: 1   MQKLEKLKSELEGIDIRFNEPLSQYTYTKVGGAADFLVFPRNRYELARIVNFANQEDIPW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G  SNI+VRD GIRG V+         +   +   +   A  +     + AL++ + 
Sbjct: 61  MVLGNASNIIVRDGGIRGFVIMFDKLNNVAV---DGYMIEAEAGANLIQTTHIALQNSLT 117

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           GF F  GIPGS+GGA +MNAGA   E +  +V    +  +G    +    +K+ YR S +
Sbjct: 118 GFEFACGIPGSVGGAVFMNAGAYGGEIAHVLVSCKVLTPQGEVKTLDVRDMKFGYRHSLV 177

Query: 185 TK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            +   I+        P     I   +  + H RE  QP++  + GS FK P GH A QLI
Sbjct: 178 QETGDIVISAKFALSPGVHRTIRQEMERLTHLRELKQPLEYPSCGSVFKRPLGHFAGQLI 237

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
            ++G +G   GG ++SE H  FMIN D  T  D E L   V ++V   SGI LE E++ +
Sbjct: 238 SEAGLKGHRIGGVEVSEKHAGFMINVDKGTAQDYENLIAHVIERVRENSGITLEREVRII 297

Query: 304 GD 305
           G+
Sbjct: 298 GE 299


>gi|327473935|gb|EGF19348.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK408]
          Length = 301

 Score =  216 bits (550), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 98/302 (32%), Positives = 151/302 (50%), Gaps = 6/302 (1%)

Query: 7   SRLLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPI 64
            + L +   +L G   + N PL Q T+ + GG A+ +  P++ ++L   +      DIP 
Sbjct: 1   MQKLEKLKTELEGIDIRFNEPLSQYTYTKVGGAADFLVFPRNRYELARVVNFANQEDIPW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G  SNI+VRD GIRG V+         +   +   +   A  +     + AL++ + 
Sbjct: 61  MVLGNASNIIVRDGGIRGFVIMFDKLNNVTV---DGYMIEAEAGANLIQTTHIALQNSLT 117

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           GF F  GIPGS+GGA +MNAGA   E +  +V    +  +G    +    +K+ YR S +
Sbjct: 118 GFEFACGIPGSVGGAVFMNAGAYGGEIAHVLVSCKVLTPQGQVKTLDVRDMKFGYRHSLV 177

Query: 185 TK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            +   I+        P     I   +  + H RE  QP++  + GS FK P GH A QLI
Sbjct: 178 QETGDIVISAKFALSPGVHRTIRQEMERLTHLRELKQPLEYPSCGSVFKRPLGHFAGQLI 237

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
            ++G +G   GG ++SE H  FMIN D  T  D E L   V ++V   SGI LE E++ +
Sbjct: 238 SEAGLKGHRIGGVEVSEKHAGFMINVDKGTAQDYENLIAHVIERVRENSGITLEREVRII 297

Query: 304 GD 305
           G+
Sbjct: 298 GE 299


>gi|323485853|ref|ZP_08091188.1| hypothetical protein HMPREF9474_02939 [Clostridium symbiosum
           WAL-14163]
 gi|323400841|gb|EGA93204.1| hypothetical protein HMPREF9474_02939 [Clostridium symbiosum
           WAL-14163]
          Length = 304

 Score =  216 bits (550), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 104/289 (35%), Positives = 148/289 (51%), Gaps = 3/289 (1%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVR 76
            G+   +  + + T FR GG A     P     LK  L L   + +P  I+G GSN+LV 
Sbjct: 14  NGQVTRDEMMNRHTTFRVGGPASYFVSPDGDEALKKVLLLCREEQMPYYILGNGSNLLVS 73

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G  G V+ L   GF+ I      E+  GA      +A  A  H + GF F  GIPG++
Sbjct: 74  DKGYGG-VMILMGEGFAQIREDVSGELAAGAGVLLSRIAREAQEHSLTGFEFAAGIPGTL 132

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVL 195
           GGA  MNAGA + E    +  V  +D+ G    +   +L+  YR S I  K+ I+   V+
Sbjct: 133 GGAVVMNAGAYDGEMKNVLKTVRVMDKNGRILELSANELELGYRRSCIQEKEYIVLSAVI 192

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
                 +  I   +A +   R   QP++  + GSTFK P G+ A +LIE +G RG   GG
Sbjct: 193 TLKQGDKEAIQTKMAELAGKRRDKQPLEYPSAGSTFKRPAGYFAGKLIEDAGLRGYREGG 252

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           A++SE HC F+IN+  AT  D+  L   V+KKV   SG+ LE E++ +G
Sbjct: 253 AQVSEKHCGFVINSGGATAEDIRLLCRSVQKKVKETSGVDLETEVRMIG 301


>gi|301301250|ref|ZP_07207405.1| UDP-N-acetylmuramate dehydrogenase [Lactobacillus salivarius
           ACS-116-V-Col5a]
 gi|300851126|gb|EFK78855.1| UDP-N-acetylmuramate dehydrogenase [Lactobacillus salivarius
           ACS-116-V-Col5a]
          Length = 299

 Score =  216 bits (550), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 88/307 (28%), Positives = 148/307 (48%), Gaps = 11/307 (3%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP- 59
           M    +  L  +         + +  LK+ T  +TGG A+V+  P  I + +  + +   
Sbjct: 1   MTTNDLRELFLDL------NVKFDEELKKYTNTKTGGKADVLAFPDSIEETEKLIKIAKK 54

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
           +++P+TI+G  SN++V+D GIRG+V+ L +     +   +  ++   A  S       A 
Sbjct: 55  NNVPLTILGNASNLIVKDGGIRGLVVILQHLDQITV---DGTKVTAQAGASLIGTTRVAA 111

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
           +H + G  F  GIPGSIGGA +MNAGA   E    V  V  + R G       ++L + Y
Sbjct: 112 KHSLTGMEFASGIPGSIGGAIFMNAGAYGGEIKNIVESVKLLTRDGEYKTYTVDELDFGY 171

Query: 180 RSSEIT-KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S +  +D I+     +        I   +  +   R + QP++  + GS FK P GH 
Sbjct: 172 RHSRLQSEDDIVVAATFKLEHGDIKKIRERMEELSFLRASKQPLEYPSCGSVFKRPAGHF 231

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
             +L+  SG +G   GG ++S+ H  F++N  N TG D   +   V+  V  +  + LE 
Sbjct: 232 TGKLVHDSGLQGYTVGGVQVSKKHAGFIVNIGNGTGKDYLDVIHHVQAVVKEKFDVELET 291

Query: 299 EIKRLGD 305
           E++ +G+
Sbjct: 292 EVRIIGE 298


>gi|328946192|gb|EGG40337.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK1087]
          Length = 301

 Score =  216 bits (550), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 97/302 (32%), Positives = 151/302 (50%), Gaps = 6/302 (1%)

Query: 7   SRLLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPI 64
            + L +   +L G   + N PL Q T+ + GG A+ +  P++ ++L   +      DIP 
Sbjct: 1   MQKLEKLKSELEGIDIRFNEPLSQYTYTKVGGAADFLVFPRNRYELARIVNFANQEDIPW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G  SNI+VRD GIRG V+         +   +   +   A  +     + A+++ + 
Sbjct: 61  MVLGNASNIIVRDGGIRGFVIMFDKLNNVAV---DGYMIEAEAGANLIQTTHIAMQNSLT 117

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           GF F  GIPGS+GGA +MNAGA   E +  +V    +  +G    +    +K+ YR S +
Sbjct: 118 GFEFACGIPGSVGGAVFMNAGAYGGEIAHVLVSCKVLTPQGQVKTLDVRDMKFGYRHSLV 177

Query: 185 TK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            +   I+        P     I   +  + H RE  QP++  + GS FK P GH A QLI
Sbjct: 178 QETGDIVISAKFALSPGVHRTIRQEMERLTHLRELKQPLEYPSCGSVFKRPLGHFAGQLI 237

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
            ++G +G   GG ++SE H  FMIN D  T  D E L   V ++V   SGI LE E++ +
Sbjct: 238 SEAGLKGHRIGGVEVSEKHAGFMINVDKGTAQDYENLIAHVIERVRENSGITLEREVRII 297

Query: 304 GD 305
           G+
Sbjct: 298 GE 299


>gi|21282429|ref|NP_645517.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus MW2]
 gi|49485610|ref|YP_042831.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus MSSA476]
 gi|82750442|ref|YP_416183.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus RF122]
 gi|87161900|ref|YP_493425.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus USA300_FPR3757]
 gi|88194516|ref|YP_499311.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus NCTC 8325]
 gi|151220919|ref|YP_001331741.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus str. Newman]
 gi|161509005|ref|YP_001574664.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus USA300_TCH1516]
 gi|221140823|ref|ZP_03565316.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus str. JKD6009]
 gi|253731366|ref|ZP_04865531.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_TCH959]
 gi|253732814|ref|ZP_04866979.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus TCH130]
 gi|258452946|ref|ZP_05700940.1| UDP-N-acetylenolpyruvylglucosamine reductase [Staphylococcus aureus
           A5948]
 gi|262049522|ref|ZP_06022392.1| hypothetical protein SAD30_0944 [Staphylococcus aureus D30]
 gi|262052338|ref|ZP_06024541.1| hypothetical protein SA930_1064 [Staphylococcus aureus 930918-3]
 gi|282922035|ref|ZP_06329732.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A9765]
 gi|284023759|ref|ZP_06378157.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus 132]
 gi|294850524|ref|ZP_06791252.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A9754]
 gi|297208535|ref|ZP_06924964.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus ATCC 51811]
 gi|300912627|ref|ZP_07130070.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus TCH70]
 gi|304381643|ref|ZP_07364292.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus ATCC BAA-39]
 gi|47606433|sp|P61431|MURB_STAAU RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|47606434|sp|P61432|MURB_STAAW RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|56749208|sp|Q6GB92|MURB_STAAS RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|122540001|sp|Q2G069|MURB_STAA8 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|123486787|sp|Q2FIQ3|MURB_STAA3 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|123547697|sp|Q2YSJ1|MURB_STAAB RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|172048792|sp|A6QF47|MURB_STAAE RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|189028930|sp|A8Z012|MURB_STAAT RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|15419942|gb|AAK97215.1|AF300988_1 UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus]
 gi|21203866|dbj|BAB94565.1| MW0700 [Staphylococcus aureus subsp. aureus MW2]
 gi|28201238|dbj|BAC56587.1| UDP-N-acetylenolpyruvylglucosamine reductase [Staphylococcus
           aureus]
 gi|49244053|emb|CAG42479.1| putative UDP-N-acetylenolpyruvoylglucosamine reductase
           [Staphylococcus aureus subsp. aureus MSSA476]
 gi|82655973|emb|CAI80378.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus RF122]
 gi|87127874|gb|ABD22388.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus USA300_FPR3757]
 gi|87202074|gb|ABD29884.1| UDP-N-acetylenolpyruvoylglucosamine reductase, putative
           [Staphylococcus aureus subsp. aureus NCTC 8325]
 gi|150373719|dbj|BAF66979.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus str. Newman]
 gi|160367814|gb|ABX28785.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|253724891|gb|EES93620.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_TCH959]
 gi|253729179|gb|EES97908.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus TCH130]
 gi|257859457|gb|EEV82311.1| UDP-N-acetylenolpyruvylglucosamine reductase [Staphylococcus aureus
           A5948]
 gi|259159778|gb|EEW44819.1| hypothetical protein SA930_1064 [Staphylococcus aureus 930918-3]
 gi|259162358|gb|EEW46930.1| hypothetical protein SAD30_0944 [Staphylococcus aureus D30]
 gi|269940315|emb|CBI48692.1| putative UDP-N-acetylenolpyruvoylglucosaminereductase
           [Staphylococcus aureus subsp. aureus TW20]
 gi|282593693|gb|EFB98685.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A9765]
 gi|294822603|gb|EFG39044.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A9754]
 gi|296886790|gb|EFH25694.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus ATCC 51811]
 gi|298694070|gb|ADI97292.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus ED133]
 gi|300886873|gb|EFK82075.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus TCH70]
 gi|302750634|gb|ADL64811.1| putative UDP-N-acetylenolpyruvoylglucosamine reductase
           [Staphylococcus aureus subsp. aureus str. JKD6008]
 gi|304339746|gb|EFM05691.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus ATCC BAA-39]
 gi|315196412|gb|EFU26763.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus CGS01]
 gi|320139929|gb|EFW31790.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus MRSA131]
 gi|320141980|gb|EFW33808.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus MRSA177]
 gi|329313459|gb|AEB87872.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus T0131]
 gi|329723775|gb|EGG60303.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus 21189]
 gi|329729649|gb|EGG66050.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus 21193]
          Length = 307

 Score =  216 bits (550), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 97/307 (31%), Positives = 161/307 (52%), Gaps = 7/307 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-P 59
           MI   I + L++       K + + PLK+ T+ +TGGNA+    P    +++  +     
Sbjct: 1   MINKDIYQALQQLIPN--EKIKVDEPLKRYTYTKTGGNADFYITPTKNEEVQAVVKYAYQ 58

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
           ++IP+T +G GSNI++R+ GIRG+V+ L +     +       +I G+  +   ++  A 
Sbjct: 59  NEIPVTYLGNGSNIIIREGGIRGIVISLLSLDHIEVSDDA---IIAGSGAAIIDVSRVAR 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            + + G  F  GIPGSIGGA YMNAGA   E    +     ++ +G+   +  ++L+  Y
Sbjct: 116 DYALTGLEFACGIPGSIGGAVYMNAGAYGGEVKDCIDYALCVNEQGSLIKLTTKELELDY 175

Query: 180 RSSEITKDL-IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R+S I K+  ++        P     I A + ++   RE+ QP++  + GS F+ P GH 
Sbjct: 176 RNSIIQKEHLVVLEAAFTLAPGKMTEIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI+ S  +G   GG ++S  H  FM+N DN T  D E L   V+K V  + GI L  
Sbjct: 236 AGKLIQDSNLQGHRIGGVEVSTKHAGFMVNVDNGTATDYENLIHYVQKTVKEKFGIELNR 295

Query: 299 EIKRLGD 305
           E++ +G+
Sbjct: 296 EVRIIGE 302


>gi|282916080|ref|ZP_06323843.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus D139]
 gi|283769901|ref|ZP_06342793.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus H19]
 gi|282320028|gb|EFB50375.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus D139]
 gi|283460048|gb|EFC07138.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus H19]
          Length = 307

 Score =  216 bits (550), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 97/307 (31%), Positives = 161/307 (52%), Gaps = 7/307 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-P 59
           MI   I + L++       K + + PLK+ T+ +TGGNA+    P    +++  +     
Sbjct: 1   MINKDIYQALQQLIPN--EKIKVDEPLKRYTYTKTGGNADFYITPTKNEEVQAVVKYAYQ 58

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
           ++IP+T +G GSNI++R+ GIRG+V+ L +     +       +I G+  +   ++  A 
Sbjct: 59  NEIPVTYLGNGSNIIIREGGIRGIVISLLSLNHIEVSDDA---IIAGSGAAIIDVSRVAR 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            + + G  F  GIPGSIGGA YMNAGA   E    +     ++ +G+   +  ++L+  Y
Sbjct: 116 DYALTGLEFACGIPGSIGGAVYMNAGAYGGEVKDCIDYALCVNEQGSLIKLTTKELELDY 175

Query: 180 RSSEITKDL-IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R+S I K+  ++        P     I A + ++   RE+ QP++  + GS F+ P GH 
Sbjct: 176 RNSIIQKEHLVVLEAAFTLAPGKMTEIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI+ S  +G   GG ++S  H  FM+N DN T  D E L   V+K V  + GI L  
Sbjct: 236 AGKLIQDSNLQGHRIGGVEVSTKHAGFMVNVDNGTATDYENLIHYVQKTVKEKFGIELNR 295

Query: 299 EIKRLGD 305
           E++ +G+
Sbjct: 296 EVRIIGE 302


>gi|313901766|ref|ZP_07835192.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermaerobacter
           subterraneus DSM 13965]
 gi|313467972|gb|EFR63460.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thermaerobacter
           subterraneus DSM 13965]
          Length = 330

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 102/307 (33%), Positives = 147/307 (47%), Gaps = 4/307 (1%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS- 60
           +      + RE    ++G  +   PL + T FR GG AE++ +P    DL   LT     
Sbjct: 1   MAVDREAMARELQGLVQGAVRVAEPLARYTTFRIGGPAELLVEPAAEDDLARTLTWARER 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVG--ARCSGKSLANSA 118
            +P+T++G GSN+LV D G+ GVV+R+   G             V   A      L + A
Sbjct: 61  GLPVTLLGGGSNVLVPDEGLPGVVVRIGLDGIRWEPPDPQGRRGVVVGAGTVLARLVHEA 120

Query: 119 LRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQ 178
            R G  G     GIPG++GGA  MNAG  +    Q V  V  ++  G      RE+  + 
Sbjct: 121 ARRGFRGLEPCAGIPGTVGGALVMNAGTRHGSIGQVVDWVRVVEPAGRVARWSREECGFA 180

Query: 179 YRSSEITKDLIITHV-VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGH 237
           YRSS + K+ +      L   P    +I   I     +R+  QP++    GS FKNP G 
Sbjct: 181 YRSSRMQKEAVPVVAARLVLEPGDPRVILEEIRRHTAYRQRTQPLRYPNCGSVFKNPPGD 240

Query: 238 SAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLE 297
           ++ +LIE  G +GL  G A+ISE H NF+IN   A   D+  L     + V ++ GI LE
Sbjct: 241 ASGRLIEACGLKGLRHGQAQISEQHANFIINLGGARAEDVLALMTTAWRCVRDRFGITLE 300

Query: 298 WEIKRLG 304
            E++ LG
Sbjct: 301 PEVRLLG 307


>gi|229175766|ref|ZP_04303272.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus MM3]
 gi|228607717|gb|EEK65033.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus MM3]
          Length = 304

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 88/307 (28%), Positives = 147/307 (47%), Gaps = 7/307 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    + + L     +  G  +++  LK  T  + GG A+V   P +  +++  +     
Sbjct: 1   MNMQEVYKYLSTVLPE--GHVKQDEMLKNHTHIKVGGKADVFVAPTNYDEIQEVIKYANE 58

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +IP+T +G GSN++++D GIRG+ + L               ++     +   ++  AL
Sbjct: 59  YNIPVTFLGNGSNVIIKDGGIRGITVSLI---HITDVTVTGTTIVAQCGAAIIDVSRIAL 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            H + G  F  GIPGS+GGA YMNAGA   E S  + E   +   G    + +E  ++ Y
Sbjct: 116 DHNLTGLEFACGIPGSVGGALYMNAGAYGGEVSFVLTEAVVMTGDGELRTLTKEAFEFGY 175

Query: 180 RSSEITKDLII-THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S    +  I            +  I   + ++   RE+ QP++  + GS FK P  + 
Sbjct: 176 RKSVFANNHYIILEARFELEEGVREEIKEKMDDLTFKRESKQPLEYPSCGSVFKRPPNNF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI++SG +G   GG ++S  H  FM+N DN T  D   L   V+K V  + G+ LE 
Sbjct: 236 AGKLIQESGLQGKRIGGVEVSLKHAGFMVNVDNGTAQDYIDLIHFVQKTVEEKFGVKLER 295

Query: 299 EIKRLGD 305
           E++ +G+
Sbjct: 296 EVRIIGE 302


>gi|309800697|ref|ZP_07694837.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           infantis SK1302]
 gi|308115682|gb|EFO53218.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           infantis SK1302]
          Length = 301

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 95/302 (31%), Positives = 153/302 (50%), Gaps = 6/302 (1%)

Query: 7   SRLLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPI 64
             +L +  + L G   + + PLK  T+ + GG A+ +  P++ +++   +     + IP 
Sbjct: 1   MTVLDKLKETLEGIDIRFDEPLKTYTYTKVGGKADYLVFPRNRYEMARVVKFANQETIPW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G  SNI+VR+ G+RG V+        ++   +   +   A  +       ALRH + 
Sbjct: 61  MVLGNASNIIVREGGVRGFVIMCDKLNNVSV---DGYTIEAEAGANLIETTRIALRHSLT 117

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           GF F  GIPGS+GGA +MNAGA   E +  +     + ++G    +  + L + YR S I
Sbjct: 118 GFEFACGIPGSVGGAVFMNAGAYGGEIAHVLQSCQILTKEGEIETLSAKDLTFGYRHSAI 177

Query: 185 T-KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
                ++        P +  +I   +  + H RE  QP++  + GS FK P GH A QLI
Sbjct: 178 QASGAVVLSAKFALAPGNHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLI 237

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
            ++G +G   GG ++SE H  FMIN  + T  D E L E V +KV   SG+ LE E++ L
Sbjct: 238 AEAGLKGYRIGGVEVSEKHAGFMINVADGTARDYEDLIESVIEKVKEHSGVTLEREVRIL 297

Query: 304 GD 305
           G+
Sbjct: 298 GE 299


>gi|253682099|ref|ZP_04862896.1| UDP-N-acetylmuramate dehydrogenase [Clostridium botulinum D str.
           1873]
 gi|253561811|gb|EES91263.1| UDP-N-acetylmuramate dehydrogenase [Clostridium botulinum D str.
           1873]
          Length = 307

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 98/303 (32%), Positives = 160/303 (52%), Gaps = 7/303 (2%)

Query: 5   RISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIP 63
            I++ L     +   + + N  +K  T FR GG A+V   P     ++  + L    +IP
Sbjct: 6   DINKKLESILDK--EEIKNNVLMKSYTSFRVGGPADVFVTPNSYEKIRDVIKLCKHYNIP 63

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
             I+G GSN+LV+D GIRGVV+  +     ++      ++I  +      +AN+AL++ +
Sbjct: 64  YFILGNGSNLLVKDGGIRGVVINFTKLNKISV---EETKVIAESGAILSMVANTALKNNL 120

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            G  F +GIPGS+GGA  MNAGA N E  Q +     ID  G    I ++ ++  YR+S 
Sbjct: 121 TGLEFAHGIPGSVGGAVAMNAGAYNGEICQVIESATIIDNHGEIREISKKDMELSYRNSL 180

Query: 184 ITKD-LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
           I K+  I+     +      + I A + ++   R+  QP++  + GSTFK P G+ A +L
Sbjct: 181 ILKNGYIVLKATFKLQKGEHDSIKARMDDLMRRRKEKQPLEYPSAGSTFKRPEGYFAAKL 240

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IE S  +G+  G A++S  H  F+IN  NA+  D+  L E V+K V ++  + L  E++ 
Sbjct: 241 IEDSELKGVHVGDAEVSVKHSGFIINKGNASAKDILDLIELVKKTVNDKFKVTLNTEVRI 300

Query: 303 LGD 305
           +G+
Sbjct: 301 VGE 303


>gi|322391763|ref|ZP_08065228.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus peroris ATCC
           700780]
 gi|321145243|gb|EFX40639.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus peroris ATCC
           700780]
          Length = 301

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 95/302 (31%), Positives = 152/302 (50%), Gaps = 6/302 (1%)

Query: 7   SRLLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPI 64
             +L +  + L G   + + PLK  T+ + GG A+ +  P++ +++   +      +IP 
Sbjct: 1   MTVLDKLKETLEGIDIRFDEPLKTYTYTKVGGKADYLVFPRNRYEMARVVKFANQENIPW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G  SNI+VR+ G+RG V+         +   +   +   A  +       ALRH + 
Sbjct: 61  MVLGNASNIIVREGGVRGFVIMCDKLNNVTV---DGYTIEAEAGANLIETTRIALRHSLT 117

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           GF F  GIPGS+GGA +MNAGA   E +  +     + ++G    +  + L + YR S +
Sbjct: 118 GFEFACGIPGSVGGAVFMNAGAYGGEIAHILQSCKVLTKEGAIETLSAKDLAFGYRHSLV 177

Query: 185 TK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
                I+        P +  +I   +  + H RE  QP++  + GS FK P GH A QLI
Sbjct: 178 QDSGAIVLSAKFALAPGNHQVIKQEMERLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLI 237

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
            ++G +G   GG ++SE H  FMIN  + T  D E L E V +KV   SG+ LE E++ L
Sbjct: 238 SEAGLKGYRIGGVEVSEKHAGFMINVADGTARDYEDLIESVIEKVKEHSGVTLEREVRIL 297

Query: 304 GD 305
           G+
Sbjct: 298 GE 299


>gi|228942238|ref|ZP_04104778.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis serovar berliner ATCC 10792]
 gi|228975168|ref|ZP_04135727.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis serovar thuringiensis str. T01001]
 gi|228981807|ref|ZP_04142102.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis Bt407]
 gi|228777919|gb|EEM26191.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis Bt407]
 gi|228784689|gb|EEM32709.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis serovar thuringiensis str. T01001]
 gi|228817572|gb|EEM63657.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis serovar berliner ATCC 10792]
 gi|326942892|gb|AEA18788.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis serovar chinensis CT-43]
          Length = 305

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 89/310 (28%), Positives = 147/310 (47%), Gaps = 7/310 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    + + L     +  G  +++  LK  T  + GG A+V   P +  +++  +     
Sbjct: 1   MNMQEVYKYLSTVLPE--GHVKQDEMLKNHTHIKVGGKADVFVAPTNYDEIQEVIKYANE 58

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +IP+T +G GSN++++D GIRG+ + L               ++     +   ++  AL
Sbjct: 59  YNIPVTFLGNGSNVIIKDGGIRGITVSLI---HITGVTVTGTTIVAQCGAAIIDVSRIAL 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            H + G  F  GIPGS+GGA YMNAGA   E S  + E   +   G    + +E  ++ Y
Sbjct: 116 DHNLTGLEFACGIPGSVGGALYMNAGAYGGEVSFVLTEAVVMTGDGELRTLTKEAFEFGY 175

Query: 180 RSSEITKDLII-THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S    +  I               I A + ++   RE+ QP++  + GS FK P  + 
Sbjct: 176 RKSVFANNHYIILEARFELEEGVHEEIKAKMDDLTFKRESKQPLEYPSCGSVFKRPPNNF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI+ SG +G   GG ++S  H  FM+N DN T  D   L   V+K V  + G+ LE 
Sbjct: 236 AGKLIQDSGLQGKRIGGVEVSLKHAGFMVNVDNGTAQDYIDLIHFVQKTVEEKFGVKLER 295

Query: 299 EIKRLGDFFD 308
           E++ +G+  +
Sbjct: 296 EVRIIGEDKE 305


>gi|332187117|ref|ZP_08388857.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sphingomonas sp.
           S17]
 gi|332012817|gb|EGI54882.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sphingomonas sp.
           S17]
          Length = 295

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 118/291 (40%), Positives = 166/291 (57%), Gaps = 1/291 (0%)

Query: 14  GKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNI 73
                G+     PL  + WF+ GG AE + +P+D+ DL  FL  L  ++P+  +GLGSN+
Sbjct: 3   LPDTAGRLTPAAPLAPLVWFKAGGPAEYLLEPKDVDDLSAFLKALGGEVPVMALGLGSNL 62

Query: 74  LVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           +VRD G+ GVV+RL     S         +  G   SG  ++++A   GIGG  F   IP
Sbjct: 63  IVRDGGVPGVVVRLGKPF-SYARAGEEHLITCGGGTSGILVSSNARDAGIGGLEFLRSIP 121

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHV 193
           G++GG   MN GA   E +  +V    + R G    +    L+Y YR S +T   ++   
Sbjct: 122 GTVGGFVRMNGGAYGREVADVLVSATVVRRDGTVETLGVADLEYTYRHSNLTDGTVVVEA 181

Query: 194 VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEF 253
             +G      II A +  +   RE  QP++ KTGGSTFKNP GH AW L++ +GCRGL  
Sbjct: 182 TFQGQAAEPEIIQAEMDRIAAAREASQPLRSKTGGSTFKNPEGHKAWALVDAAGCRGLTL 241

Query: 254 GGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           G A++SE HCNF++N  NAT  ++E LGE+VR KV  QSG+ LEWEI+R+G
Sbjct: 242 GDAQVSEKHCNFLLNLGNATAAEIEALGEEVRAKVKAQSGVTLEWEIQRVG 292


>gi|149181510|ref|ZP_01860005.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus sp. SG-1]
 gi|148850760|gb|EDL64915.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus sp. SG-1]
          Length = 311

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 87/312 (27%), Positives = 158/312 (50%), Gaps = 7/312 (2%)

Query: 1   MIYGRISRLL-RERGKQLRGK-FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL 58
           M++   ++ +  +    ++ +  + +  LK   + + GG A+    P    +++  + L 
Sbjct: 3   MMFMIDNKKIHDKLLDVVKTENIKVDEMLKDHLYTKLGGKADFFITPTTYEEVQNVVKLS 62

Query: 59  PS-DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANS 117
              +IP T++G GSN++++D GIRG+V+ L +    +    +   ++  +       +  
Sbjct: 63  NEENIPFTLLGNGSNLIIKDGGIRGIVINLKHLDDIS---TDGTTIVAQSGARIIDASRR 119

Query: 118 ALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKY 177
           AL   + G  F  GIPG++GGA YMNAGA   E    +   + +D++GN       +   
Sbjct: 120 ALAESLSGLEFACGIPGTVGGALYMNAGAYGGEIKDVLDYAYVVDKEGNLVKRLASEFDL 179

Query: 178 QYRSSEITKD-LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTG 236
            YR+S I  +  I+     +  P     I A + ++ + RE+ QP++  + GS FK P G
Sbjct: 180 DYRTSNIPDNGDIVLEATFKLKPGKYEEIKAIMDDLTYKRESKQPLEFPSCGSVFKRPPG 239

Query: 237 HSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILL 296
           + A +LI+ S  +G   GGA++S  H  F++N DNAT  D   L E V+K V  +  + L
Sbjct: 240 YFAGKLIQDSQLQGKNIGGAEVSTKHAGFIVNKDNATAKDYISLIEHVQKTVKEKFNVDL 299

Query: 297 EWEIKRLGDFFD 308
           E E++ +G+  +
Sbjct: 300 EREVRIIGEDLE 311


>gi|323351692|ref|ZP_08087346.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis VMC66]
 gi|322122178|gb|EFX93904.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis VMC66]
 gi|324993030|gb|EGC24950.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK405]
 gi|324995661|gb|EGC27573.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK678]
 gi|327461298|gb|EGF07629.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK1]
 gi|327489157|gb|EGF20950.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK1058]
          Length = 301

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 98/302 (32%), Positives = 151/302 (50%), Gaps = 6/302 (1%)

Query: 7   SRLLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPI 64
            + L +   +L G   + N PL Q T+ + GG A+ +  P++ ++L   +      DIP 
Sbjct: 1   MQKLEKLKTELEGIDIRFNEPLSQYTYTKVGGAADFLVFPRNRYELARIVNFANQEDIPW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G  SNI+VRD GIRG V+         +   +   +   A  +     + AL++ + 
Sbjct: 61  MVLGNASNIIVRDGGIRGFVIMFDKLNNVAV---DGYMIEAEAGANLIQTTHIALQNSLT 117

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           GF F  GIPGS+GGA +MNAGA   E +  +V    +  +G    +    +K+ YR S +
Sbjct: 118 GFEFACGIPGSVGGAVFMNAGAYGGEIAHVLVSCKVLTPQGQVKTLDVRDMKFGYRHSLV 177

Query: 185 TK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            +   I+        P     I   +  + H RE  QP++  + GS FK P GH A QLI
Sbjct: 178 QETGDIVISAKFALSPGVHRTIRQEMERLTHLRELKQPLEYPSCGSVFKRPLGHFAGQLI 237

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
            ++G +G   GG ++SE H  FMIN D  T  D E L   V ++V   SGI LE E++ +
Sbjct: 238 SEAGLKGHRIGGVEVSEKHAGFMINVDKGTAQDYENLIAHVIERVRENSGITLEREVRII 297

Query: 304 GD 305
           G+
Sbjct: 298 GE 299


>gi|225018885|ref|ZP_03708077.1| hypothetical protein CLOSTMETH_02835 [Clostridium methylpentosum
           DSM 5476]
 gi|224948355|gb|EEG29564.1| hypothetical protein CLOSTMETH_02835 [Clostridium methylpentosum
           DSM 5476]
          Length = 304

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 103/297 (34%), Positives = 151/297 (50%), Gaps = 3/297 (1%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVG 68
           L    ++   +++   PLK+ T F+ GGN  ++  P  I  ++  +      +I   I+G
Sbjct: 8   LEHCLEENGIRYEWGVPLKEYTSFKIGGNCTILLSPDSIEQVQNAIRCCRKHNINYFILG 67

Query: 69  LGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHF 128
            GSN+LV D G  G V+  SN+    I +     +   A      L   A   G+ G  F
Sbjct: 68  KGSNLLVSDDGFEGAVICTSNSLHE-ITMVGETTIACQAGVHLSKLCTFAFEQGLTGLEF 126

Query: 129 FYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKD 187
            YGIPG++GGAAYMNAGA   E    +     ID +GN     R+QL + YR S    ++
Sbjct: 127 AYGIPGTVGGAAYMNAGAYGGEMKDVITRCDHIDGEGNPGTFLRKQLDFSYRHSAYSDQN 186

Query: 188 LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSG 247
             IT +  R        I A +  + H R T QP++  + GSTFK P G  A  LIE+ G
Sbjct: 187 YCITTIYFRLQKGDPEAIKARMEELMHRRVTKQPLEYPSAGSTFKRPEGAYASALIEQCG 246

Query: 248 CRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            +G   G A++SE H  F+IN   AT   +  L EQV+++V+ ++G  LE E+KR+G
Sbjct: 247 LKGRSVGDAQVSEKHSGFLINRGEATCKQVLELIEQVQQEVYERTGFSLECEVKRIG 303


>gi|125717878|ref|YP_001035011.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           sanguinis SK36]
 gi|166222946|sp|A3CMQ6|MURB_STRSV RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|125497795|gb|ABN44461.1| UDP-N-acetylenolpyruvoylglucosamine reductase, putative
           [Streptococcus sanguinis SK36]
          Length = 301

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 98/302 (32%), Positives = 151/302 (50%), Gaps = 6/302 (1%)

Query: 7   SRLLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPI 64
            + L +   +L G   + N PL Q T+ + GG A+ +  P++ ++L   +      DIP 
Sbjct: 1   MQKLEKLKSELEGIDIRFNEPLSQYTYTKVGGAADFLVFPRNRYELVRIVNFANQEDIPW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G  SNI+VRD GIRG V+         +   +   +   A  +     + AL++ + 
Sbjct: 61  MVLGNASNIIVRDGGIRGFVIMFDKLNNVAV---DGYMIEAEAGANLIQTTHIALQNSLT 117

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           GF F  GIPGS+GGA +MNAGA   E +  +V    +  +G    +    +K+ YR S +
Sbjct: 118 GFEFACGIPGSVGGAVFMNAGAYGGEIAHVLVSCKVLTPQGQVKTLDVRDMKFGYRHSLV 177

Query: 185 TK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            +   I+        P     I   +  + H RE  QP++  + GS FK P GH A QLI
Sbjct: 178 QETGDIVISAKFALSPGVHRTIRQEMERLTHLRELKQPLEYPSCGSVFKRPLGHFAGQLI 237

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
            ++G +G   GG ++SE H  FMIN D  T  D E L   V ++V   SGI LE E++ +
Sbjct: 238 SEAGLKGHRIGGVEVSEKHAGFMINVDKGTAQDYENLIAHVIERVRENSGITLEREVRII 297

Query: 304 GD 305
           G+
Sbjct: 298 GE 299


>gi|75760561|ref|ZP_00740595.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis serovar israelensis ATCC 35646]
 gi|218900220|ref|YP_002448631.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           G9842]
 gi|228903573|ref|ZP_04067694.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis IBL 4222]
 gi|228910909|ref|ZP_04074718.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis IBL 200]
 gi|74491957|gb|EAO55139.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis serovar israelensis ATCC 35646]
 gi|218544314|gb|ACK96708.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           G9842]
 gi|228848860|gb|EEM93705.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis IBL 200]
 gi|228856002|gb|EEN00541.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis IBL 4222]
          Length = 305

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 89/310 (28%), Positives = 148/310 (47%), Gaps = 7/310 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    + + L     +  G  +++  LK  T  + GG A+V   P +  +++  +     
Sbjct: 1   MNMQEVYKYLSTVLPE--GHVKQDEMLKNHTHIKVGGKADVFVAPTNYDEIQEVIKYANE 58

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +IP+T +G GSN++++D GIRG+ + L               ++     +   ++  AL
Sbjct: 59  YNIPVTFLGNGSNVIIKDGGIRGITVSLI---HITGVTVTGTTIVAQCGAAIIDVSRIAL 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            H + G  F  GIPGS+GGA YMNAGA   E S  + E   +   G    + +E  ++ Y
Sbjct: 116 DHNLTGLEFACGIPGSVGGALYMNAGAYGGEISFVLTEAVVMTGDGELRTLTKEAFEFGY 175

Query: 180 RSSEITKDLII-THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S    +  I            +  I A + ++   RE+ QP++  + GS FK P  + 
Sbjct: 176 RKSVFANNHYIILEARFELEEGVREEIKAKMDDLTFKRESKQPLEYPSCGSVFKRPPNNF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI+ SG +G   GG ++S  H  FM+N DN T  D   L   V+K V  + G+ LE 
Sbjct: 236 AGKLIQDSGLQGKRIGGVEVSLKHAGFMVNVDNGTAQDYIDLIHFVQKTVEEKFGVKLER 295

Query: 299 EIKRLGDFFD 308
           E++ +G+  +
Sbjct: 296 EVRIIGEDKE 305


>gi|30023100|ref|NP_834731.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus ATCC
           14579]
 gi|206970054|ref|ZP_03231007.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           AH1134]
 gi|218235193|ref|YP_002369875.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           B4264]
 gi|228923800|ref|ZP_04087078.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis serovar huazhongensis BGSC 4BD1]
 gi|228955334|ref|ZP_04117342.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
 gi|228961313|ref|ZP_04122930.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis serovar pakistani str. T13001]
 gi|229049758|ref|ZP_04194315.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           AH676]
 gi|229072556|ref|ZP_04205758.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           F65185]
 gi|229082315|ref|ZP_04214778.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           Rock4-2]
 gi|229112513|ref|ZP_04242050.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           Rock1-15]
 gi|229130325|ref|ZP_04259284.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           BDRD-Cer4]
 gi|229147621|ref|ZP_04275965.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           BDRD-ST24]
 gi|229153259|ref|ZP_04281437.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           m1550]
 gi|229181363|ref|ZP_04308692.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           172560W]
 gi|229193349|ref|ZP_04320299.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus ATCC
           10876]
 gi|296505506|ref|YP_003667206.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis BMB171]
 gi|47605854|sp|Q815R9|MURB2_BACCR RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase 2;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase 2
 gi|29898660|gb|AAP11932.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus ATCC
           14579]
 gi|206734631|gb|EDZ51800.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           AH1134]
 gi|218163150|gb|ACK63142.1| UDP-N-acetylmuramate dehydrogenase [Bacillus cereus B4264]
 gi|228590150|gb|EEK48019.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus ATCC
           10876]
 gi|228602099|gb|EEK59591.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           172560W]
 gi|228629863|gb|EEK86514.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           m1550]
 gi|228635830|gb|EEK92316.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           BDRD-ST24]
 gi|228653258|gb|EEL09137.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           BDRD-Cer4]
 gi|228670893|gb|EEL26200.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           Rock1-15]
 gi|228700747|gb|EEL53270.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           Rock4-2]
 gi|228710532|gb|EEL62505.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           F65185]
 gi|228722671|gb|EEL74059.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           AH676]
 gi|228798366|gb|EEM45362.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis serovar pakistani str. T13001]
 gi|228804467|gb|EEM51078.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
 gi|228835929|gb|EEM81292.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis serovar huazhongensis BGSC 4BD1]
 gi|296326558|gb|ADH09486.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis BMB171]
          Length = 305

 Score =  216 bits (549), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 89/310 (28%), Positives = 147/310 (47%), Gaps = 7/310 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    + + L     +  G  +++  LK  T  + GG A+V   P +  +++  +     
Sbjct: 1   MNMQEVYKYLSTVLPE--GHVKQDEMLKNHTHIKVGGKADVFVAPTNYDEIQEVIKYANE 58

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +IP+T +G GSN++++D GIRG+ + L               ++     +   ++  AL
Sbjct: 59  YNIPVTFLGNGSNVIIKDGGIRGITVSLI---HITGVTVTGTTIVAQCGAAIIDVSRIAL 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            H + G  F  GIPGS+GGA YMNAGA   E S  + E   +   G    + +E  ++ Y
Sbjct: 116 DHNLTGLEFACGIPGSVGGALYMNAGAYGGEISFVLTEAVVMTGDGELRTLTKEAFEFGY 175

Query: 180 RSSEITKDLII-THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S    +  I               I A + ++   RE+ QP++  + GS FK P  + 
Sbjct: 176 RKSVFANNHYIILEARFELEEGVHEEIKAKMDDLTFKRESKQPLEYPSCGSVFKRPPNNF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI+ SG +G   GG ++S  H  FM+N DN T  D   L   V+K V  + G+ LE 
Sbjct: 236 AGKLIQDSGLQGKRIGGVEVSLKHAGFMVNVDNGTAQDYIDLIHFVQKTVEEKFGVKLER 295

Query: 299 EIKRLGDFFD 308
           E++ +G+  +
Sbjct: 296 EVRIIGEDKE 305


>gi|332360937|gb|EGJ38742.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK355]
          Length = 301

 Score =  216 bits (549), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 98/302 (32%), Positives = 151/302 (50%), Gaps = 6/302 (1%)

Query: 7   SRLLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPI 64
            + L +   +L G   + N PL Q T+ + GG A+ +  P++ ++L   +      DIP 
Sbjct: 1   MQKLEKLKTELEGIDIRFNEPLSQYTYTKVGGAADFLVFPRNRYELARIVNFANQEDIPW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G  SNI+VRD GIRG V+         +   +   +   A  +     + AL++ + 
Sbjct: 61  MVLGNASNIIVRDGGIRGFVIMFDKLNNVGV---DGYMIEAEAGANLIQTTHIALQNSLT 117

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           GF F  GIPGS+GGA +MNAGA   E +  +V    +  +G    +    +K+ YR S +
Sbjct: 118 GFEFACGIPGSVGGAVFMNAGAYGGEIAHVLVSCKVLTPQGQVKTLDVRDMKFGYRHSLV 177

Query: 185 TK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            +   I+        P     I   +  + H RE  QP++  + GS FK P GH A QLI
Sbjct: 178 QETGDIVISAKFALSPGVHRTIRQEMERLTHLRELKQPLEYPSCGSVFKRPLGHFAGQLI 237

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
            ++G +G   GG ++SE H  FMIN D  T  D E L   V ++V   SGI LE E++ +
Sbjct: 238 SEAGLKGHRIGGVEVSEKHAGFMINVDKGTAQDYENLIAHVIERVRENSGITLEREVRII 297

Query: 304 GD 305
           G+
Sbjct: 298 GE 299


>gi|257784160|ref|YP_003179377.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Atopobium parvulum
           DSM 20469]
 gi|257472667|gb|ACV50786.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Atopobium parvulum
           DSM 20469]
          Length = 308

 Score =  216 bits (549), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 88/288 (30%), Positives = 139/288 (48%), Gaps = 4/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKY-FLTLLPSDIPITIVGLGSNILVRDA 78
               + P+ + T F+ GG A++   P D  ++K   L +  +  P  I+G GS++LV DA
Sbjct: 23  NVLVDEPMSEHTTFKVGGPADLYVIPDDPDEVKETLLAVKDAKAPYFILGYGSDLLVSDA 82

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           G RGV++ +++            EM   A    K  +  A    + G  F  GIPGS+GG
Sbjct: 83  GYRGVIIAVADGLTGVSIDD--TEMTCQAGVGLKEASEMACELDLSGLEFACGIPGSVGG 140

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLRG 197
           A +MNAGA +   S  +  V  +   G    +   +L   YR S I  + +I+       
Sbjct: 141 ACFMNAGAYDGCISDVLKSVRVLLADGTFATLDASELDLGYRHSRIADEGMIVLSATFNL 200

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
                  I   +      RE  QP++  + GSTFK P GH   +L+  +G +G  FGGA 
Sbjct: 201 HRADGEKIREKMEEFTRAREEKQPLELPSAGSTFKRPEGHFVGKLVTDAGLKGYRFGGAG 260

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S+ H  F++N DNAT  ++  + E V+ +V  Q  + L  E++ LG+
Sbjct: 261 VSDKHAGFVVNYDNATAAEVHAVIEHVQAEVKRQFDVELYPEVRFLGE 308


>gi|301063254|ref|ZP_07203803.1| UDP-N-acetylmuramate dehydrogenase [delta proteobacterium NaphS2]
 gi|300442682|gb|EFK06898.1| UDP-N-acetylmuramate dehydrogenase [delta proteobacterium NaphS2]
          Length = 304

 Score =  216 bits (549), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 100/302 (33%), Positives = 157/302 (51%), Gaps = 2/302 (0%)

Query: 6   ISRLLRERGKQLRGK-FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIP 63
           + R  +   ++L GK  + N+P+ Q T ++ GG  EV+++ +D+  LK  +  L    IP
Sbjct: 1   MDRHQKAALEKLAGKGIRFNYPMHQRTTYQVGGPVEVLWEARDLLTLKEVIRYLSGESIP 60

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
             ++G GSN+LV D GI GV++ L  +  +  +      +  G       L     + G+
Sbjct: 61  YHVLGKGSNLLVTDDGIDGVMILLKGSLATINKGPEDSLIWAGGGLHLTDLMKWCRQKGM 120

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            G  F  GIPG++GGA  MNAGA      + V  +  +   G + ++ R  LK+ YR   
Sbjct: 121 SGLEFMAGIPGTVGGAVVMNAGAFGHAIGEKVRNIQCVVPGGKEVLVNRSDLKFSYRRLH 180

Query: 184 ITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
           + K+  I +  L     + + +S  + +    R+  QP+   + GS FKNP G  A +LI
Sbjct: 181 VQKNSAIINACLELSRSTPDKVSLKMGDFLKTRKETQPLDAPSAGSVFKNPPGDHAGRLI 240

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           EK+G +G + G A +SE H N+++N  NAT  D+  L E VR +V   SGI LE EIK +
Sbjct: 241 EKAGLKGRKIGDAMVSEKHANYILNKGNATAKDILSLMELVRFEVKRTSGIDLEPEIKIV 300

Query: 304 GD 305
           G 
Sbjct: 301 GK 302


>gi|229099525|ref|ZP_04230453.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           Rock3-29]
 gi|229105683|ref|ZP_04236314.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           Rock3-28]
 gi|229118590|ref|ZP_04247942.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           Rock1-3]
 gi|228664782|gb|EEL20272.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           Rock1-3]
 gi|228677731|gb|EEL31977.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           Rock3-28]
 gi|228683821|gb|EEL37771.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           Rock3-29]
          Length = 305

 Score =  216 bits (549), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 88/307 (28%), Positives = 146/307 (47%), Gaps = 7/307 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    + + L     +  G   ++  LK  T  + GG A+V   P +  +++  +     
Sbjct: 1   MNMQEVYKYLSTVLPE--GHVTQDEMLKNHTHIKVGGKADVFVAPTNYDEIQEVIKYANQ 58

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +IP+T +G GSN++++D GIRG+ + L               ++     +   ++  AL
Sbjct: 59  YNIPVTFLGNGSNVIIKDGGIRGITVSLI---HITGVTVTGTTIVAQCGAAIIDVSRIAL 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            H + G  F  GIPGS+GGA YMNAGA   E S  + E   +   G    + +E  ++ Y
Sbjct: 116 DHNLTGLEFACGIPGSVGGALYMNAGAYGGEVSFVLTEAVVMTGDGELRTLTKEAFEFGY 175

Query: 180 RSSEITKDLII-THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S    +  I               I   + ++ + RE+ QP++  + GS FK P  + 
Sbjct: 176 RKSVFANNHYIILEARFELEEGVHEEIKEKMDDLTYKRESKQPLEYPSCGSVFKRPPNNF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI++SG +G   GG ++S  H  FM+N DN T  D   L   V+K V  + G+ LE 
Sbjct: 236 AGKLIQESGLQGKRIGGVEVSLKHAGFMVNVDNGTAQDYIDLIHFVQKTVEEKFGVKLER 295

Query: 299 EIKRLGD 305
           E++ +G+
Sbjct: 296 EVRIIGE 302


>gi|18309335|ref|NP_561269.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens str. 13]
 gi|110798584|ref|YP_694802.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens ATCC 13124]
 gi|168204465|ref|ZP_02630470.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens E str. JGS1987]
 gi|168210458|ref|ZP_02636083.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens B str. ATCC 3626]
 gi|168216566|ref|ZP_02642191.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens NCTC 8239]
 gi|169344098|ref|ZP_02865084.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens C str. JGS1495]
 gi|29336835|sp|Q8XNI0|MURB_CLOPE RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|123149012|sp|Q0TU88|MURB_CLOP1 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|18144011|dbj|BAB80059.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens str. 13]
 gi|110673231|gb|ABG82218.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens ATCC 13124]
 gi|169297833|gb|EDS79930.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens C str. JGS1495]
 gi|170663988|gb|EDT16671.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens E str. JGS1987]
 gi|170711463|gb|EDT23645.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens B str. ATCC 3626]
 gi|182381288|gb|EDT78767.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens NCTC 8239]
          Length = 304

 Score =  216 bits (549), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 94/304 (30%), Positives = 148/304 (48%), Gaps = 7/304 (2%)

Query: 3   YGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-D 61
           Y    +LL E   +       + P+ +  +FR GG A+++  P +   +   L L    +
Sbjct: 4   YMEFYKLLGEFYNE--EDITVDSPMSEHIYFRVGGPADILVTPVNEEQVVNTLKLCREYN 61

Query: 62  IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRH 121
           +P  I+G GSNILV+D GI      +      N        +   +    K ++ +AL +
Sbjct: 62  VPYFILGNGSNILVKDGGI---SGVVIKFNKLNKITTEGNCVTAQSGALLKDVSKAALEN 118

Query: 122 GIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS 181
            + GF F  GIPGSIGGA +MNAGA + E +  +     ID   N   + +E+L+  YRS
Sbjct: 119 NLRGFEFACGIPGSIGGAVFMNAGAYDGEMAHVIKSARVIDENCNIKNLTKEELELGYRS 178

Query: 182 SEITKDLIITHV-VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
           S + K   +     +         I   I ++ + RE+ QP++  + GSTFK P G+ A 
Sbjct: 179 SIVMKKGYVVIEATVELESGEYASIKDKIDDLTNRRESKQPLEYPSAGSTFKRPEGYFAG 238

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LI+ SG +G   GGA +SE H  F+IN   AT  D+  +   V+K V     + L  E+
Sbjct: 239 KLIQDSGLKGFSIGGAAVSEKHSGFVINKGGATAKDVLDVIAHVQKTVKENFDVELHTEV 298

Query: 301 KRLG 304
           + +G
Sbjct: 299 RIIG 302


>gi|205373272|ref|ZP_03226076.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           coahuilensis m4-4]
          Length = 302

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 100/302 (33%), Positives = 164/302 (54%), Gaps = 5/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLT-LLPSDIPI 64
           + R+  +  +   G  + N PLK  T  + GG A+++ +P  I  ++  +  ++  +IP 
Sbjct: 1   MERIYEQLVELNVGNVKYNEPLKYHTTIKIGGPADILIEPYSIEAIEKIMKVIIKGEIPW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T++G GSN+LV D GI GVVL+L+          N  ++ VGA  S   LA    + G+ 
Sbjct: 61  TVIGRGSNLLVSDKGIEGVVLKLNKGLD--HIDINENQVTVGAGYSLIVLATQLSKKGLK 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           GF F  GIPGS+GGA YMNAGA+  + S  +V+   +   G    + +E++KY YR+S +
Sbjct: 119 GFEFAGGIPGSVGGAVYMNAGAHGMDLSTILVKAKVLFDDGTISWVTKEEMKYSYRTSVL 178

Query: 185 TKDLI--ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
            K     +   + +     ++ I   +     +R+  QP      GS F+NP    A +L
Sbjct: 179 QKKRPGIVLEAIFQLEAGDKHSIQNEMQVNKDYRKETQPWSNPCAGSIFRNPLPEYAGRL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IE +G +G   GGAKIS+LH NF++N  NA+  D+  L + +++ +++  GI +E EI+ 
Sbjct: 239 IETAGLKGYTIGGAKISDLHGNFIVNNGNASAEDVRKLIQYIQQTIYDLYGIRMETEIEI 298

Query: 303 LG 304
           +G
Sbjct: 299 IG 300


>gi|15615127|ref|NP_243430.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus halodurans
           C-125]
 gi|20139213|sp|Q9K9T1|MURB_BACHD RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|10175184|dbj|BAB06283.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus halodurans
           C-125]
          Length = 301

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 97/302 (32%), Positives = 150/302 (49%), Gaps = 8/302 (2%)

Query: 10  LRERGKQLR----GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           + +  + LR    G+ + N  L   T ++ GG A+V   P DI  LK  + L+       
Sbjct: 1   MEQLVESLRALQVGEVRVNESLAHHTTWKIGGPADVFVIPNDIEGLKNTMKLIQETGCKW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G GSNILV D G+RGV ++L           N   + VGA      LA    R G+ 
Sbjct: 61  RVIGRGSNILVSDKGLRGVTIKLDKGLD--HLEVNGESITVGAGFPVVKLATVISRQGLA 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA +MNAGA+  + SQ + + H +   G    +  E++ + YR+S +
Sbjct: 119 GLEFAAGIPGSVGGAVFMNAGAHGSDISQILTKAHVLFPDGTLRWLTNEEMAFSYRTSLL 178

Query: 185 TKDL-IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            K+  I    +       +  I   +     +R   QP    T GS F+NP    A QLI
Sbjct: 179 QKNDGICVEAIFSLTRGDKEDIKKKLQKNKDYRRDTQPWNHPTCGSVFRNPLPEYAGQLI 238

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           EK+G +G + GGA+IS +H NF++N  +A   D+  L   V+  +  Q  + +E E++ +
Sbjct: 239 EKAGLKGYQIGGAQISTMHANFIVNTGDAKAADVLALIHHVKDTIQKQYQMNMETEVELI 298

Query: 304 GD 305
           G+
Sbjct: 299 GE 300


>gi|52080125|ref|YP_078916.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           licheniformis ATCC 14580]
 gi|52785499|ref|YP_091328.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           licheniformis ATCC 14580]
 gi|319646100|ref|ZP_08000330.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus sp.
           BT1B_CT2]
 gi|81385636|sp|Q65JX9|MURB_BACLD RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|52003336|gb|AAU23278.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           licheniformis ATCC 14580]
 gi|52348001|gb|AAU40635.1| MurB [Bacillus licheniformis ATCC 14580]
 gi|317391850|gb|EFV72647.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus sp.
           BT1B_CT2]
          Length = 303

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 96/303 (31%), Positives = 159/303 (52%), Gaps = 5/303 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           + ++++E  +   GK  EN PL   T  + GG A+V+  P+DI  +K  + ++    +  
Sbjct: 1   MDKVIQELKELEVGKVLENEPLSNHTTIKIGGPADVLVIPKDIQAVKDTMKVVKKHGVKW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T +G GSN+LV D GIRGVV++L                 VG   S   LA    + G+ 
Sbjct: 61  TAIGRGSNLLVLDEGIRGVVIKLGQGLDHMEIDGEQVT--VGGGYSVVRLATGISKKGLS 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA+  + S+ +V+   +   G    +  E++ + YR+S +
Sbjct: 119 GLEFAAGIPGSVGGAVYMNAGAHGSDISKVLVKALILFEDGTIEWLTNEEMAFSYRTSIL 178

Query: 185 TKDLI--ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
                      VL+   + ++ I A +     +R+  QP+     GS F+NP    A +L
Sbjct: 179 QNKRPGICLEAVLQLEQKERDQIVAQMQKNKDYRKETQPVSNPCAGSIFRNPLPEHAGRL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           +E++G +G + GGAK+SE+H NF++NA  AT  D+  L   ++K +  +  I +  E++ 
Sbjct: 239 VEEAGLKGHQIGGAKVSEMHGNFIVNAGGATAKDVLDLIAFIQKTIKEKYDIDMHTEVEI 298

Query: 303 LGD 305
           +G+
Sbjct: 299 IGE 301


>gi|270290672|ref|ZP_06196896.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Pediococcus
           acidilactici 7_4]
 gi|304386196|ref|ZP_07368529.1| UDP-N-acetylmuramate dehydrogenase [Pediococcus acidilactici DSM
           20284]
 gi|270280732|gb|EFA26566.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Pediococcus
           acidilactici 7_4]
 gi|304327553|gb|EFL94780.1| UDP-N-acetylmuramate dehydrogenase [Pediococcus acidilactici DSM
           20284]
          Length = 300

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 96/307 (31%), Positives = 153/307 (49%), Gaps = 11/307 (3%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M+   I+    E       K  ++ PL + T  +TGG A+++  P+ + + K  +     
Sbjct: 1   MMDQSITAAFPEI------KVYKDEPLSKYTNTQTGGPADLLVFPKSVTETKQLMIWAKE 54

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
              P+T++G  SN++VRD GIRG+VL L+      +   N   +I  A  +       A 
Sbjct: 55  TATPLTVIGNASNLIVRDGGIRGLVLILTKMDNIQV---NGNTVIAEAGAALIQATEVAY 111

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
           + G+ GF F  GIPGS+GGA +MNAGA   E S+ V     +   G    +   +L + Y
Sbjct: 112 QSGLTGFEFAAGIPGSVGGAIFMNAGAYGGEISEIVESAEVLTPDGQIKRLNNHELDFGY 171

Query: 180 RSSEITKDLIITHV-VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S +     +      +  P  Q  I A +  +   R + QP++  + GS FK PTG+ 
Sbjct: 172 RHSSVQDYHDVVISASFKLRPGDQTKIRARMDELNRLRASKQPLEYPSCGSVFKRPTGYF 231

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
             +LI ++G +G   GGA++S+ H  F+IN  NAT  D   +   V+  VF Q G+ LE 
Sbjct: 232 TGKLIHEAGLQGFTIGGAQVSKKHAGFIINIGNATATDYLDVIHHVQATVFKQFGVKLET 291

Query: 299 EIKRLGD 305
           E++ +G+
Sbjct: 292 EVRIIGE 298


>gi|83589696|ref|YP_429705.1| UDP-N-acetylmuramate dehydrogenase [Moorella thermoacetica ATCC
           39073]
 gi|123524769|sp|Q2RK77|MURB_MOOTA RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|83572610|gb|ABC19162.1| UDP-N-acetylmuramate dehydrogenase [Moorella thermoacetica ATCC
           39073]
          Length = 302

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 103/302 (34%), Positives = 157/302 (51%), Gaps = 4/302 (1%)

Query: 5   RISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIP 63
            ++ L  E    L+ +   N PL + T +R GG A+++ +P+   +L Y L+      +P
Sbjct: 2   DLTALAGELQTGLKLQVLTNEPLSRHTTWRLGGPADLLARPRSREELDYCLSFARRKGLP 61

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           + I+G GSN+LV D G+RG+V++        IE R    ++  A      L   A + G+
Sbjct: 62  LHILGNGSNLLVLDGGVRGLVVQTREWRQVIIEGRK---ILATAGTLLPGLLQVASKKGL 118

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
           GG  F  GIP ++GGA  MNAG         VV V  +D  G +H++   ++ + YR S 
Sbjct: 119 GGLEFAAGIPATVGGAVVMNAGTPAGCLGDLVVGVEVLDYDGRRHILENREITFTYRHSS 178

Query: 184 ITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
           + +   +  V L   P+    I   I    H R + QP++    GS FKNP G+ A +LI
Sbjct: 179 LHRAGTVVTVTLELVPDEVPAIRERIEANLHRRRSRQPLEWPNAGSVFKNPPGYYAGRLI 238

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           E  G +G   GGA+++E H NF+IN   AT  D+  L ++VR+ V  Q GI LE EI+  
Sbjct: 239 EAVGAKGWRVGGAEVAEKHANFIINRGQATAADVMELIDRVREAVARQLGIDLELEIEVW 298

Query: 304 GD 305
           G+
Sbjct: 299 GE 300


>gi|28212078|ref|NP_783022.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium tetani
           E88]
 gi|47605874|sp|Q890Y6|MURB_CLOTE RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|28204521|gb|AAO36959.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium tetani
           E88]
          Length = 307

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 98/302 (32%), Positives = 161/302 (53%), Gaps = 8/302 (2%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPI 64
           IS L+   G +     + N  +K  T F+ GG  +++  P+    ++Y +     ++IP 
Sbjct: 8   ISNLIENLGSE---NVKTNELMKNHTSFKVGGPVDILVTPESYEQVQYVIKHSRGNNIPY 64

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            I+G GSN+LVRD GIRG+V++        IE      +I  +      ++N A ++ + 
Sbjct: 65  FIMGNGSNLLVRDGGIRGLVIKFCKLNRIKIEDDK---IIAQSGVLLSKVSNMAAKNNLE 121

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGSIGGA  MNAGA N E SQ +     +D+ G    + +E+L+  YR+S I
Sbjct: 122 GLEFASGIPGSIGGALTMNAGAYNGEISQVIDSALVLDKSGEILNLSKEELELGYRTSSI 181

Query: 185 TKD-LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            K+  ++   +L+        I   I  +   R+T QP++  + GSTFK P G+ A +LI
Sbjct: 182 LKNGYVVLEAILKLSLGDSKNIYDRIKELTEKRKTKQPLEYPSAGSTFKRPQGYFAAKLI 241

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           E+SG +G+  G A++S+ H  F+IN  NA+  D+  +   V+  V ++  + L  E+  +
Sbjct: 242 EESGLKGINVGDAEVSQKHSGFIINKGNASAKDILNVINIVQDTVKSKFDVELHTEVLII 301

Query: 304 GD 305
           G+
Sbjct: 302 GE 303


>gi|323693192|ref|ZP_08107410.1| UDP-N-acetylmuramate dehydrogenase [Clostridium symbiosum
           WAL-14673]
 gi|323502675|gb|EGB18519.1| UDP-N-acetylmuramate dehydrogenase [Clostridium symbiosum
           WAL-14673]
          Length = 304

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 104/289 (35%), Positives = 148/289 (51%), Gaps = 3/289 (1%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVR 76
            G+   +  + + T FR GG A     P     LK  L L   + +P  I+G GSN+LV 
Sbjct: 14  NGQVTRDEMMNRHTTFRVGGPASYFVSPDGDEALKKVLLLCREEQMPYYILGNGSNLLVS 73

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G  G V+ L   GF+ I      E+  GA      +A  A  H + GF F  GIPG++
Sbjct: 74  DKGYGG-VMILMGEGFAQIREDVPGELAAGAGALLSRIAREAQEHSLTGFEFAAGIPGTL 132

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVL 195
           GGA  MNAGA + E    +  V  +D+ G    +   +L+  YR S I  K+ I+   V+
Sbjct: 133 GGAVVMNAGAYDGEMKNVLKTVSVMDKNGRILELSANELELGYRRSCIQEKEYIVLSAVI 192

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
                 +  I   +A +   R   QP++  + GSTFK P G+ A +LIE +G RG   GG
Sbjct: 193 SLKQGDKEAIQTKMAELAGKRRDKQPLEYPSAGSTFKRPAGYFAGKLIEDAGLRGYREGG 252

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           A++SE HC F+IN+  AT  D+  L   V+KKV   SG+ LE E++ +G
Sbjct: 253 AQVSEKHCGFVINSGGATAEDIRLLCRSVQKKVKETSGVDLETEVRMIG 301


>gi|304321498|ref|YP_003855141.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Parvularcula
           bermudensis HTCC2503]
 gi|303300400|gb|ADM09999.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Parvularcula
           bermudensis HTCC2503]
          Length = 296

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 132/292 (45%), Positives = 177/292 (60%), Gaps = 7/292 (2%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDA 78
           GK   + PL   TW R GG A+ +F P    +L  FL  +P+D P++++G+GSN+LVRD 
Sbjct: 5   GKLLTDAPLAPYTWLRVGGPADRLFLPNTEAELSAFLADMPADEPLSVIGIGSNLLVRDG 64

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIRG V+RL +   +       C +  GA     S+A +A R GI G  F+ GIPGSIGG
Sbjct: 65  GIRGTVIRLGSGFGTIEV--EGCRVRAGAAALDASVAKAAGRAGITGLEFYRGIPGSIGG 122

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGF 198
           A  MNAGA   ET   +VE   +DR+GN+H++  E++ + YR S +  D I+   V  G 
Sbjct: 123 ALRMNAGAYGGETKDVLVEATVLDRRGNRHLMTAEEMGFSYRRSSLPPDWIVVSAVFEGQ 182

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNP-----TGHSAWQLIEKSGCRGLEF 253
                 I A +A++   RE  QPIK +TGGSTFKNP      G S+WQLI+  G RG   
Sbjct: 183 EGDPARIEARMADIMAKREATQPIKSRTGGSTFKNPDPSRSEGRSSWQLIDAIGARGRVV 242

Query: 254 GGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           G A++S+LH NFMIN   AT  DLE LGE +R+ V ++ G+ LEWEIKR+GD
Sbjct: 243 GDAQMSDLHANFMINRGAATAADLEALGEGIRRDVKDRFGVELEWEIKRVGD 294


>gi|258423387|ref|ZP_05686278.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A9635]
 gi|257846448|gb|EEV70471.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus A9635]
 gi|302332447|gb|ADL22640.1| putative UDP-N-acetylenolpyruvoylglucosamine reductase
           [Staphylococcus aureus subsp. aureus JKD6159]
          Length = 307

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 97/307 (31%), Positives = 161/307 (52%), Gaps = 7/307 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-P 59
           MI   I + L++       K + + PLK+ T+ +TGGNA+    P    +++  +     
Sbjct: 1   MINKDIYQALQQLIPN--EKIKVDEPLKRYTYTKTGGNADFYITPTKNEEVQAVVKYAYQ 58

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
           ++IP+T +G GSNI++R+ GIRG+V+ L +     +       +I G+  +   ++  A 
Sbjct: 59  NEIPVTYLGNGSNIIIREGGIRGIVISLLSLDHIEVSDDA---IIAGSGAAIIDVSRVAR 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            + + G  F  GIPGSIGGA YMNAGA   E    +     ++ +G+   +  ++L+  Y
Sbjct: 116 DYALTGLEFACGIPGSIGGAVYMNAGAYGGEVKDCIDYALCVNEQGSLIKLTTKELELDY 175

Query: 180 RSSEITKDL-IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R+S I K+  ++        P     I A + ++   RE+ QP++  + GS F+ P GH 
Sbjct: 176 RNSIIQKEHLVVLEAAFTLAPGKLTEIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI+ S  +G   GG ++S  H  FM+N DN T  D E L   V+K V  + GI L  
Sbjct: 236 AGKLIQDSNLQGHRIGGVEVSTKHAGFMVNVDNGTATDYENLIHYVQKTVKEKFGIELNR 295

Query: 299 EIKRLGD 305
           E++ +G+
Sbjct: 296 EVRIIGE 302


>gi|182624492|ref|ZP_02952275.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens D str. JGS1721]
 gi|177910300|gb|EDT72681.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens D str. JGS1721]
          Length = 304

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 94/304 (30%), Positives = 149/304 (49%), Gaps = 7/304 (2%)

Query: 3   YGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-D 61
           Y    +LL E   +       + P+ +  +FR GG A+++  P +   +   L L    +
Sbjct: 4   YMEFYKLLGEFYNE--EDITVDSPMSEHIYFRVGGPADILVTPVNEEQVVNTLKLCREYN 61

Query: 62  IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRH 121
           +P  I+G GSNILV+D GI      +      N    +   +   +    K ++ +AL +
Sbjct: 62  VPYFILGNGSNILVKDGGI---SGVVIKFNKLNKITTDGNCVTAQSGALLKDVSKAALEN 118

Query: 122 GIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS 181
            + GF F  GIPGSIGGA +MNAGA + E +  +     ID   N   + +E+L+  YRS
Sbjct: 119 NLRGFEFACGIPGSIGGAVFMNAGAYDGEMAHVIKSARVIDENCNIKNLTKEELELGYRS 178

Query: 182 SEITKDLIITHV-VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
           S + K   +     +         I   I ++ + RE+ QP++  + GSTFK P G+ A 
Sbjct: 179 SIVMKKGYVVIEATVELESGEYASIKDKIDDLTNKRESKQPLEYPSAGSTFKRPEGYFAG 238

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LI+ SG +G   GGA +SE H  F+IN   AT  D+  +   V+K V     + L  E+
Sbjct: 239 KLIQDSGLKGFSIGGAAVSEKHSGFVINKGGATAKDVLDVIAHVQKTVKENFDVELHTEV 298

Query: 301 KRLG 304
           + +G
Sbjct: 299 RIIG 302


>gi|326201318|ref|ZP_08191190.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           papyrosolvens DSM 2782]
 gi|325988886|gb|EGD49710.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           papyrosolvens DSM 2782]
          Length = 312

 Score =  215 bits (548), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 91/303 (30%), Positives = 144/303 (47%), Gaps = 9/303 (2%)

Query: 11  RERGKQL-----RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPI 64
            E  ++L     +     N P+   T F+ GG A++M  P + + L   +     S+IP 
Sbjct: 11  EEFVQKLVYVAGKDGVSVNEPMANHTSFKIGGPADIMTYPGNSNQLVNIVKECVKSNIPY 70

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G G+N+LV D GIR   + +           ++  + + A       +  AL + + 
Sbjct: 71  MVMGNGTNLLVSDKGIR--GVVIKIYDNLAAFKVDNDTIELEAGMLVSKASKLALEYSLT 128

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPG++GGA  MNAGA   E    V +   +D +GN   I  ++  + YRSS I
Sbjct: 129 GLEFAEGIPGTVGGAVTMNAGAYIGEMCMVVHQTEYMDGEGNIITITGDEHCFSYRSSII 188

Query: 185 TK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            K   I+    L+        I   +      R   QP++  + GS FK P G+   +LI
Sbjct: 189 QKSKGIVLKTRLKLQKGDSVNIKEKMDEFNFKRRDKQPLEWPSAGSVFKRPQGYFVGKLI 248

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           +  G RG   GGA+IS+ H  F+IN   AT  D+  L + ++  V  + G+ LE E++ +
Sbjct: 249 DDCGLRGYGIGGAQISDKHSGFIINRGGATCSDVLALIKHIQTTVDERFGVQLEPELRII 308

Query: 304 GDF 306
           GDF
Sbjct: 309 GDF 311


>gi|110802755|ref|YP_697663.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens SM101]
 gi|122956880|sp|Q0SW37|MURB_CLOPS RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|110683256|gb|ABG86626.1| UDP-N-acetylmuramate dehydrogenase [Clostridium perfringens SM101]
          Length = 304

 Score =  215 bits (548), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 94/304 (30%), Positives = 148/304 (48%), Gaps = 7/304 (2%)

Query: 3   YGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-D 61
           Y    +LL E   +       + P+ +  +FR GG A+++  P +   +   L L    +
Sbjct: 4   YMEFYKLLGEFYNE--EDITVDSPMSEHIYFRVGGPADILVTPVNEEQVVNTLKLCREYN 61

Query: 62  IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRH 121
           +P  I+G GSNILV+D GI      +      N        +   +    K ++ +AL +
Sbjct: 62  VPYFILGNGSNILVKDGGI---SGVVIKFNKLNKITTEGNCVTAQSGALLKDVSKAALEN 118

Query: 122 GIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS 181
            + GF F  GIPGSIGGA +MNAGA + E +  +     ID   N   + +E+L+  YRS
Sbjct: 119 NLRGFEFACGIPGSIGGAVFMNAGAYDGEMAHVIKSARVIDENCNIKNLTKEELELGYRS 178

Query: 182 SEITKDLIITHV-VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
           S + K   +     +         I   I ++ + RE+ QP++  + GSTFK P G+ A 
Sbjct: 179 SIVMKKGYVVIEATIELESGEYASIKDKIDDLTNRRESKQPLEYPSAGSTFKRPEGYFAG 238

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LI+ SG +G   GGA +SE H  F+IN   AT  D+  +   V+K V     + L  E+
Sbjct: 239 KLIQDSGLKGFSIGGAAVSEKHSGFVINKGGATAKDVLDVIAHVQKTVKENFDVELHTEV 298

Query: 301 KRLG 304
           + +G
Sbjct: 299 RIIG 302


>gi|49475853|ref|YP_033894.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella henselae
           str. Houston-1]
 gi|49238661|emb|CAF27907.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella henselae
           str. Houston-1]
          Length = 351

 Score =  215 bits (548), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 154/298 (51%), Positives = 207/298 (69%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           ++GK   N  ++++TWFRTGG AE+ +QP D  DL +FL  LP  IP+TIVG+GSN+LVR
Sbjct: 49  IKGKLTPNMDMQKVTWFRTGGLAELFYQPADEVDLAFFLQNLPESIPVTIVGIGSNLLVR 108

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GI GVV+RLS  GF  ++  +    +VGA  + K LA +AL   I GFHF++GIPG +
Sbjct: 109 DGGIPGVVIRLSAKGFGQVQQVSPTGFLVGAATADKHLAAAALEAEIAGFHFYHGIPGGL 168

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET+  VVEV+ +DR+G  H +    + Y YR   + +D I T  +L 
Sbjct: 169 GGALKMNAGANGVETAARVVEVYALDRRGQCHTLSLADMHYSYRHCAVPEDFIFTAALLE 228

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G P ++  I AA+  V  HRE+VQP++EKTGGSTF+NP   SAW++I+++GCRGL+ GGA
Sbjct: 229 GKPGNKGDIRAAMDEVALHRESVQPVREKTGGSTFRNPKDISAWRVIDEAGCRGLQIGGA 288

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVDA 314
           ++SE+HCNFMIN   AT YDLE LGE VR +VF  S  LL+WEI+R+G F   +IV +
Sbjct: 289 QMSEMHCNFMINTGQATAYDLEALGETVRARVFAYSSHLLQWEIQRIGQFEQGRIVSS 346


>gi|319407501|emb|CBI81149.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella sp. 1-1C]
          Length = 325

 Score =  215 bits (548), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 159/307 (51%), Positives = 213/307 (69%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPIT 65
           + + L+   + ++GK   N  ++++TWFRTGG AE+ +QP D  DL  F   LP  IPIT
Sbjct: 12  LLKKLQPALRGIQGKLMPNVDMRKVTWFRTGGIAEIFYQPSDEADLVLFFQSLPESIPIT 71

Query: 66  IVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGG 125
           IVG+GSN+LVRD GI GVV+RLS  GF  +E  +    +VGA  +GK LA +AL   + G
Sbjct: 72  IVGIGSNLLVRDGGIPGVVVRLSAKGFGQLEQVSSKRFLVGAAVAGKHLAAAALEAELSG 131

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT 185
           FHF++GIPG  GGA  MNAGAN  ET++ VVEV+ +DRKG +H++    + Y YR  ++ 
Sbjct: 132 FHFYHGIPGGCGGALKMNAGANGIETAERVVEVYALDRKGQRHILSVNDIHYSYRCCDVP 191

Query: 186 KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEK 245
            D +    +L G    +N I AA+  V  HR+ VQPI+EKTGGSTF+NP G SAW++I++
Sbjct: 192 DDFVFVAALLEGEQGHRNHIRAAMEEVALHRQKVQPIREKTGGSTFRNPVGTSAWRVIDE 251

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +GCRGL+ GGA++SE+HCNFMIN D ATGYDLE LGE VR +VF  SG LL+WEI+R+G 
Sbjct: 252 AGCRGLKIGGAQMSEMHCNFMINIDQATGYDLEKLGETVRARVFAHSGHLLQWEIQRIGQ 311

Query: 306 FFDHQIV 312
           F   +IV
Sbjct: 312 FEQDRIV 318


>gi|331701661|ref|YP_004398620.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           buchneri NRRL B-30929]
 gi|329129004|gb|AEB73557.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           buchneri NRRL B-30929]
          Length = 304

 Score =  215 bits (548), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 82/307 (26%), Positives = 150/307 (48%), Gaps = 10/307 (3%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M+     + + +   ++  +   N PL + T   TGG A+++  P+ I + +  L     
Sbjct: 1   MMQS---KTVVDLYPKI--EILINEPLSKYTHTLTGGPADILAFPKSIKECQEMLDYANE 55

Query: 61  D-IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
             +P+T+VG  SN++V+D GIRG+ + L+     +    +  E++  A  +   +  +A 
Sbjct: 56  QSLPVTVVGNASNLIVKDGGIRGLTMILTKMNRIS---SHENEVVADAGAALIDVTKAAQ 112

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            H +    F  GIPGS+GGA +MNAGA   E +  V     +    +   +  ++L + Y
Sbjct: 113 AHSLTHLEFAAGIPGSVGGAVFMNAGAYGGEIANVVSGAEVLTPDNHIIHLNHQELDFGY 172

Query: 180 RSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRE-TVQPIKEKTGGSTFKNPTGHS 238
           R   + ++  I                    +  +    + QP++  + GS FK PTG+ 
Sbjct: 173 RHCSVQENQQIVISATFSLEVGIADKIQKRMDHLNALRASKQPLELPSCGSVFKRPTGYF 232

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI  +G +G + GGA++S  H  F++N D AT  D   +   V+K V+++ G+ LE 
Sbjct: 233 AGKLIHDAGLQGFQIGGAQVSMKHAGFIVNVDGATATDYLNVIAHVQKTVYDKFGVHLET 292

Query: 299 EIKRLGD 305
           E++ +G+
Sbjct: 293 EVRIIGE 299


>gi|115311587|sp|Q6G2Q7|MURB_BARHE RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
          Length = 325

 Score =  215 bits (548), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 154/298 (51%), Positives = 207/298 (69%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           ++GK   N  ++++TWFRTGG AE+ +QP D  DL +FL  LP  IP+TIVG+GSN+LVR
Sbjct: 23  IKGKLTPNMDMQKVTWFRTGGLAELFYQPADEVDLAFFLQNLPESIPVTIVGIGSNLLVR 82

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GI GVV+RLS  GF  ++  +    +VGA  + K LA +AL   I GFHF++GIPG +
Sbjct: 83  DGGIPGVVIRLSAKGFGQVQQVSPTGFLVGAATADKHLAAAALEAEIAGFHFYHGIPGGL 142

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET+  VVEV+ +DR+G  H +    + Y YR   + +D I T  +L 
Sbjct: 143 GGALKMNAGANGVETAARVVEVYALDRRGQCHTLSLADMHYSYRHCAVPEDFIFTAALLE 202

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G P ++  I AA+  V  HRE+VQP++EKTGGSTF+NP   SAW++I+++GCRGL+ GGA
Sbjct: 203 GKPGNKGDIRAAMDEVALHRESVQPVREKTGGSTFRNPKDISAWRVIDEAGCRGLQIGGA 262

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVDA 314
           ++SE+HCNFMIN   AT YDLE LGE VR +VF  S  LL+WEI+R+G F   +IV +
Sbjct: 263 QMSEMHCNFMINTGQATAYDLEALGETVRARVFAYSSHLLQWEIQRIGQFEQGRIVSS 320


>gi|90962123|ref|YP_536039.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           salivarius UCC118]
 gi|122448786|sp|Q1WSZ5|MURB_LACS1 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|90821317|gb|ABD99956.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           salivarius UCC118]
          Length = 299

 Score =  215 bits (548), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 88/307 (28%), Positives = 148/307 (48%), Gaps = 11/307 (3%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP- 59
           M    +  L  +         + +  LK+ T  +TGG A+V+  P  I + +  + +   
Sbjct: 1   MTTNDLRELFLDL------NVKFDEELKKYTNTKTGGKADVLAFPDSIEETEKLIKIAKK 54

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
           +++P+TI+G  SN++V+D GIRG+V+ L +     +   +  ++   A  S       A 
Sbjct: 55  NNVPLTILGNASNLIVKDGGIRGLVVILQHLDQITV---DGTKVTAQAGASLIGTTRVAA 111

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
           +H + G  F  GIPGSIGGA +MNAGA   E    V  V  + R G       ++L + Y
Sbjct: 112 KHSLTGMEFASGIPGSIGGAIFMNAGAYGGEIKNIVESVKLLTRDGEYKTYTVDELDFGY 171

Query: 180 RSSEIT-KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S +  +D I+     +        I   +  +   R + QP++  + GS FK P GH 
Sbjct: 172 RHSRLQSEDDIVVAATFKLEHGDIKKIRERMEELSFLRASKQPLEYPSCGSVFKRPAGHF 231

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
             +L+  SG +G   GG ++S+ H  F++N  N TG D   +   V+  V  +  + LE 
Sbjct: 232 TGKLVYDSGLQGYTVGGVQVSKKHAGFIVNIGNGTGKDYLDVIHHVQAVVKEKFDVELET 291

Query: 299 EIKRLGD 305
           E++ +G+
Sbjct: 292 EVRIIGE 298


>gi|154499870|ref|ZP_02037908.1| hypothetical protein BACCAP_03527 [Bacteroides capillosus ATCC
           29799]
 gi|150271468|gb|EDM98725.1| hypothetical protein BACCAP_03527 [Bacteroides capillosus ATCC
           29799]
          Length = 305

 Score =  215 bits (548), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 95/306 (31%), Positives = 153/306 (50%), Gaps = 8/306 (2%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS- 60
           I+  +  +L     +L  + +   P+ + T FR GG A +M  P+D  ++K  +      
Sbjct: 3   IFSAVRMVLERECPEL--ELRTEEPMARHTTFRVGGPARLMAFPRDKKEIKAAVRAADEM 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
            +    +G GSN+LV D G+   V++      +      +  +          LA +AL 
Sbjct: 61  GVIPFFLGNGSNLLVADEGVEAFVIKTGGLDQTR---EVNRRLRAECGIPLSRLAVAALG 117

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
            G+ G  F +GIPGS+GGA  MNAGA   E  Q +  V  +D+ G +H +P  +    YR
Sbjct: 118 RGLTGLEFAHGIPGSLGGAVVMNAGAYGGEMVQVLTAVTYLDKHGQEHTVPASECGLTYR 177

Query: 181 SSEI--TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
            S      + ++    +         I A + ++   R++ QP++  + GSTFK P GH 
Sbjct: 178 HSMFTDHPEWLVLEAEMELEQGDAEEIRAKMEDLAQRRKSKQPLEYPSAGSTFKRPEGHF 237

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A  LIE+ G +GL  GGA++SE H  F+IN   AT  D+  L EQ+++ V  ++G+ LE 
Sbjct: 238 AAALIEQCGLKGLTVGGAQVSEKHAGFVINRGGATCADILKLTEQIKETVLRETGVTLEL 297

Query: 299 EIKRLG 304
           E++ LG
Sbjct: 298 EVRTLG 303


>gi|16800527|ref|NP_470795.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria innocua
           Clip11262]
 gi|29336875|sp|Q92BT5|MURB_LISIN RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|16413932|emb|CAC96690.1| lin1459 [Listeria innocua Clip11262]
          Length = 298

 Score =  215 bits (548), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 101/287 (35%), Positives = 151/287 (52%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAG 79
            + N PL + T+ +TGGNA+V   P+ I + K  +T    + +P+TI+G GSN++++D G
Sbjct: 13  IKLNEPLSKYTYTKTGGNADVFVMPKTIEETKEIVTYCHQNKLPLTILGNGSNLIIKDGG 72

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRGV++ L          R + ++I  +       A  AL   + G  F  GIPGSIGGA
Sbjct: 73  IRGVIVHLDLLQSI---ERKNTQIIAMSGAKLIDTAKFALDESLSGLEFACGIPGSIGGA 129

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLRGF 198
            +MNAGA   E S  +     + + G    + R +LK  YR S I  K  I+        
Sbjct: 130 LHMNAGAYGGEISDVLEAATVLTQSGELKKLKRSELKAAYRFSTIAEKKYIVLDATFSLE 189

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
            E +NII A +  +   RE  QP++  + GS FK P GH A +LI+ SG +G   GGA++
Sbjct: 190 LEDKNIIQAKMDELTALREAKQPLEYPSCGSVFKRPPGHFAGKLIQDSGLQGHIIGGAQV 249

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           S  H  F++N   AT  D   L   V++ V  +  + LE E+K +G+
Sbjct: 250 SLKHAGFIVNIGGATATDYMNLIAHVQQTVREKFDVELETEVKIIGE 296


>gi|332653511|ref|ZP_08419256.1| UDP-N-acetylmuramate dehydrogenase [Ruminococcaceae bacterium D16]
 gi|332518657|gb|EGJ48260.1| UDP-N-acetylmuramate dehydrogenase [Ruminococcaceae bacterium D16]
          Length = 307

 Score =  215 bits (548), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 99/304 (32%), Positives = 161/304 (52%), Gaps = 6/304 (1%)

Query: 3   YGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD- 61
           + ++   L++    +  +  +  P+ + T FR GG   +M +P +   +   + L   + 
Sbjct: 8   FDQLFDQLQKCCPDM--ELLKQEPMARHTTFRIGGPVPLMARPTNEEQVLACVRLARENQ 65

Query: 62  IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRH 121
           IP+ ++G GSN+LV D G++     L   G S +E     E+ VGA  +   LA+ A   
Sbjct: 66  IPLVVLGNGSNLLVADEGVQ--AFVLDMTGLSRLERTGEREITVGAGVTLARLASFAAGE 123

Query: 122 GIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS 181
           G+ G  F  GIPG++GGA  MNAGA   E  Q V     +  +G    I  E+ ++ YR 
Sbjct: 124 GLTGLEFAGGIPGTLGGAVMMNAGAYGGEMVQVVRRTRCLTPEGAVKEIVGEEHEFSYRH 183

Query: 182 SEITK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
           S  ++ + +I   VL   P  +  I A +A +   R++ QP++  + GS FK P G+ A 
Sbjct: 184 SVFSQGEDVILSSVLELEPGQEENIRAQMAELAQKRKSKQPLEYPSAGSMFKRPQGYFAA 243

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
            LI++ G +G   GGA++SE H  F+IN   AT  D+  L  +V+++V  Q+G+ LE E+
Sbjct: 244 ALIDQCGLKGFTVGGAQVSEKHAGFVINRGGATCADVLALVREVQRRVREQTGVELEMEV 303

Query: 301 KRLG 304
           +RLG
Sbjct: 304 RRLG 307


>gi|302870981|ref|YP_003839617.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Caldicellulosiruptor
           obsidiansis OB47]
 gi|302573840|gb|ADL41631.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 311

 Score =  215 bits (547), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 91/297 (30%), Positives = 140/297 (47%), Gaps = 7/297 (2%)

Query: 14  GKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSN 72
            K L  +F ++ PLK+ T F+ GG A  +  PQ+       LTL+    I   +VG  SN
Sbjct: 7   LKNLGIEFLKDHPLKEFTTFKIGGKARYIVFPQNTEQFIGILTLIKEKKINYIVVGNCSN 66

Query: 73  ILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGI 132
           +LV D G  G V+         I   +   +          +A  A   G+ G  F  GI
Sbjct: 67  VLVSDKGFNGAVITTVKIDSFKI---DGNLIEADCGAMLSVIAKKACEKGLKGLEFAVGI 123

Query: 133 PGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITH 192
           PG++GGA YMNAGA + E          +D+  N   + + ++K+ YR S + ++ ++  
Sbjct: 124 PGTVGGAVYMNAGAYDSEIKDVFEWAEVLDKNLNILKLSKSEMKFSYRHSRLKEEKMVLL 183

Query: 193 VVLR---GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
                     +   +     +     R   QP+   + GS FK P  + A +LIE +G +
Sbjct: 184 RAAFSLEFAAKEDILPLQKASEFSKRRREKQPLSYPSAGSVFKRPPNNFAGKLIEDAGLK 243

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           G   GGA ISE H  F++N ++A   D+  L    +K V+ + GILLE EI+ +GDF
Sbjct: 244 GYRMGGACISEKHAGFIVNVEDAKAEDVRKLIYLAQKTVYEKFGILLEPEIQFIGDF 300


>gi|217964432|ref|YP_002350110.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes HCC23]
 gi|254764202|sp|B8DE89|MURB_LISMH RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|217333702|gb|ACK39496.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes HCC23]
 gi|307571003|emb|CAR84182.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes L99]
          Length = 298

 Score =  215 bits (547), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 101/287 (35%), Positives = 151/287 (52%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAG 79
            + N PL + T+ +TGG A+V   P+ I + +  +     + IP+TI+G GSN++++D G
Sbjct: 13  IKLNEPLSKYTYTKTGGEADVFVMPKTIEEAQEVVAYCHQNKIPLTILGNGSNLIIKDGG 72

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRGV+L L          RN+ ++I  +       A  AL   + G  F  GIPGSIGGA
Sbjct: 73  IRGVILHLDLLQTI---ERNNTQIIAMSGAKLIDTAKFALDESLSGLEFACGIPGSIGGA 129

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLRGF 198
            +MNAGA   E S  +     + + G    + R +LK  YR S I  K+ I+        
Sbjct: 130 LHMNAGAYGGEISDVLEAATVLTQTGELKKLKRSELKAAYRFSTIAEKNYIVLDATFSLA 189

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
            E +N+I A +  +   RE  QP++  + GS FK P GH A +LI+ SG +G   GGA++
Sbjct: 190 LEEKNLIQAKMDELTAAREAKQPLEYPSCGSVFKRPPGHFAGKLIQDSGLQGHIIGGAQV 249

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           S  H  F++N   AT  D   L   V+K V  +  + LE E+K +G+
Sbjct: 250 SLKHAGFIVNIGGATATDYMNLIAYVQKTVREKFDVELETEVKIIGE 296


>gi|238650472|ref|YP_002916324.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia peacockii
           str. Rustic]
 gi|259509760|sp|C4K125|MURB_RICPU RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|238624570|gb|ACR47276.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia peacockii
           str. Rustic]
          Length = 295

 Score =  215 bits (547), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 131/292 (44%), Positives = 179/292 (61%), Gaps = 2/292 (0%)

Query: 13  RGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSN 72
               ++G++++++ LK +TWF+ GGNAE+ F+P D  DLK FL      +PI   G GSN
Sbjct: 3   ILPIVKGEYKKDYNLKHLTWFKVGGNAEIFFKPLDSEDLKSFLIQNKQKLPIKTFGAGSN 62

Query: 73  ILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGI 132
           I++RD GI GVV++L     +   +     +IVG+ C   +LA     + I GF F  GI
Sbjct: 63  IIIRDGGIEGVVIKLGQNFSNIEFID--NHLIVGSSCLNYNLAKFCQANAISGFEFLVGI 120

Query: 133 PGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITH 192
           PG+IGG   MNAGA   E    VV++  ID  GN      E + ++YRS+ + K+LII  
Sbjct: 121 PGTIGGGVAMNAGAYGSEFKDIVVQIEAIDFAGNFLTFTNEAIGFKYRSNNLPKNLIILK 180

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
           VV +        I   +  + + R + QPIKE+TGGSTF NP GH +W+LI+K+G RG  
Sbjct: 181 VVFKINKGDSENILLRMNEINNARSSTQPIKERTGGSTFANPEGHKSWELIDKAGLRGYR 240

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            GGA +SELHCNFMIN  +AT  DLE LG+ VR+KV   SG+ LEWEIKR+G
Sbjct: 241 IGGASMSELHCNFMINNGDATAKDLEDLGDFVRQKVCEDSGVKLEWEIKRIG 292


>gi|153956162|ref|YP_001396927.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium kluyveri
           DSM 555]
 gi|219856487|ref|YP_002473609.1| hypothetical protein CKR_3144 [Clostridium kluyveri NBRC 12016]
 gi|189028921|sp|A5N360|MURB_CLOK5 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|254764169|sp|B9DWV2|MURB_CLOK1 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|146349020|gb|EDK35556.1| MurB [Clostridium kluyveri DSM 555]
 gi|219570211|dbj|BAH08195.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 304

 Score =  215 bits (547), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 101/306 (33%), Positives = 157/306 (51%), Gaps = 10/306 (3%)

Query: 7   SRLLRERGKQLRG-----KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-S 60
                +   +LR        + + P+K+ T F+ GG  +++  P+  + +   + L    
Sbjct: 1   MNKFEDFAIKLREILDIEDIKIDEPMKEHTSFKVGGPVDILLTPKHFNQVVDVVKLCKKE 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           +IP  I+G GSN+LV+D GIRGV+++L       +      ++I  +  S K ++ +AL 
Sbjct: 61  NIPYYIMGNGSNLLVKDGGIRGVMIKLVKLNKIQV---KGNKIITESGVSLKDISTTALE 117

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
           + + GF F  GIPGS+GGA  MNAGA N E S  +     I   G   V+ RE+++  YR
Sbjct: 118 NCLTGFEFACGIPGSVGGAVTMNAGAYNGEISNVIESAKVICNSGEIIVLNREEMELGYR 177

Query: 181 SSEITKD-LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
            S I K+   I  V       ++  I   I ++   R   QP++  + GSTFK P GH A
Sbjct: 178 MSSILKNGYTILEVTFNLEKGNKENIMNRIEDLSRRRNEKQPLEYASAGSTFKRPQGHFA 237

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LIE SG +G   G A++SE H  F+IN  NAT  D+  L   V+ +V     I L  E
Sbjct: 238 AKLIEDSGLKGESVGDAQVSEKHSGFIINKGNATAKDILTLISIVQDRVRQNFDIDLYTE 297

Query: 300 IKRLGD 305
           ++ +G+
Sbjct: 298 VRIIGE 303


>gi|325845029|ref|ZP_08168346.1| UDP-N-acetylmuramate dehydrogenase [Turicibacter sp. HGF1]
 gi|325488937|gb|EGC91329.1| UDP-N-acetylmuramate dehydrogenase [Turicibacter sp. HGF1]
          Length = 302

 Score =  215 bits (547), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 99/301 (32%), Positives = 151/301 (50%), Gaps = 9/301 (2%)

Query: 9   LLRERGKQLRGK----FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIP 63
           + +   ++ +GK      EN PL + T FR GG A  +  P     L   + L+   ++P
Sbjct: 1   MFKSFIEEYKGKNIGLLLENEPLSKHTTFRVGGPARCLVIPNSKQSLVETMKLINKYELP 60

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
             ++G GSN+L  D    G++++               ++ VGA  S   LAN   +  +
Sbjct: 61  FKVIGRGSNLLPSDRLFEGIIVKCDKGLDHVEID--GTQVTVGAGVSTILLANKVAKCEL 118

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            G  F  G+PGS+GGA YMNAGA N E    +V+   +D  G    +  E++ + YR S 
Sbjct: 119 AGLEFISGVPGSVGGAIYMNAGAYNREIQDVLVKALILDEAGELKWLTVEEMGFSYRQSI 178

Query: 184 I--TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
           +   K+ I+   VL+    S   I   +      R   QP    + GSTF+NP  H +WQ
Sbjct: 179 LQTHKNWIVVEAVLQLEKGSYEEIMELMKARKVRRIESQPTNLPSAGSTFRNPLPHYSWQ 238

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           LIE+SG RG+  GGA++S+ HCNF++N   AT  D+  L + V+  VF + GI L  E++
Sbjct: 239 LIERSGLRGVRIGGAEVSQKHCNFIVNVGGATATDIYELIQHVQAVVFEKHGIQLHPEVE 298

Query: 302 R 302
            
Sbjct: 299 M 299


>gi|315303147|ref|ZP_07873818.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria ivanovii
           FSL F6-596]
 gi|313628478|gb|EFR96940.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria ivanovii
           FSL F6-596]
          Length = 298

 Score =  215 bits (547), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 95/287 (33%), Positives = 148/287 (51%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAG 79
            + N PL + T+ +TGGNA++   P+   + +  ++     +IP+TI+G GSN++++D G
Sbjct: 13  IKLNEPLSKYTYTKTGGNADIFVMPKTTQETQEIVSYCHLKNIPLTILGNGSNLIIKDGG 72

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRGV++ L          R + ++   +       A  AL   + G  F  GIPGSIGGA
Sbjct: 73  IRGVIVHLDLLQS---MERKNTQVTAMSGAKLIDTAKFALEESLSGLEFACGIPGSIGGA 129

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLRGF 198
            +MNAGA   E S  +     + + G    + R +LK  YR S I  K+ I+        
Sbjct: 130 LHMNAGAYGGEISDCLEAATVLTQSGELKKLKRSELKAAYRFSTIAEKNYIVLDATFSLK 189

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
            + +N I   +  +   RE  QP++  + GS FK P GH A +LI+ SG +G   GGA++
Sbjct: 190 LDDKNNIQTKMDELTAAREAKQPLEYPSCGSVFKRPPGHFAGKLIQDSGLQGHIIGGAQV 249

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           S  H  F++N   AT  D   L   V+K V  +  + LE E+K +G+
Sbjct: 250 SLKHAGFIVNIGGATATDYMNLIAYVQKTVREKFDVELETEVKIIGE 296


>gi|94498829|ref|ZP_01305373.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sphingomonas sp.
           SKA58]
 gi|94421717|gb|EAT06774.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sphingomonas sp.
           SKA58]
          Length = 287

 Score =  215 bits (547), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 121/284 (42%), Positives = 168/284 (59%), Gaps = 1/284 (0%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDAGI 80
            +    L  + WF+TGG A+ +F+PQD  DL  FL  L  D+P+  +GLGSN++VRD G+
Sbjct: 2   LKPAASLAPLVWFKTGGPAQWLFEPQDADDLSDFLAQLDPDMPVMALGLGSNLIVRDGGV 61

Query: 81  RGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAA 140
            GVV+RL               +   A  SG  ++++A   GI G  F   IPG++GG  
Sbjct: 62  PGVVVRLGKPFAKVERQDETTLVCG-AGASGILVSSTARDAGIAGLEFLRSIPGTVGGFV 120

Query: 141 YMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPE 200
            MN GA   ET+  ++E   + R G Q  +    L Y YR S +T   I+     RG P 
Sbjct: 121 RMNGGAYGRETADILLECELVLRSGEQVTLLNRDLAYSYRHSNLTDGAIVVSATFRGHPG 180

Query: 201 SQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISE 260
               I A +  +   RE  QP++ KTGGSTFKNP GH AWQL++++GCRGL+ GGA++SE
Sbjct: 181 ESAAIQAEMDRIAAAREESQPLRSKTGGSTFKNPDGHKAWQLVDEAGCRGLQIGGAQVSE 240

Query: 261 LHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            H NF++N   AT  D+E LGE+VR++V  +SGI LEWEI+R+G
Sbjct: 241 KHTNFLLNTGGATSTDIEALGEEVRRRVREKSGIELEWEIQRVG 284


>gi|229020310|ref|ZP_04177077.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           AH1273]
 gi|229026535|ref|ZP_04182886.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           AH1272]
 gi|228734761|gb|EEL85404.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           AH1272]
 gi|228740982|gb|EEL91213.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           AH1273]
          Length = 305

 Score =  215 bits (547), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 87/307 (28%), Positives = 147/307 (47%), Gaps = 7/307 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    + + L     +  G  +++  LK  T  + GG A+V   P +  +++  +     
Sbjct: 1   MNMQEVYKYLSTVLPE--GHVKKDEMLKDHTHIKVGGKADVFVAPTNYDEIQEVIKYANE 58

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +IP+T +G GSN++++D G+RG+ + L               ++     +   ++  AL
Sbjct: 59  YNIPVTFLGNGSNVIIKDGGLRGITVSLI---HITGVTVTGTTIVAQCGAAIIDVSRIAL 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            H + G  F  GIPGS+GGA YMNAGA   E S  + E   +   G    + +E  ++ Y
Sbjct: 116 DHNLTGLEFACGIPGSVGGALYMNAGAYGGEVSFVLTEAVVMTGDGELRTLTKEAFEFGY 175

Query: 180 RSSEITKDLII-THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S    +  I            +  I   + ++   RE+ QP++  + GS FK P  + 
Sbjct: 176 RKSVFANNHYIILEARFELEEGVREEIKEKMDDLTFKRESKQPLEYPSCGSVFKRPPNNF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI++SG +G   GG ++S  H  FM+N DN T  D   L   V+K V  + G+ LE 
Sbjct: 236 AGKLIQESGLQGKRIGGVEVSLKHAGFMVNVDNGTAQDYIDLIHFVQKTVEEKFGVKLER 295

Query: 299 EIKRLGD 305
           E++ +G+
Sbjct: 296 EVRIIGE 302


>gi|325694410|gb|EGD36321.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK150]
          Length = 301

 Score =  215 bits (547), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 96/302 (31%), Positives = 149/302 (49%), Gaps = 6/302 (1%)

Query: 7   SRLLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPI 64
            + L +   +L G   + N PL Q T+ + GG A+ +  P++ ++L   +      DIP 
Sbjct: 1   MQKLEKLKSELEGIDIRFNEPLSQYTYTKVGGAADFLVFPRNRYELARIVNFANQEDIPW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G  SNI+VRD GIRG V+         +   +   +   A  +     + AL++ + 
Sbjct: 61  MVLGNASNIIVRDGGIRGFVIMFDKLNNVAV---DGYMIEAEAGANLIQTTHIALQNSLT 117

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           GF F  GIPGS+GGA +MNAGA   E +  +V    +  +G    +    +K+ YR S +
Sbjct: 118 GFEFACGIPGSVGGAVFMNAGAYGGEIAHVLVSCKVLTPQGQVKTLDVRDMKFGYRHSLV 177

Query: 185 TK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            +   I+              I   +  + H RE  QP++  + GS FK P GH A  LI
Sbjct: 178 QETGDIVISAKFALSLGVHRTIRQEMERLTHLRELKQPLEYPSCGSVFKRPLGHFAGLLI 237

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
            ++G +G   GG ++SE H  FMIN D  T  D E L   V ++V   SGI LE E++ +
Sbjct: 238 SEAGLKGHRIGGVEVSEKHAGFMINVDKGTAQDYENLIAHVIERVRENSGITLEREVRII 297

Query: 304 GD 305
           G+
Sbjct: 298 GE 299


>gi|290967918|ref|ZP_06559468.1| UDP-N-acetylmuramate dehydrogenase [Megasphaera genomosp. type_1
           str. 28L]
 gi|290782057|gb|EFD94635.1| UDP-N-acetylmuramate dehydrogenase [Megasphaera genomosp. type_1
           str. 28L]
          Length = 307

 Score =  215 bits (547), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 93/308 (30%), Positives = 154/308 (50%), Gaps = 5/308 (1%)

Query: 1   MIYGRISRLLRERGKQLR-GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP 59
           M   R+S L+      ++  +   N P+ + T F  GG A+++  P  + ++   +    
Sbjct: 1   MTDNRLSLLIETLQPHMKPEQMLANEPMSRHTTFAVGGPADLLLLPYTVKEMSLAIRAAR 60

Query: 60  S-DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSA 118
           +  +PIT++G GSN+LV D GIR     +     + +  R+   +   A      +   A
Sbjct: 61  ALQLPITVLGGGSNVLVLDGGIR--GAVIQLQALTQVLYRHDDRITASAGHMLADVCEFA 118

Query: 119 LRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQ 178
              G+GG  F  GIPG++GGA +MNAGA + E S  V  V  +D +G  H       ++ 
Sbjct: 119 CAEGLGGAEFACGIPGTLGGAVFMNAGAYDGEMSHIVARVRTVDHRGGVHTYAAAACRFA 178

Query: 179 YRSSEITK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGH 237
           YR S   +    +    L     S+  I A +  +   R + QP++  + GSTFK P G+
Sbjct: 179 YRRSRFQETQEYVVEAELLLHAASRTAIQARMEELMRRRRSKQPLEMASAGSTFKRPPGY 238

Query: 238 SAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLE 297
            A  LI+++G +GL FGGA++S  H  F++N   AT  D+  +   V+++V    G+ LE
Sbjct: 239 FAGTLIDQTGLKGLTFGGAQVSTKHAGFVVNTGRATARDVLQVIHAVQERVEAAHGVRLE 298

Query: 298 WEIKRLGD 305
            E++ LG+
Sbjct: 299 PEVRILGE 306


>gi|225377819|ref|ZP_03755040.1| hypothetical protein ROSEINA2194_03470 [Roseburia inulinivorans DSM
           16841]
 gi|225210330|gb|EEG92684.1| hypothetical protein ROSEINA2194_03470 [Roseburia inulinivorans DSM
           16841]
          Length = 302

 Score =  215 bits (547), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 110/288 (38%), Positives = 154/288 (53%), Gaps = 5/288 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAG 79
                P+K+ T FR GG A+V+ QP D   L   L L     +P + +G GSN+LV D G
Sbjct: 18  IFMEEPMKKHTTFRVGGPADVLVQP-DETALAAVLGLCRQHHVPYSFIGNGSNLLVGDKG 76

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRGVV+ ++              +   A      +AN+A  +G+GG  F  GIPGS+GGA
Sbjct: 77  IRGVVIEMTEPMGDIEV--QGTRITAQAGAMLSKIANTAASNGLGGMEFAAGIPGSVGGA 134

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLRGF 198
             MNAGA   E    +  V+ +D  G Q  + R+ L   YR S I  K  I+T VVL   
Sbjct: 135 VVMNAGAYGGEMKDIIERVYVLDENGAQLELDRDALDLGYRHSCIPDKKYIVTKVVLELV 194

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P  +  I + +  +   R   QP++  + GSTFK P G+ A +LI  +G RG + GGA++
Sbjct: 195 PRDEAEIRSEMKELNEKRAEKQPLQYPSAGSTFKRPEGYFAGKLIMDAGLRGYQVGGAQV 254

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           SE HC F+IN  +AT  D+  L   V  KV  Q G++LE E+K +G+F
Sbjct: 255 SEKHCGFVINKGDATAADICQLMRDVSDKVQAQFGVVLEPEVKMIGEF 302


>gi|229917749|ref|YP_002886395.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Exiguobacterium sp.
           AT1b]
 gi|229469178|gb|ACQ70950.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Exiguobacterium sp.
           AT1b]
          Length = 306

 Score =  215 bits (547), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 92/288 (31%), Positives = 153/288 (53%), Gaps = 5/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDA 78
           +  ++ PL   T+ + GG A+    P    +++  L L   + +P  I+G GSN++VRD 
Sbjct: 15  RVLQDEPLSAHTYTKLGGKADYFVAPHTYEEVQAVLQLAHQEAMPFMILGFGSNLIVRDG 74

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIRG+VL L+         R   +MI  A  +   ++  AL  G+ G  F  GIPG++GG
Sbjct: 75  GIRGIVLNLNELDSIR---REGNQMIAQAGAAIIDVSRQALAEGLSGLEFACGIPGTVGG 131

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL-IITHVVLRG 197
           A YMNAGA   ET   +     + + G    + +++L   YR+S ++K+  I+       
Sbjct: 132 AVYMNAGAYGGETKDVITSATVLTQDGQVLHLSKDELDLDYRTSRVSKEGLIVLEATFEL 191

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P++  +I   + ++ + RE+ QP++  + GS FK P G+ A +LI+ SG +G   GGA+
Sbjct: 192 EPKNYELIKEVMDDLTYKRESKQPLEYPSCGSVFKRPPGYFAGKLIQDSGLQGKRIGGAE 251

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S  H  F++N D AT  +   L   V+  V  +  + LE E+K +G+
Sbjct: 252 VSLKHAGFIVNIDEATATEYISLIRHVQATVKEKFEVELEPEVKIIGE 299


>gi|160939918|ref|ZP_02087265.1| hypothetical protein CLOBOL_04809 [Clostridium bolteae ATCC
           BAA-613]
 gi|158437352|gb|EDP15117.1| hypothetical protein CLOBOL_04809 [Clostridium bolteae ATCC
           BAA-613]
          Length = 298

 Score =  215 bits (547), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 102/300 (34%), Positives = 148/300 (49%), Gaps = 4/300 (1%)

Query: 9   LLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIV 67
           +L+E         +   P+   T FR GG AE    P +  +L   + +    DIP  ++
Sbjct: 1   MLKEVLVSEGAVCRFMEPMSNHTTFRIGGPAEAYVCPGNEDELGKVICMCREHDIPWNVL 60

Query: 68  GLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFH 127
           G GSN+LV D GI+   + ++  G           +  GA      +A  AL H + G  
Sbjct: 61  GNGSNLLVSDRGIK--GVVIAMEGNWCYAGAEGSVIRAGAGELLGRVARVALDHCLTGME 118

Query: 128 FFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TK 186
           F  GIPGS+GGA  MNAGA   E    +     +  +G    +  ++L+  YR+S I  +
Sbjct: 119 FAAGIPGSVGGALVMNAGAYGSEIKNILKSARVMTNEGEVLELSVDELELGYRTSCIPHR 178

Query: 187 DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKS 246
              +     +  P  Q  I A +  +   R   QP++  + GSTFK P G+ A +LIE +
Sbjct: 179 GYTVLEASFQLEPGDQEAIEARMKELAARRREKQPLEYPSAGSTFKRPQGYFAGKLIEDA 238

Query: 247 GCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           G RG   GGA++SE HC F+IN  NAT  D+  L   +RK V  QSG+ LE E+KR G+F
Sbjct: 239 GLRGYGMGGARVSEKHCGFVINGGNATASDVMALCGHIRKTVMEQSGVELEMEVKRWGEF 298


>gi|296275147|ref|ZP_06857654.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus MR1]
          Length = 307

 Score =  215 bits (547), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 97/307 (31%), Positives = 162/307 (52%), Gaps = 7/307 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-P 59
           MI   I + L++       K + + PLK+ T+ +TGGNA+    P    +++  +     
Sbjct: 1   MINKDIYQALQQLIPN--EKIKVDEPLKRYTYTKTGGNADFYITPTKNEEVQAVVKYAYQ 58

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
           ++IP+T +G GSNI++R+ GIRG+V+ L +    ++       +I G+  +   ++  A 
Sbjct: 59  NEIPVTYLGNGSNIIIREGGIRGIVISLLSLDHIDVSDDA---IIAGSGAAIIDVSRVAR 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            + + G  F  GIPGSIGGA YMNAGA   E    +     ++ +G+   +  ++L+  Y
Sbjct: 116 DYALTGLEFACGIPGSIGGAVYMNAGAYGGEVKDCIDYALCVNEQGSLIKLTTKELELDY 175

Query: 180 RSSEITKDL-IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R+S I K+  ++        P     I A + ++   RE+ QP++  + GS F+ P GH 
Sbjct: 176 RNSIIQKEHLVVLEAAFTLAPGKMTEIQAKMDDLTERRESKQPLEYPSCGSVFQRPLGHF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI+ S  +G   GG ++S  H  FM+N DN T  D E L   V+K V  + GI L  
Sbjct: 236 AGKLIQDSNLQGHRIGGVEVSTKHAGFMVNVDNGTATDYENLIHYVQKTVKEKFGIELNR 295

Query: 299 EIKRLGD 305
           E++ +G+
Sbjct: 296 EVRIIGE 302


>gi|331268618|ref|YP_004395110.1| UDP-N-acetylmuramate dehydrogenase [Clostridium botulinum
           BKT015925]
 gi|329125168|gb|AEB75113.1| UDP-N-acetylmuramate dehydrogenase [Clostridium botulinum
           BKT015925]
          Length = 307

 Score =  215 bits (547), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 98/303 (32%), Positives = 158/303 (52%), Gaps = 7/303 (2%)

Query: 5   RISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIP 63
            I++ L     +   + + N  +K  T FR GG A+V   P     ++  + +    ++P
Sbjct: 6   DINKKLESILDK--EEIKNNVLMKSYTSFRVGGPADVFVTPNSYEKIRDVIKICKQYNVP 63

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
             I+G GSN+LVRD GIRGVV+  +      +      ++I  +      +AN+AL++ +
Sbjct: 64  YFILGNGSNLLVRDGGIRGVVINFTKLNKILV---EETKVIAESGAVLSMVANAALKNDL 120

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            G  F +GIPGS+GGA  MNAGA N E  Q +     ID  G    I +E++   YR+S 
Sbjct: 121 TGLEFAHGIPGSVGGAVAMNAGAYNGEICQVIESATIIDSDGEIREICKEEMDLSYRNSL 180

Query: 184 ITKD-LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
           I K+  I+     +      + I A + ++   R+  QP++  + GSTFK P G+ A +L
Sbjct: 181 ILKNGYIVLKATFKLQRGEHDSIKARMDDLMRRRKEKQPLEYPSAGSTFKRPEGYFAAKL 240

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IE S  +G   G A++S  H  F+IN  NA+  D+  L E V+K V ++  + L  E++ 
Sbjct: 241 IEDSELKGAHVGDAEVSVKHSGFIINKGNASAKDILDLIELVKKTVNDKFQVALNTEVRI 300

Query: 303 LGD 305
           +G+
Sbjct: 301 VGE 303


>gi|226313547|ref|YP_002773441.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Brevibacillus brevis
           NBRC 100599]
 gi|226096495|dbj|BAH44937.1| probable UDP-N-acetylenolpyruvoylglucosamine reductase
           [Brevibacillus brevis NBRC 100599]
          Length = 300

 Score =  215 bits (546), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 99/295 (33%), Positives = 146/295 (49%), Gaps = 4/295 (1%)

Query: 13  RGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGS 71
             ++ + +     PL   T ++ GG A+++  P     L   L +L    +P  ++G GS
Sbjct: 7   LLRERQVEVTYQEPLAAHTTWKVGGPADLLITPSSKSQLIMVLQILNEHHVPWMVMGKGS 66

Query: 72  NILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYG 131
           N+LV D G RG V++L+ A           ++  GA  S   LA  A +H + G  F  G
Sbjct: 67  NLLVTDKGYRGAVIKLNKALD--YARIVGNQIYAGAGYSLIKLAALANKHRLSGLEFAGG 124

Query: 132 IPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLII 190
           IPGS+GGA YMNAGAN  + S        I + G    +    L + YR S +   + II
Sbjct: 125 IPGSVGGAVYMNAGANGSDISDIFHSAEVITQTGAIRSLRDVDLDFSYRHSSLQDANAII 184

Query: 191 THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRG 250
           T  V          I          R   QP+     GS F+NP GH A +LIE +G +G
Sbjct: 185 TEAVFELTMRDNESIKLQWNRYKEKRLQTQPLPFDCAGSVFRNPPGHFAAKLIEDAGLKG 244

Query: 251 LEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           + +GGA++S  H NF++N  NAT  D+  L  Q+++KV +QSGI L  E+  +G+
Sbjct: 245 MRYGGAEVSSKHANFIMNTGNATALDVWTLMRQIQEKVHSQSGIYLVPEVVIVGE 299


>gi|297588763|ref|ZP_06947406.1| UDP-N-acetylmuramate dehydrogenase [Finegoldia magna ATCC 53516]
 gi|297574136|gb|EFH92857.1| UDP-N-acetylmuramate dehydrogenase [Finegoldia magna ATCC 53516]
          Length = 301

 Score =  215 bits (546), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 88/288 (30%), Positives = 141/288 (48%), Gaps = 4/288 (1%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDI-PITIVGLGSNILVRD 77
           G+   + P+K  T F+ GG+ +VM  PQ    +   + L+  +     I+G GSN+LV D
Sbjct: 14  GEILYDEPMKNHTTFKIGGSCDVMIFPQTEEQIINAIQLIKQNGFAYRIIGNGSNLLVSD 73

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G+R VV++L +             +   +     +++  A+ +   GF    GIPG IG
Sbjct: 74  EGLREVVIKLHDNFNDMKID--GDILTAKSGALLSAVSKLAINNSYAGFEAVSGIPGDIG 131

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL-IITHVVLR 196
           GA  MNAGA   E +  V  V  ID   N      +++ + YR S +  +  I+  V   
Sbjct: 132 GAITMNAGAYGTEMNDIVHRVKVIDSDLNVKYYSCDEMDFSYRHSRVQDEKLIVLEVEFL 191

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
                Q  I     +    R + QP++  + GS FK P GH A QLI+++G RG  +  A
Sbjct: 192 LKKGDQQEILNNFHDYTERRTSKQPLELPSCGSVFKRPEGHFAGQLIDEAGLRGYRYNDA 251

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            +SE HC F++N  +A   D+  + E V++ VF +  + LE E++ +G
Sbjct: 252 MVSEKHCGFIVNVGDAKCSDVVAVIEHVQEVVFEKFNVKLEPEVRIIG 299


>gi|323438910|gb|EGA96645.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus O11]
 gi|323441858|gb|EGA99498.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus O46]
          Length = 307

 Score =  215 bits (546), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 97/307 (31%), Positives = 162/307 (52%), Gaps = 7/307 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-P 59
           MI   I + L++       K + + PLK+ T+ +TGGNA+    P    +++  +     
Sbjct: 1   MINKDIYQALQQLIPN--EKIKVDEPLKRYTYTKTGGNADFYITPTKNEEVQAVVKYAYQ 58

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
           ++IP+T +G GSNI++R+ GIRG+V+ L +     +       +I G+  +   ++  A 
Sbjct: 59  NEIPVTYLGNGSNIIIREGGIRGIVISLLSLDHIEVSDDA---IIAGSGAAIIDVSRVAR 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            + + G  F  GIPGSIGGA YMNAGA   E    +     ++ +G+   +  ++L+  Y
Sbjct: 116 DYALTGLEFACGIPGSIGGAVYMNAGAYGGEVKDCIDYALCVNEQGSLIKLTTKELELDY 175

Query: 180 RSSEITKDL-IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R+S I K+  ++        P     I A + ++   RE+ QP++  + GS F+ P GH 
Sbjct: 176 RNSIIQKEHLVVLEAAFTLAPGKLTEIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI+ S  +G   GG ++S  H  FM+N DN T  D E L   V+K V ++ GI L  
Sbjct: 236 AGKLIQDSNLQGHRIGGVEVSTKHAGFMVNVDNGTATDYENLIHYVQKTVKDKFGIELNR 295

Query: 299 EIKRLGD 305
           E++ +G+
Sbjct: 296 EVRIIGE 302


>gi|290894089|ref|ZP_06557062.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes FSL J2-071]
 gi|290556344|gb|EFD89885.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes FSL J2-071]
          Length = 298

 Score =  215 bits (546), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 100/287 (34%), Positives = 151/287 (52%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAG 79
            + N PL + T+ +TGG A+V   P+ I + +  +     + IP+TI+G GSN++++D G
Sbjct: 13  IKLNEPLSKYTYTKTGGEADVFVMPKTIEEAQEVVAYCHQNKIPLTILGNGSNLIIKDGG 72

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRGV+L L          RN+ ++I  +       A  AL   + G  F  GIPGSIGGA
Sbjct: 73  IRGVILHLDLLQTI---ERNNTQIIAMSGAKLIDTAKFALDESLSGLEFACGIPGSIGGA 129

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLRGF 198
            +MNAGA   E S  +     + + G    + R +LK  YR S I  K+ I+        
Sbjct: 130 LHMNAGAYGGEISDVLEAATVLTQTGELKKLKRSELKAAYRFSTIAEKNYIVLDATFSLA 189

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
            E +++I A +  +   RE  QP++  + GS FK P GH A +LI+ SG +G   GGA++
Sbjct: 190 LEEKSLIQAKMDELTAAREAKQPLEYPSCGSVFKRPPGHFAGKLIQDSGLQGHIIGGAQV 249

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           S  H  F++N   AT  D   L   V+K V  +  + LE E+K +G+
Sbjct: 250 SLKHAGFIVNIGGATATDYMNLIAYVQKTVREKFDVELETEVKIIGE 296


>gi|308069879|ref|YP_003871484.1| UDP-N-acetylenolpyruvoylglucosamine reductase (UDP-N-acetylmuramate
           dehydrogenase) [Paenibacillus polymyxa E681]
 gi|305859158|gb|ADM70946.1| UDP-N-acetylenolpyruvoylglucosamine reductase (UDP-N-acetylmuramate
           dehydrogenase) [Paenibacillus polymyxa E681]
          Length = 301

 Score =  215 bits (546), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 100/289 (34%), Positives = 148/289 (51%), Gaps = 4/289 (1%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRD 77
           GK  E+ PL + T +R GG A+ +  P     L   L L     IP   +G GSN+LV D
Sbjct: 14  GKVLEHEPLFKYTTWRIGGPADALVIPDTKEQLARVLKLASEHGIPWMQLGRGSNMLVSD 73

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            GIRG+V++L              +++ G   S   L   A + G+ G  F  GIPGS+G
Sbjct: 74  KGIRGLVIKLGPGFD--YVHFKDEQIVAGGGVSLVKLCVMASKQGLSGLEFAGGIPGSVG 131

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL-IITHVVLR 196
           GA YMNAGA+  + SQ       +   G   V   E + + YR S + +   ++T  V R
Sbjct: 132 GAVYMNAGAHGSDVSQIFQSAEIVLDTGELAVYDAENMHFSYRHSVLHEQRGMVTEAVFR 191

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
                +  ISAA+A     R   QP++    GS F+NP G  A +LIE +G +GL+ GGA
Sbjct: 192 MKRGDREEISAALAAFKDRRRLTQPLQLACAGSVFRNPPGDYAARLIESAGLKGLKAGGA 251

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           ++S  H NF++N   AT  D+  L + ++  + +Q+GI L  E+  +G+
Sbjct: 252 EVSVQHANFIVNTGQATAEDVLTLMKHIQSTISSQTGIKLVPEVFVVGE 300


>gi|154685942|ref|YP_001421103.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           amyloliquefaciens FZB42]
 gi|166222822|sp|A7Z4E6|MURB_BACA2 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|154351793|gb|ABS73872.1| MurB [Bacillus amyloliquefaciens FZB42]
          Length = 303

 Score =  215 bits (546), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 93/303 (30%), Positives = 157/303 (51%), Gaps = 7/303 (2%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           +  +++E   +  GK  E  PL   T  + GG A+++  P  +  +K  + ++   D+P 
Sbjct: 1   MENVIQELRDREVGKVLEQEPLANHTTMKIGGPADILIIPNRVEAVKDIMDIVKKHDLPW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRL-SNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           T++G GSN+LV D GIRGVV++L +      I+          +     +  +   + G+
Sbjct: 61  TVIGRGSNLLVLDEGIRGVVIKLGAGLDHLEIDGDQVTVGGGYSVVRLATSMS---KKGM 117

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            G  F  GIPGSIGGA YMNAGA+  + S+ +V+   +   G    +  E++ + YR+S 
Sbjct: 118 SGLEFAAGIPGSIGGAVYMNAGAHGSDMSEILVKARILFEDGTIEWLTNEEMDFSYRTSV 177

Query: 184 ITKDLIITHVVL--RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
           + K      +    +   + +  I+A +     +R+  QP      GS F+NP    A  
Sbjct: 178 LQKKRPGVCLEAVLQLEQKEREAITAQMQQNKDYRKNTQPYSSPCAGSIFRNPLPDHAGN 237

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           L+EK+G +G + GGAK+SE+H NF++NA  AT  D+  L E V+K +  Q  + +  E++
Sbjct: 238 LVEKAGLKGHQIGGAKVSEMHGNFIVNAGGATAKDVLDLIEYVKKTIREQYDVDMHTEVE 297

Query: 302 RLG 304
            +G
Sbjct: 298 IIG 300


>gi|229199219|ref|ZP_04325897.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           m1293]
 gi|228584236|gb|EEK42376.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           m1293]
 gi|324329010|gb|ADY24270.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis serovar finitimus YBT-020]
          Length = 305

 Score =  215 bits (546), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 89/310 (28%), Positives = 146/310 (47%), Gaps = 7/310 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    +   L     +  G  +++  LK  T  + GG A+V   P +  +++  +     
Sbjct: 1   MNMQEVYEYLSTVLPE--GHVKQDEMLKNHTHIKVGGKADVFVAPTNYDEIQEVIKYANK 58

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +IP+T +G GSN++++D GIRG+ + L               ++     +   ++  AL
Sbjct: 59  YNIPVTFLGNGSNVIIKDGGIRGITVSLI---HITGVTVTGTTIVAQCGAAIIDVSRIAL 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            H + G  F  GIPGS+GGA YMNAGA   E S  + E   +   G    + +E  ++ Y
Sbjct: 116 EHNLTGLEFACGIPGSVGGALYMNAGAYGGEISYVLTEAVVMTGDGELRTLTKEAFEFGY 175

Query: 180 RSSEITKDLII-THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S    +  I               I A + ++   RE+ QP++  + GS FK P  + 
Sbjct: 176 RKSVFANNHYIILEARFELEEGVHEEIKAKMDDLTFKRESKQPLEYPSCGSVFKRPPNNF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI+ SG +G   GG ++S  H  FM+N DN T  D   L   V+K V  + G+ LE 
Sbjct: 236 AGKLIQDSGLQGKRIGGVEVSLKHAGFMVNVDNGTAQDYIDLIHFVQKTVEEKFGVKLER 295

Query: 299 EIKRLGDFFD 308
           E++ +G+  +
Sbjct: 296 EVRIIGEDKE 305


>gi|47567311|ref|ZP_00238024.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           G9241]
 gi|229158673|ref|ZP_04286731.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus ATCC
           4342]
 gi|47555932|gb|EAL14270.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           G9241]
 gi|228624657|gb|EEK81426.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus ATCC
           4342]
          Length = 305

 Score =  215 bits (546), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 89/310 (28%), Positives = 147/310 (47%), Gaps = 7/310 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    +   L     +  G  +++  LK  T  + GG A+V   P +  +++  +     
Sbjct: 1   MNMQEVYEYLSTVLPE--GHVKQDEMLKNHTHIKVGGKADVFVAPTNYDEIQEVIKYANE 58

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +IP+T +G GSN++++D GIRG+ + L               ++     +   ++  AL
Sbjct: 59  YNIPVTFLGNGSNVIIKDGGIRGITVSLI---HITGVTVTGTTIVAQCGAAIIDVSRIAL 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            H + G  F  GIPGS+GGA YMNAGA   E S  + E   +   G    + +E  ++ Y
Sbjct: 116 DHNLTGLEFACGIPGSVGGALYMNAGAYGGEISYVLTEAVVMTGDGELRTLTKEAFEFGY 175

Query: 180 RSSEITKDLII-THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S    +  I               I A + ++   RE+ QP++  + GS FK P  + 
Sbjct: 176 RKSVFANNHYIILEARFELEEGVYEEIKAKMDDLTFKRESKQPLEYPSCGSVFKRPPNNF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI++SG +G   GG ++S  H  FM+N DN T  D   L   V+K V  + G+ LE 
Sbjct: 236 AGKLIQESGLQGKRIGGVEVSLKHAGFMVNVDNGTAQDYIDLIHFVQKTVEEKFGVKLER 295

Query: 299 EIKRLGDFFD 308
           E++ +G+  +
Sbjct: 296 EVRIIGEDKE 305


>gi|114330271|ref|YP_746493.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrosomonas
           eutropha C91]
 gi|122314678|sp|Q0AJE3|MURB_NITEC RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|114307285|gb|ABI58528.1| UDP-N-acetylmuramate dehydrogenase [Nitrosomonas eutropha C91]
          Length = 332

 Score =  215 bits (546), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 103/305 (33%), Positives = 151/305 (49%), Gaps = 10/305 (3%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRG+ +++ P+KQ   +R GG+A   +QP D+ DL  FL   P D P+ ++GLGSN LVR
Sbjct: 28  LRGELRQHEPMKQHVSWRAGGHAAYFYQPADLEDLAVFLHFWPKDEPVMMIGLGSNFLVR 87

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNH---CEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           D G+ GV++ L       + V        +  GA      LA  A  H + G  F  GIP
Sbjct: 88  DGGLPGVMIALHAKLNDLLLVEQEEDGGLIYAGAGVPCAKLARFASLHNLAGAEFLAGIP 147

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK------- 186
           G++GGA  MNAG    ET + V  V  IDR G  H    E  +  YR  E+ +       
Sbjct: 148 GTVGGALAMNAGCYGSETWERVERVKTIDRDGTLHERTPEDYRIGYRQVELHEVVPPDTS 207

Query: 187 DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKS 246
                    R  P  Q     A+  +   R   QP+   + GS F+NP G  A +L+E+ 
Sbjct: 208 CSWFVGGWFRLRPGQQESSRQAVKALLGTRIKTQPLGFPSAGSVFRNPPGDYAARLVEQC 267

Query: 247 GCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           G +G   G A IS LH NF+IN  +AT  ++E +   V+  V+ ++ I L  E++ +G  
Sbjct: 268 GLKGFRIGDAMISTLHANFIINCGHATATEIETVINTVQDIVYKKTEIRLVTEVRIIGQH 327

Query: 307 FDHQI 311
             +++
Sbjct: 328 KGNEL 332


>gi|229087578|ref|ZP_04219708.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           Rock3-44]
 gi|228695694|gb|EEL48549.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           Rock3-44]
          Length = 305

 Score =  215 bits (546), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 86/310 (27%), Positives = 149/310 (48%), Gaps = 7/310 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    + + L E   +     +++  LK+ T  + GG A+V   P    +++  +     
Sbjct: 1   MNMQEVYKHLNEILPE--EHVKQDEMLKKHTHIKVGGKADVFVAPTTYDEIQKVVKYANE 58

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +IP+T +G GSN++++D GIRG+ + L +     +   +          +   ++  AL
Sbjct: 59  HNIPVTFLGNGSNVIIKDGGIRGITVSLIHITDVTVTGTSIVAQC---GAAIIDVSRIAL 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            H + G  F  GIPGS+GGA YMNAGA   E +  + E   +   G    + ++  ++ Y
Sbjct: 116 DHCLTGLEFACGIPGSVGGALYMNAGAYGGEVAYVLTEAIVMTGDGELRTLTKDDFEFGY 175

Query: 180 RSSEITKDLII-THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S    +  I            +  I   + ++   RE+ QP++  + GS FK P  + 
Sbjct: 176 RKSTFANNHYIILEAKFELAEGVREEIKEKMDDLTFKRESKQPLEYPSCGSVFKRPPNNF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI++SG +G   GG ++S  H  FM+N DN T  D   L   V+K V  + G+ LE 
Sbjct: 236 AGKLIQESGLQGKRIGGVEVSVKHAGFMVNVDNGTAQDYIDLIHFVQKTVEEKFGVKLER 295

Query: 299 EIKRLGDFFD 308
           E++ +G+  +
Sbjct: 296 EVRIIGEDLE 305


>gi|168212740|ref|ZP_02638365.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens CPE str. F4969]
 gi|170715845|gb|EDT28027.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           perfringens CPE str. F4969]
          Length = 304

 Score =  215 bits (546), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 94/304 (30%), Positives = 148/304 (48%), Gaps = 7/304 (2%)

Query: 3   YGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-D 61
           Y    +LL E   +       + P+ +  +FR GG A+++  P +   +   L L    +
Sbjct: 4   YMEFYKLLGEFYNE--EDITVDSPMSEHIYFRVGGPADILATPVNEEQVVNTLKLCREYN 61

Query: 62  IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRH 121
           +P  I+G GSNILV+D GI      +      N        +   +    K ++ +AL +
Sbjct: 62  VPYFILGNGSNILVKDGGI---SGVVIKFNKLNKITTEGNCVTAQSGALLKDVSKAALEN 118

Query: 122 GIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS 181
            + GF F  GIPGSIGGA +MNAGA + E +  +     ID   N   + +E+L+  YRS
Sbjct: 119 NLRGFEFACGIPGSIGGAVFMNAGAYDGEMAHVIKSARVIDENCNIKNLTKEELELGYRS 178

Query: 182 SEITKDLIITHV-VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
           S + K   +     +         I   I ++ + RE+ QP++  + GSTFK P G+ A 
Sbjct: 179 SIVMKKGYVVIEATVELESGEYASIKDKIDDLTNRRESKQPLEYPSAGSTFKRPEGYFAG 238

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LI+ SG +G   GGA +SE H  F+IN   AT  D+  +   V+K V     + L  E+
Sbjct: 239 KLIQDSGLKGFSIGGAAVSEKHSGFVINKGGATAKDVLDVIAHVQKTVKENFDVELHTEV 298

Query: 301 KRLG 304
           + +G
Sbjct: 299 RIIG 302


>gi|114566546|ref|YP_753700.1| UDP-N-acetylmuramate dehydrogenase [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
 gi|122318390|sp|Q0AY75|MURB_SYNWW RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|114337481|gb|ABI68329.1| UDP-N-acetylmuramate dehydrogenase [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 299

 Score =  215 bits (546), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 95/288 (32%), Positives = 149/288 (51%), Gaps = 4/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDA 78
           + + N P+K+ + F+ GG  ++M  P+ I +++         DIP  + GLGSNILVRD 
Sbjct: 13  RIKINEPMKEHSSFKIGGPVDLMVLPESIEEIQRITHYCRKKDIPCFVFGLGSNILVRDK 72

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIRGV +++ N   +      +  +   A      L+ +A  + + G  F  GIPGS+GG
Sbjct: 73  GIRGVAIKVGNNLKNI--SICNDTIFAEAGVRLAELSQAAADYSLSGLEFAEGIPGSLGG 130

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL-IITHVVLRG 197
           A  MNAGA   E    + EV  I   GN      E++K +YR S   ++  I+   +++ 
Sbjct: 131 AVVMNAGAYGGEMKDVLKEVRAITPDGNLSSFKPEEMKLRYRGSIFQEEELIVVSALMQL 190

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
             E    I A + +    R   QP++  + GSTF+ P G     +IE+ G +G + GGA+
Sbjct: 191 HKERAEDIRARMQDFAKRRREKQPLEYPSAGSTFRRPAGFFVGPMIEEMGLKGFKVGGAE 250

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S  H  F+IN+ NAT  ++  L   V+ K     GI LE E+K +G+
Sbjct: 251 VSRKHAGFIINSGNATANEVLELIAIVKAKAKEHYGIELETEVKVVGE 298


>gi|16803460|ref|NP_464945.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes EGD-e]
 gi|224501638|ref|ZP_03669945.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes FSL R2-561]
 gi|254829821|ref|ZP_05234476.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes 10403S]
 gi|284801806|ref|YP_003413671.1| hypothetical protein LM5578_1561 [Listeria monocytogenes 08-5578]
 gi|284994948|ref|YP_003416716.1| hypothetical protein LM5923_1513 [Listeria monocytogenes 08-5923]
 gi|29336839|sp|Q8Y776|MURB_LISMO RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|16410849|emb|CAC99498.1| lmo1420 [Listeria monocytogenes EGD-e]
 gi|284057368|gb|ADB68309.1| hypothetical protein LM5578_1561 [Listeria monocytogenes 08-5578]
 gi|284060415|gb|ADB71354.1| hypothetical protein LM5923_1513 [Listeria monocytogenes 08-5923]
          Length = 298

 Score =  215 bits (546), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 99/287 (34%), Positives = 151/287 (52%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAG 79
            + N PL + T+ +TGG A+V   P+ I + +  +     + IP+TI+G GSN++++D G
Sbjct: 13  IKLNEPLSKYTYTKTGGAADVFVMPKTIEEAQEVVAYCHQNKIPLTILGNGSNLIIKDGG 72

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRGV+L L          RN+ +++  +       A  AL   + G  F  GIPGSIGGA
Sbjct: 73  IRGVILHLDLLQTI---ERNNTQIVAMSGAKLIDTAKFALNESLSGLEFACGIPGSIGGA 129

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLRGF 198
            +MNAGA   E S  +     + + G    + R +LK  YR S I  K+ I+        
Sbjct: 130 LHMNAGAYGGEISDVLEAATVLTQTGELKKLKRSELKAAYRFSTIAEKNYIVLDATFSLA 189

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
            E +N+I A +  +   RE  QP++  + GS FK P GH A +LI+ SG +G   GGA++
Sbjct: 190 LEEKNLIQAKMDELTAAREAKQPLEYPSCGSVFKRPPGHFAGKLIQDSGLQGHIIGGAQV 249

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           S  H  F++N   AT  D   L   V++ V  +  + LE E+K +G+
Sbjct: 250 SLKHAGFIVNIGGATATDYMNLIAYVQQTVREKFDVELETEVKIIGE 296


>gi|34580725|ref|ZP_00142205.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia sibirica
           246]
 gi|28262110|gb|EAA25614.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia sibirica
           246]
          Length = 295

 Score =  215 bits (546), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 129/292 (44%), Positives = 180/292 (61%), Gaps = 2/292 (0%)

Query: 13  RGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSN 72
               ++G++++++ LK +TWF+ GGNAE+ F+P D  DLK FL      +PI   G GSN
Sbjct: 3   ILPIVKGEYKKDYNLKHLTWFKVGGNAEIFFKPLDSEDLKSFLIQNKQKLPIKTFGAGSN 62

Query: 73  ILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGI 132
           +++RD GI GVV++L     +   +     +IVG+ C   +LA     + I GF F  GI
Sbjct: 63  VIIRDGGIEGVVIKLGQNFSNIEFID--NHLIVGSSCLNYNLAKFCQANAISGFEFLVGI 120

Query: 133 PGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITH 192
           PG+IGG   MNAGA   E    VV++  ID  GN      E++ ++YRS+++ K+LII  
Sbjct: 121 PGTIGGGVAMNAGAYGSEFKDIVVQIEAIDFAGNFLTFTNEEIGFKYRSNDLPKNLIILK 180

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
           VV +        I   +  + + R + QPIKE+TGGSTF NP G  +W+LI+K+G RG  
Sbjct: 181 VVFKINKGDSENILLRMNEINNARSSTQPIKERTGGSTFANPEGRKSWELIDKAGLRGYR 240

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            GGA +SELHCNFMIN  +AT  DLE LG+ VR+KV   SG+ LEWEIKR+G
Sbjct: 241 IGGASMSELHCNFMINNGDATAKDLEDLGDFVRQKVCEDSGVKLEWEIKRIG 292


>gi|52140460|ref|YP_086369.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           E33L]
 gi|228936351|ref|ZP_04099149.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|81685532|sp|Q631P8|MURB2_BACCZ RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase 2;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase 2
 gi|51973929|gb|AAU15479.1| UDP-N-acetylmuramate dehydrogenase
           (UDP-N-acetylenolpyruvoylglucosamine reductase)
           [Bacillus cereus E33L]
 gi|228823183|gb|EEM69017.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis serovar andalousiensis BGSC 4AW1]
          Length = 305

 Score =  215 bits (546), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 89/310 (28%), Positives = 146/310 (47%), Gaps = 7/310 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    +   L     +  G  +++  LK  T  + GG A+V   P +  +++  +     
Sbjct: 1   MNMQEVYEYLSTVLPE--GHVKQDEMLKNHTHIKVGGKADVFVAPTNYDEIQEVIKYANK 58

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +IP+T +G GSN++++D GIRG+ + L               ++     +   ++  AL
Sbjct: 59  YNIPVTFLGNGSNVIIKDGGIRGITVSLI---HITGVTVTGTTIVAQCGAAIIDVSRIAL 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            H + G  F  GIPGS+GGA YMNAGA   E S  + E   +   G    + +E  ++ Y
Sbjct: 116 DHNLTGLEFACGIPGSVGGALYMNAGAYGGEISFVLTEAVVMTGDGELRTLTKEAFEFGY 175

Query: 180 RSSEITKDLII-THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S    +  I               I A + ++   RE+ QP++  + GS FK P  + 
Sbjct: 176 RKSVFANNHYIILEARFELEEGVHEEIKAKMDDLTFKRESKQPLEYPSCGSVFKRPPNNF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI+ SG +G   GG ++S  H  FM+N DN T  D   L   V+K V  + G+ LE 
Sbjct: 236 AGKLIQDSGLQGKRIGGVEVSLKHAGFMVNVDNGTAQDYIDLIHFVQKTVEEKFGVKLER 295

Query: 299 EIKRLGDFFD 308
           E++ +G+  +
Sbjct: 296 EVRIIGEDKE 305


>gi|313623798|gb|EFR93929.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria innocua FSL
           J1-023]
          Length = 298

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 101/287 (35%), Positives = 150/287 (52%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAG 79
            + N PL + T+ +TGGNA+V   P+ I + K  +T      +P+TI+G GSN++++D G
Sbjct: 13  IKLNEPLSKYTYTKTGGNADVFVMPKTIEETKEIVTYCHQSKLPLTILGNGSNLIIKDGG 72

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRGV++ L          R + ++I  +       A  AL   + G  F  GIPGSIGGA
Sbjct: 73  IRGVIVHLDLLQSI---ERKNTQIIAMSGAKLIDTAKFALDESLSGLEFACGIPGSIGGA 129

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLRGF 198
            +MNAGA   E S  +     + + G    + R +LK  YR S I  K  I+        
Sbjct: 130 LHMNAGAYGGEISDVLEAATVLTQSGELKKLKRSELKAAYRFSTIAEKKYIVLDATFSLE 189

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
            E +NII A +  +   RE  QP++  + GS FK P GH A +LI+ SG +G   GGA++
Sbjct: 190 LEDKNIIQAKMDELTALREAKQPLEYPSCGSVFKRPPGHFAGKLIQDSGLQGHIIGGAQV 249

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           S  H  F++N   AT  D   L   V++ V  +  + LE E+K +G+
Sbjct: 250 SLKHAGFIVNIGGATATDYMNLIAHVQQTVREKFDVELETEVKIIGE 296


>gi|229032712|ref|ZP_04188673.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           AH1271]
 gi|228728607|gb|EEL79622.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           AH1271]
          Length = 305

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 89/310 (28%), Positives = 148/310 (47%), Gaps = 7/310 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    +   L     +  G  +++  LK  T  + GG A+V   P +  +++  +     
Sbjct: 1   MNMQEVYEYLSTVLPE--GHVKQDEMLKNHTHIKVGGKADVFVAPTNYDEIQEVIKYANE 58

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +IP+T +G GSN++++D GIRG+ + L               ++     +   ++  AL
Sbjct: 59  YNIPVTFLGNGSNVIIKDGGIRGITVSLI---HITGVTVTGTTIVAQCGAAIIDVSRIAL 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            H + G  F  GIPGS+GGA YMNAGA   E S  + E   +   G    + +E  ++ Y
Sbjct: 116 DHNLTGLEFACGIPGSVGGALYMNAGAYGGEVSFVLTEAVVMTGDGELRTLTKEAFEFGY 175

Query: 180 RSSEITKDLII-THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S    +  I            +  I A + ++   RE+ QP++  + GS FK P  + 
Sbjct: 176 RKSVFANNHYIILEARFELEEGVREEIKAKMDDLTFKRESKQPLEYPSCGSVFKRPPNNF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI++SG +G   GG ++S  H  FM+N DN T  D   L   V+K V  + G+ LE 
Sbjct: 236 AGKLIQESGLQGKRIGGVEVSLKHAGFMVNVDNGTAQDYIDLIHFVQKTVEEKFGVKLER 295

Query: 299 EIKRLGDFFD 308
           E++ +G+  +
Sbjct: 296 EVRIIGEDKE 305


>gi|171777628|ref|ZP_02919293.1| hypothetical protein STRINF_00128 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171283156|gb|EDT48580.1| hypothetical protein STRINF_00128 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 300

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 97/303 (32%), Positives = 150/303 (49%), Gaps = 6/303 (1%)

Query: 9   LLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITI 66
           +L     +L+G   + N PLK+ T+ + GG A+ +  P++ ++L   +     +DIP  +
Sbjct: 1   MLEFLNDELKGIDIRVNEPLKKYTYTKVGGPADYLAFPRNRYELIRIVEFANKNDIPWMV 60

Query: 67  VGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGF 126
           +G  SNI+VRD GIRG V+         +   N   +   +  +       A  H + GF
Sbjct: 61  LGNASNIIVRDGGIRGFVIMFDKLNTVTV---NGYVIEAESGANLVETTRIAKYHSLTGF 117

Query: 127 HFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK 186
            F  GIPGS+GGA +MNAGA   E S  +V    + ++G    I    +K+ YR S +  
Sbjct: 118 EFACGIPGSVGGAVFMNAGAYGGEISHVLVSAQVLTKEGKVKTIEARDMKFGYRHSAVQD 177

Query: 187 -DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEK 245
              I+        P    +I   +A + H RE  QP++  + GS FK P GH A QLI +
Sbjct: 178 SGDIVISAKFALKPGDYVLIEQEMARLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLITE 237

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +  +G   GG ++S+ H  FM+N  + T  D E L   V   V   SG+ LE E++ +G+
Sbjct: 238 ANLKGHRIGGVEVSKKHAGFMVNVADGTAQDYEDLIAYVIDTVEKNSGVRLEREVRIIGE 297

Query: 306 FFD 308
             D
Sbjct: 298 KKD 300


>gi|293376449|ref|ZP_06622679.1| UDP-N-acetylmuramate dehydrogenase [Turicibacter sanguinis PC909]
 gi|292644926|gb|EFF63006.1| UDP-N-acetylmuramate dehydrogenase [Turicibacter sanguinis PC909]
          Length = 302

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 99/301 (32%), Positives = 151/301 (50%), Gaps = 9/301 (2%)

Query: 9   LLRERGKQLRGK----FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIP 63
           + +   ++ +GK      EN PL + T FR GG A  +  P     L   + L+   ++P
Sbjct: 1   MFKSFIEEYKGKNIGLLLENEPLSKHTTFRVGGPARCLVIPNSKQSLVETMKLINKYELP 60

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
             ++G GSN+L  D    G++++               ++ VGA  S   LAN   +  +
Sbjct: 61  FKVIGRGSNLLPSDRLFEGIIVKCDKGLDHVEID--GTQVTVGAGVSTILLANKVAKCEL 118

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            G  F  G+PGS+GGA YMNAGA N E    +V+   +D  G    +  E++ + YR S 
Sbjct: 119 AGLEFISGVPGSVGGAIYMNAGAYNREIQDVLVKALILDEAGELKWLTVEEMGFSYRQSI 178

Query: 184 I--TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
           +   ++ I+   VL+    S   I   +      R   QP    + GSTF+NP  H +WQ
Sbjct: 179 LQTHRNWIVVEAVLQLEKGSYEEIMELMKARKVRRIESQPTNLPSAGSTFRNPLPHYSWQ 238

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           LIEKSG RG+  GGA++S+ HCNF++N   AT  D+  L + V+  VF + GI L  E++
Sbjct: 239 LIEKSGLRGVRIGGAEVSQKHCNFIVNVGGATATDIYELIQHVQAVVFEKHGIQLHPEVE 298

Query: 302 R 302
            
Sbjct: 299 M 299


>gi|229075666|ref|ZP_04208648.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           Rock4-18]
 gi|229117406|ref|ZP_04246782.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           Rock1-3]
 gi|228666016|gb|EEL21482.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           Rock1-3]
 gi|228707442|gb|EEL59633.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           Rock4-18]
          Length = 301

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 88/302 (29%), Positives = 148/302 (49%), Gaps = 5/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           + +L+ E  +   G+   N PL + T  + GG A+++  P+ +  ++  L L+    I  
Sbjct: 1   MEQLVNELIEANVGRVLVNEPLARYTTMKIGGPADILIVPKHVAGIEKILQLVKKYKIKW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T++G GSN+LV D GI GVV+RL          ++     VG       L+    R G+ 
Sbjct: 61  TVIGRGSNLLVSDKGIEGVVIRLGEGLDHLEVEKHRVR--VGGGYPLIKLSTLLSRQGLA 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA+  + S  + +   +   G    +    +++ YR+S +
Sbjct: 119 GLEFASGIPGSVGGAVYMNAGAHKSDISNILSKALILFENGTIEWLTNRGMEFSYRTSVL 178

Query: 185 TKDLI--ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
                  +     +     +  I   +     +R   QP      GS F+NP  + A  L
Sbjct: 179 QTKRPGIVLEAEFQLQVGEREKIVRNMQKNKDYRRETQPWNHPCAGSVFRNPIPYFAGDL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           +EK+G RG + GGA+ISE+H NF+IN   A+  D+  L   ++  + ++ G+ +  E++ 
Sbjct: 239 VEKAGLRGYQIGGAQISEMHGNFIINTGGASAQDVLDLISLIKHTIKDKFGVEMHTEVEI 298

Query: 303 LG 304
           +G
Sbjct: 299 IG 300


>gi|229104472|ref|ZP_04235139.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           Rock3-28]
 gi|228678914|gb|EEL33124.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           Rock3-28]
          Length = 301

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 88/302 (29%), Positives = 148/302 (49%), Gaps = 5/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           + +L+ E  +   G+   N PL + T  + GG A+++  P+ +  ++  L L+    I  
Sbjct: 1   MEQLVNELIEANVGRVLVNEPLARYTTMKIGGPADILIVPKHVAGIEKILQLVKKYKIKW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T++G GSN+LV D GI GVV+RL          ++     VG       L+    R G+ 
Sbjct: 61  TVIGRGSNLLVSDKGIEGVVIRLGEGLDHLEVEKHRVR--VGGGYPLIKLSTLLSRQGLA 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA+  + S  + +   +   G    +    +++ YR+S +
Sbjct: 119 GLEFASGIPGSVGGAVYMNAGAHKSDISNILSKALILFENGTIEWLTNRGMEFSYRTSVL 178

Query: 185 TKDLI--ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
                  +     +     +  I   +     +R   QP      GS F+NP  + A  L
Sbjct: 179 QTKRPGIVLEAEFQLQVGEREEIVRNMQKNKDYRRETQPWNHPCAGSVFRNPIPYFAGDL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           +EK+G RG + GGA+ISE+H NF+IN   A+  D+  L   ++  + ++ G+ +  E++ 
Sbjct: 239 VEKAGLRGYQIGGAQISEMHGNFIINTGGASAQDVLDLISLIKHTIKDKFGVEMHTEVEI 298

Query: 303 LG 304
           +G
Sbjct: 299 IG 300


>gi|319899155|ref|YP_004159248.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella
           clarridgeiae 73]
 gi|319403119|emb|CBI76677.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella
           clarridgeiae 73]
          Length = 325

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 154/307 (50%), Positives = 210/307 (68%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPIT 65
           + + L+     ++GK   N  ++++TWFRTGG AE+ +QP D  DL  F   LP  IP+T
Sbjct: 12  LLKKLQPALCGIQGKLTPNVDMRKVTWFRTGGLAEIFYQPSDEADLVLFFQSLPESIPVT 71

Query: 66  IVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGG 125
           IVG+GSN+LVRD GI GVV+RLS  GF  ++  +    +VGA  +GK LA +AL   + G
Sbjct: 72  IVGIGSNLLVRDGGIPGVVIRLSAKGFGQLKQVSSKRFLVGAAVAGKHLAAAALEAELSG 131

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT 185
           FHF++GIPG  GGA  MNAGAN  ET++ V+EV+ +DRKG +H++    + Y YR  +I 
Sbjct: 132 FHFYHGIPGGCGGALKMNAGANGVETAERVIEVYALDRKGQRHILSVNDIHYSYRCCDIP 191

Query: 186 KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEK 245
            D +    +  G   ++N I AA+  V  HR+ VQPI+EKTGGSTF+NP G SAW++I++
Sbjct: 192 DDFVFIAALFEGERGNRNYIRAAMDEVALHRQMVQPIREKTGGSTFRNPVGTSAWRVIDE 251

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +GCRGL+ GGA++S++HCNFMIN   ATGYDLE LGE VR +VF  SG LL+WEI+R+G 
Sbjct: 252 AGCRGLKIGGAQMSKMHCNFMINTGQATGYDLEKLGEVVRARVFAHSGHLLQWEIQRIGQ 311

Query: 306 FFDHQIV 312
           F    IV
Sbjct: 312 FEQGCIV 318


>gi|253576132|ref|ZP_04853464.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Paenibacillus sp.
           oral taxon 786 str. D14]
 gi|251844475|gb|EES72491.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Paenibacillus sp.
           oral taxon 786 str. D14]
          Length = 301

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 97/288 (33%), Positives = 146/288 (50%), Gaps = 4/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDA 78
           +   N P+ + T ++ GG A+ M  PQ    L   + LL    IP  ++G GSN+LV D 
Sbjct: 15  EVLPNEPMSKYTTWKIGGPADAMAVPQTTRQLAELMRLLHAEGIPWMMIGKGSNLLVSDK 74

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIRG V+RL       +      E+  G   S   L+  A + G+ G  F  GIPG++GG
Sbjct: 75  GIRGCVIRLGGEFEQIVFD--GTEVSAGGGASTVRLSIMAGKEGLTGLEFAGGIPGTVGG 132

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIIT-HVVLRG 197
           A YMNAGA+  + S+       +   G       E +K+ YR S + +   I        
Sbjct: 133 AVYMNAGAHGSDVSRIFKSADIVLETGELVTYTAEDMKFAYRHSVLHEQRGIVAQARFSL 192

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
               +  ++AA+A     R   QP+ +   GS F+NP G  A +LIE +G +G++ GGA+
Sbjct: 193 AAGDRLEVAAAMAAYKDRRRKTQPLSQPCAGSVFRNPPGDHAARLIEAAGLKGMKVGGAE 252

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S LH NF++N   AT  D+  L EQV+  V +Q G+ L  E+  +G+
Sbjct: 253 VSTLHANFIVNTGQATAEDVLALMEQVKAAVQDQFGVALVPEVFFVGE 300


>gi|157828211|ref|YP_001494453.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165932914|ref|YP_001649703.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia
           rickettsii str. Iowa]
 gi|166222850|sp|A8GRC0|MURB_RICRS RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|189028926|sp|B0BWS1|MURB_RICRO RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|157800692|gb|ABV75945.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165908001|gb|ABY72297.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia
           rickettsii str. Iowa]
          Length = 295

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 128/292 (43%), Positives = 178/292 (60%), Gaps = 2/292 (0%)

Query: 13  RGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSN 72
               ++G++++++ LK +TWF+ GGNAE+ F+P D  DLK FL      +PI   G GSN
Sbjct: 3   ILPIVKGEYKKDYNLKHLTWFKVGGNAEIFFKPLDSEDLKSFLIQNKQKLPIKTFGAGSN 62

Query: 73  ILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGI 132
           I++RD GI GVV++L     +   +     +IVG+ C   +LA     + I GF F  GI
Sbjct: 63  IIIRDGGIEGVVIKLGQNFSNIEFID--NHLIVGSSCLNYNLAKFCQANAISGFEFLVGI 120

Query: 133 PGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITH 192
           PG+IGG   MNAGA   E    VV++  ID  GN      E++ ++YRS+ + K+LII  
Sbjct: 121 PGTIGGGVAMNAGAYGSEFKDIVVQIEAIDFAGNFLTFTNEEIGFKYRSNNLPKNLIILK 180

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
           V+ +        I   +  + + R + QPIKE+TGGSTF NP G  +W+LI+K+G RG  
Sbjct: 181 VIFKINKGDSENILLRMNEINNARSSTQPIKERTGGSTFANPEGCKSWELIDKAGLRGYR 240

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            GGA +SELHCNFMIN  +AT  DLE LG  V++KV   SG+ LEWEIKR+G
Sbjct: 241 IGGASMSELHCNFMINNGDATAKDLEDLGNFVQQKVCEDSGVKLEWEIKRIG 292


>gi|46907648|ref|YP_014037.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes serotype 4b str. F2365]
 gi|47092710|ref|ZP_00230496.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes str. 4b H7858]
 gi|226224021|ref|YP_002758128.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes Clip81459]
 gi|254824520|ref|ZP_05229521.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes FSL J1-194]
 gi|254852536|ref|ZP_05241884.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes FSL R2-503]
 gi|254932605|ref|ZP_05265964.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes HPB2262]
 gi|255521341|ref|ZP_05388578.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes FSL J1-175]
 gi|300765773|ref|ZP_07075749.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes FSL N1-017]
 gi|67460880|sp|Q71ZQ0|MURB_LISMF RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|259509759|sp|C1L2X6|MURB_LISMC RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|46880916|gb|AAT04214.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes serotype 4b str. F2365]
 gi|47018898|gb|EAL09645.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes str. 4b H7858]
 gi|225876483|emb|CAS05192.1| Putative UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes serotype 4b str. CLIP 80459]
 gi|258605845|gb|EEW18453.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes FSL R2-503]
 gi|293584164|gb|EFF96196.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes HPB2262]
 gi|293593759|gb|EFG01520.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes FSL J1-194]
 gi|300513548|gb|EFK40619.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes FSL N1-017]
 gi|332311861|gb|EGJ24956.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes str. Scott A]
          Length = 298

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 100/287 (34%), Positives = 151/287 (52%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAG 79
            + N PL + T+ +TGG A+V   P+ I + +  +     + IP+TI+G GSN++++D G
Sbjct: 13  IKLNEPLSKYTYTKTGGAADVFVMPKTIEETQEVVAYCHQNKIPLTILGNGSNLIIKDGG 72

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRGV+L L          RN+ ++I  +       A  AL   + G  F  GIPGSIGGA
Sbjct: 73  IRGVILHLDLLQTI---ERNNTQIIAMSGAKLIDTAKFALDESLSGLEFACGIPGSIGGA 129

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLRGF 198
            +MNAGA   E S  +     + + G    + R +LK  YR S I  K+ I+        
Sbjct: 130 LHMNAGAYGGEISDVLEAATVLTQTGELKKLKRSELKAAYRFSTIAEKNYIVLDATFSLA 189

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
            E +N+I A +  +   RE  QP++  + GS FK P GH A +LI+ SG +G   GGA++
Sbjct: 190 LEEKNLIQAKMDELTAAREAKQPLEYPSCGSVFKRPPGHFAGKLIQDSGLQGHIIGGAQV 249

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           S  H  F++N   AT  D   L   V++ V  +  + LE E+K +G+
Sbjct: 250 SLKHAGFIVNIGGATATDYMNLIAYVQQTVREKFDVELETEVKIIGE 296


>gi|302877581|ref|YP_003846145.1| D-alanine/D-alanine ligase [Gallionella capsiferriformans ES-2]
 gi|302580370|gb|ADL54381.1| D-alanine/D-alanine ligase [Gallionella capsiferriformans ES-2]
          Length = 631

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 106/293 (36%), Positives = 154/293 (52%), Gaps = 5/293 (1%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           LRGK   +  +++ T +R GG A+ ++QP D+ DL+ +L  LP D P+  VGLGSN+LVR
Sbjct: 14  LRGKLSLDQSMRRHTSWRVGGAADRVYQPADLDDLRVYLCSLPLDEPLVAVGLGSNLLVR 73

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+RG VL +  A    + ++    + V A   G  LA  A  H + G  F  GIPG++
Sbjct: 74  DGGVRGTVLLMHGALTE-LAMQQDGLIYVQAGVPGAKLARFAANHDLAGAEFCAGIPGTL 132

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD----LIITH 192
           GG   MNAG    E  Q+VV V  + R G        + +  YRS    +D         
Sbjct: 133 GGMLAMNAGCYGSEIWQHVVRVQVVTRSGELIERASSEYQIAYRSVTKKQDGASDEFFVG 192

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
             L        +    I  +   R + QP+     GS F+NP    A +LIE+ G +G +
Sbjct: 193 AWLSFVQGDGQVARQNIKELLAKRISSQPLNLPNAGSVFRNPANDYAARLIEQCGLKGKK 252

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            GGA++SE H NF++N DNAT  ++E L  QVR+ V  Q+G+ L  E+K +G+
Sbjct: 253 IGGAQVSEKHANFIVNVDNATADEIENLICQVRQTVMTQTGVDLHPEVKIIGE 305


>gi|229164040|ref|ZP_04291977.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           R309803]
 gi|228619423|gb|EEK76312.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           R309803]
          Length = 305

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 87/310 (28%), Positives = 149/310 (48%), Gaps = 7/310 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    + + L     +  G  +++  LK  T  + GG A+V   P +  +++  +     
Sbjct: 1   MNMQEVYKYLSTVLPE--GHVKQDEMLKNHTHIKVGGKADVFVAPTNYDEIQEVIKYANE 58

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +IP+T +G GSN++++D GIRG+ + L               ++     +   ++  AL
Sbjct: 59  YNIPVTFLGNGSNVIIKDGGIRGITVSLI---HITGVTVTGTTIVAQCGAAIIDVSRIAL 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            H + G  F  GIPGS+GGA YMNAGA   E S  + E   +   G+   + +++  + Y
Sbjct: 116 DHNLTGLEFACGIPGSVGGALYMNAGAYGGEVSFVLTEAVVMTGDGDLRTLTKDEFAFGY 175

Query: 180 RSSEITKDLII-THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S    +  I            +  I   + ++   RE+ QP++  + GS FK P  + 
Sbjct: 176 RKSVFANNHYIILEAKFELEEGVREEIKEKMDDLTFKRESKQPLEYPSCGSVFKRPPNNF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI++SG +G   GG ++S  H  FM+N DN T  D   L   V+K V  + G+ LE 
Sbjct: 236 AGKLIQESGLQGKRIGGVEVSLKHAGFMVNVDNGTAQDYIDLIHFVQKAVEEKFGVKLER 295

Query: 299 EIKRLGDFFD 308
           E++ +G+  +
Sbjct: 296 EVRIIGEDKE 305


>gi|308173488|ref|YP_003920193.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           amyloliquefaciens DSM 7]
 gi|307606352|emb|CBI42723.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           amyloliquefaciens DSM 7]
 gi|328553582|gb|AEB24074.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           amyloliquefaciens TA208]
 gi|328911624|gb|AEB63220.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           amyloliquefaciens LL3]
          Length = 303

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 92/303 (30%), Positives = 157/303 (51%), Gaps = 7/303 (2%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           +  +++E   +  GK  E  PL   T  + GG A+++  P  +  +K  + ++   D+P 
Sbjct: 1   MENVIQELRDREVGKVLEQEPLANHTTMKIGGPADILIIPNRVEAVKDIMNIVKKYDLPW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRL-SNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           T++G GSN+LV D GIRGVV++L +      I+          +     +  +   + G+
Sbjct: 61  TVIGRGSNLLVLDEGIRGVVIKLGAGLDHLEIDGDQVTVGGGYSVVRLATSMS---KKGM 117

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            G  F  GIPGSIGGA YMNAGA+  + S+ +V+   +   G    +  +++ + YR+S 
Sbjct: 118 SGLEFAAGIPGSIGGAVYMNAGAHGSDMSEILVKARILFEDGTIEWLTNDEMDFSYRTSV 177

Query: 184 ITKDLIITHVVLRGF--PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
           + K      +        + +  I+A +     +R+  QP      GS F+NP  + A  
Sbjct: 178 LQKKRPGVCLEAVLKLEQKEREAITAQMQQNKDYRKNTQPYSSPCAGSIFRNPLPNHAGN 237

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           L+EK+G +G + GGAK+SE+H NF++NA  AT  D+  L E V+K +  Q  + +  E++
Sbjct: 238 LVEKAGLKGHQIGGAKVSEMHGNFIVNAGGATAKDVLDLIEYVKKTIREQYDVEMHTEVE 297

Query: 302 RLG 304
            +G
Sbjct: 298 IIG 300


>gi|42784258|ref|NP_981505.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus ATCC
           10987]
 gi|81408560|sp|Q72Y09|MURB2_BACC1 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase 2;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase 2
 gi|42740189|gb|AAS44113.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus ATCC
           10987]
          Length = 305

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 89/310 (28%), Positives = 147/310 (47%), Gaps = 7/310 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    +   L     +  G  +++  LK  T  + GG A+V   P +  +++  +     
Sbjct: 1   MNMQEVYEYLSTVLPE--GHVKQDEMLKNHTHIKVGGKADVFVAPTNYDEIQEVIKYANK 58

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +IP+T +G GSN++++D GIRG+ + L               ++     +   ++  AL
Sbjct: 59  YNIPVTFLGNGSNVIIKDGGIRGITVSLI---HITGVTVTGTTIVAQCGAAIIDVSRIAL 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            H + G  F  GIPGS+GGA YMNAGA   E S  + E   +   G    + +E  ++ Y
Sbjct: 116 EHNLTGLEFACGIPGSVGGALYMNAGAYGGEISYVLTEAVVMTGDGELRTLTKEAFEFGY 175

Query: 180 RSSEITKDLII-THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S    +  I               I A + ++   RE+ QP++  + GS FK P  + 
Sbjct: 176 RKSVFANNHYIILEARFELEEGVYEEIKAKMDDLTFKRESKQPLEYPSCGSVFKRPPNNF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI++SG +G   GG ++S  H  FM+N DN T  D   L   V+K V  + G+ LE 
Sbjct: 236 AGKLIQESGLQGKRIGGVEVSLKHAGFMVNVDNGTAQDYIDLIHFVQKTVEEKFGVKLER 295

Query: 299 EIKRLGDFFD 308
           E++ +G+  +
Sbjct: 296 EVRIIGEDKE 305


>gi|319649662|ref|ZP_08003818.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus sp.
           2_A_57_CT2]
 gi|317398824|gb|EFV79506.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus sp.
           2_A_57_CT2]
          Length = 302

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 99/302 (32%), Positives = 158/302 (52%), Gaps = 9/302 (2%)

Query: 10  LRERGKQLR----GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           + E   +LR    G  +EN P+   T  + GG A++  +P  I +L   + L+ S ++  
Sbjct: 1   MDEFISKLRELNIGTVKENEPMANHTTMKIGGPADLFIEPSSIENLAKAMELIQSYEMKW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
             +G GSN+LV D GI GVV++L           N  E+  G   S  +L+    + G+ 
Sbjct: 61  RAIGRGSNLLVSDGGIEGVVIKLGRGMDQL--DLNGAELRAGGGYSLVALSTIISKKGLS 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA+  + SQ +   H +   G    +  E++++ YR+S +
Sbjct: 119 GLEFASGIPGSVGGAVYMNAGAHGSDISQILTRAHVLFEDGKMEWLTNEEMEFSYRTSVL 178

Query: 185 TKDLI--ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
            K     +   V R     +  IS+A+     +R+  QP      GS F+NP    A QL
Sbjct: 179 QKKRPGIVLEAVFRLTEGDREKISSAMQKNKDYRKETQPWNYPCAGSIFRNPLPEYAGQL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IEK+G +G   GGA+IS +H NF++NA +A   D+  L + ++  +F+  G+ +E E++ 
Sbjct: 239 IEKAGMKGHSIGGAQISNMHGNFIVNAGDAKAEDVLALIQHIKDTIFDLYGVKMETEVEI 298

Query: 303 LG 304
           +G
Sbjct: 299 IG 300


>gi|229098380|ref|ZP_04229325.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           Rock3-29]
 gi|228684997|gb|EEL38930.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           Rock3-29]
          Length = 301

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 88/302 (29%), Positives = 148/302 (49%), Gaps = 5/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           + +L+ E  +   G+   N PL + T  + GG A+++  P+ +  ++  L L+    I  
Sbjct: 1   MEQLVNELIEANVGRVLVNEPLARYTTMKIGGPADILIVPKHVAGIETILQLVKKYKIKW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T++G GSN+LV D GI GVV+RL          ++     VG       L+    R G+ 
Sbjct: 61  TVIGRGSNLLVSDKGIEGVVIRLGEGLDHLEVEKHRVR--VGGGYPLIKLSTLLSRQGLA 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA+  + S  + +   +   G    +    +++ YR+S +
Sbjct: 119 GLEFASGIPGSVGGAVYMNAGAHKSDISNILSKALILFENGTIEWLTNRGMEFSYRTSVL 178

Query: 185 TKDLI--ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
                  +     +     +  I   +     +R   QP      GS F+NP  + A  L
Sbjct: 179 QTKRPGIVLEAEFQLQVGEREKIVRNMQKNKDYRRETQPWNHPCAGSVFRNPIPYFAGDL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           +EK+G RG + GGA+ISE+H NF+IN   A+  D+  L   ++  + ++ G+ +  E++ 
Sbjct: 239 VEKAGLRGYQIGGAQISEMHGNFIINTGGASAQDVLDLISLIKHTIKDKFGVEMHTEVEI 298

Query: 303 LG 304
           +G
Sbjct: 299 IG 300


>gi|320546889|ref|ZP_08041192.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus equinus ATCC
           9812]
 gi|320448484|gb|EFW89224.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus equinus ATCC
           9812]
          Length = 300

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 98/303 (32%), Positives = 150/303 (49%), Gaps = 6/303 (1%)

Query: 9   LLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITI 66
           +L     +L+G   + N PLK+ T+ + GG A+ +  P++ ++L   +     +DIP  +
Sbjct: 1   MLEFLNDELKGIDIRVNEPLKKYTFTKVGGPADYLAFPRNRYELVRIVEFANKNDIPWMV 60

Query: 67  VGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGF 126
           +G  SNI+VRD GIRG V+         +   N   +   A  +       A  H + GF
Sbjct: 61  LGNASNIIVRDGGIRGFVIMFDKLNTVTV---NGYVIEAEAGANLAETTRIAKYHSLTGF 117

Query: 127 HFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK 186
            F  GIPGS+GGA +MNAGA   E S  +V    + ++G    I    +K+ YR S +  
Sbjct: 118 EFACGIPGSVGGAVFMNAGAYGGEISHVLVSAQVLTKEGKVKTIEARDMKFGYRHSAVQD 177

Query: 187 -DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEK 245
              I+        P    +I   +A + H RE  QP++  + GS FK P GH A QLI +
Sbjct: 178 SGDIVISAKFALKPGDYVLIEQEMARLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLITE 237

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +  +G   GG ++S+ H  FM+N  + T  D E L   V   V   SG+ LE E++ +G+
Sbjct: 238 ANLKGHRIGGVEVSKKHAGFMVNVADGTAQDYEDLIAYVIDTVEKNSGVRLEREVRIIGE 297

Query: 306 FFD 308
             D
Sbjct: 298 KKD 300


>gi|149914531|ref|ZP_01903061.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Roseobacter sp.
           AzwK-3b]
 gi|149811324|gb|EDM71159.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Roseobacter sp.
           AzwK-3b]
          Length = 306

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 109/307 (35%), Positives = 155/307 (50%), Gaps = 15/307 (4%)

Query: 14  GKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNI 73
             + RGK  EN  L  +TW R GG A+ +FQP DI DL  FL  L  D+ +  +G+GSN+
Sbjct: 3   MPETRGKLTENRSLSDLTWLRVGGPADWLFQPADIDDLAGFLAALDRDVSVFPMGVGSNL 62

Query: 74  LVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           +VRD G+R VV+RL        ++      +     +  +              F   IP
Sbjct: 63  IVRDGGLRAVVIRLGRGFN---QIDIDGSRVTAGAAALDAHVARKAAQAGLDLTFLRTIP 119

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHV 193
           GSIGGA  MNAG     T+   V    + R G    +  E L + YR +++    ++   
Sbjct: 120 GSIGGAVRMNAGCYGTYTADRFVSARAVSRDGQIVTLQAEDLNFGYRHTDLPDGWVLVEA 179

Query: 194 VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGH------------SAWQ 241
                      + A +      R+  QP K++T GSTF+NP+GH             AW+
Sbjct: 180 TFEAPSGDPAALQARMDEQLAKRDATQPTKDRTAGSTFRNPSGHSSTGRADDVHDFKAWK 239

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           +I+ +G RG   GGA++SE+H NF++N  NAT  DLE LGE+VRK+VF  SGI L WEI 
Sbjct: 240 VIDDAGMRGARRGGAQMSEMHSNFLVNTGNATAADLEGLGEEVRKRVFQNSGIELHWEIM 299

Query: 302 RLGDFFD 308
           R+G+   
Sbjct: 300 RVGETAP 306


>gi|228988322|ref|ZP_04148415.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
 gi|228771387|gb|EEM19860.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
          Length = 305

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 89/310 (28%), Positives = 147/310 (47%), Gaps = 7/310 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    +   L     +  G  +++  LK  T  + GG A+V   P +  +++  +     
Sbjct: 1   MNMQEVYEYLSTVLPE--GHVKQDEMLKNHTHIKVGGKADVFVAPTNYDEIQEVIKYANE 58

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +IP+T +G GSN++++D GIRG+ + L               ++     +   ++  AL
Sbjct: 59  YNIPVTFLGNGSNVIIKDGGIRGITVSLI---HITGVTVTGTTIVAQCGAAIIDVSRIAL 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            H + G  F  GIPGS+GGA YMNAGA   E S  + E   +   G    + +E  ++ Y
Sbjct: 116 DHNLTGLEFACGIPGSVGGALYMNAGAYGGEISFVLTEAVVMTGDGELRTLTKEAFEFGY 175

Query: 180 RSSEITKDLII-THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S    +  I               I A + ++   RE+ QP++  + GS FK P  + 
Sbjct: 176 RKSVFANNHYIILEARFELEEGVHEEIKAKMDDLTFKRESKQPLEYPSCGSVFKRPPNNF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI++SG +G   GG ++S  H  FM+N DN T  D   L   V+K V  + G+ LE 
Sbjct: 236 AGKLIQESGLQGKRIGGVEVSLKHAGFMVNVDNGTAQDYIDLIHFVQKTVEEKFGVKLER 295

Query: 299 EIKRLGDFFD 308
           E++ +G+  +
Sbjct: 296 EVRIIGEDKE 305


>gi|47779264|gb|AAT38532.1| MurB [Bartonella bacilliformis]
          Length = 325

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 157/317 (49%), Positives = 212/317 (66%), Gaps = 5/317 (1%)

Query: 1   MIYGRI--SRLLRERGK---QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFL 55
           M +  I   +LL         ++GK   N  ++++TWFRTGG AE+ +QP D  DL  F 
Sbjct: 2   MNFQPIDGKKLLAWLQPVLSDIKGKITPNVEMRKVTWFRTGGLAELFYQPADEDDLSLFF 61

Query: 56  TLLPSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLA 115
            +LP  +P+TI G+GSN+LVRD GI GVV+RLS   F  I+  +    +VGA  + K LA
Sbjct: 62  KVLPEFVPVTIGGIGSNLLVRDGGIPGVVIRLSTKSFGQIKQVSSTRFLVGAATADKHLA 121

Query: 116 NSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQL 175
           ++AL   I GFHF++GIPG +GGA  MNAGAN  ET++ VVEV+ +DRKG +H++    +
Sbjct: 122 SAALEAEISGFHFYHGIPGGLGGALKMNAGANGVETAERVVEVYALDRKGERHILNLRDM 181

Query: 176 KYQYRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPT 235
            Y YR   I + L+ T  +L G   +++ I AA+  V  HRETVQPI+EKTGGSTF+N  
Sbjct: 182 NYAYRHCNIPEGLVFTAALLEGDVGNKDDIRAAMHEVALHRETVQPIREKTGGSTFRNLE 241

Query: 236 GHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGIL 295
             SAW++I+++GCRGL+ GGA++SE+HCNFMIN   ATGYDLE LGE  R +VFN S   
Sbjct: 242 DISAWKVIDEAGCRGLQIGGAQMSEMHCNFMINMGEATGYDLEKLGETGRARVFNHSAHH 301

Query: 296 LEWEIKRLGDFFDHQIV 312
           LEWEI+R+G F   +IV
Sbjct: 302 LEWEIQRIGQFEQDRIV 318


>gi|114321340|ref|YP_743023.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|122311124|sp|Q0A6K4|MURB_ALHEH RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|114227734|gb|ABI57533.1| UDP-N-acetylmuramate dehydrogenase [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 298

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 102/287 (35%), Positives = 145/287 (50%), Gaps = 2/287 (0%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDA 78
           G+ +   P+ + T +R GG AE +++P  + DL  FL  LP D P+   GLGSN+LVR+ 
Sbjct: 11  GELRHWEPMARYTSWRAGGPAERLYRPAGLADLVAFLRRLPEDEPLFWCGLGSNLLVREG 70

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           G+R     +   G  +       ++   A  +   L+   +R G+ G  FF GIPG++GG
Sbjct: 71  GLR--GTVILTQGGLDALRVEGEQVHAEAGVACGRLSRYCIRQGLAGAEFFAGIPGTLGG 128

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGF 198
           A  MNAGA   ET   V  V  +DR G       E  +  YR             VL   
Sbjct: 129 ALAMNAGAFGGETWSRVRRVETVDRHGVLRRRGPEDFRVGYRHVSGPAGEWFVAAVLDLE 188

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P     + A +  +   R   QPI E + GS F+NP G  A +LIE +G +GL  G A++
Sbjct: 189 PGDAQAMQARVKALLSQRNRTQPIGEPSCGSVFRNPPGDHAARLIEAAGLKGLRRGAAQV 248

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H NF+IN   AT  D+E L EQVR +V  + G+ L  E+  +G+
Sbjct: 249 SERHANFIINTGGATPADIEALIEQVRDEVARRHGVTLVPEVHIVGE 295


>gi|219670072|ref|YP_002460507.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Desulfitobacterium
           hafniense DCB-2]
 gi|219540332|gb|ACL22071.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Desulfitobacterium
           hafniense DCB-2]
          Length = 293

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 89/288 (30%), Positives = 148/288 (51%), Gaps = 4/288 (1%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYF-LTLLPSDIPITIVGLGSNILV 75
           +RG+ +  +PL+++  +R GG AE +  P+   +L+   L      IP  + G GSN+L 
Sbjct: 6   MRGRIEHRYPLQKLNTWRIGGLAETVCWPESEEELREIWLKCQEQGIPFRLFGRGSNVLF 65

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
            D G+ GV +  +    S  +          A  S   L+  A   G+ G  F  GIPG+
Sbjct: 66  PDEGLPGVTVISTGLAQSVWDSERVTVG---AGYSLARLSQEAADRGLTGLEFARGIPGT 122

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           +GGA  MNAGA+       + EV  +  +G    + +E +++ YR   +    I+   V 
Sbjct: 123 VGGAVVMNAGAHGGSIQDILEEVKILAPEGEVQRLAKEDIQFGYRECSLRDQAIVLEGVF 182

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
              P   ++I A ++     R+  QP++    GS F+NP G SA +LIE++G +G   GG
Sbjct: 183 HLKPGDPDVIQATMSENLARRKAAQPLELPNAGSVFRNPPGGSAGRLIEEAGWKGKRLGG 242

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           A++S  H NF++N  NAT  D+  L  +++K V +Q G+ L+ E++ +
Sbjct: 243 AQVSSKHANFIVNQGNATARDVLALIREIQKDVHHQFGVELKTEVRYI 290


>gi|49481099|ref|YP_039087.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|81394326|sp|Q6HBI9|MURB2_BACHK RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase 2;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase 2
 gi|49332655|gb|AAT63301.1| UDP-N-acetylmuramate dehydrogenase
           (UDP-N-acetylenolpyruvoylglucosamine reductase)
           [Bacillus thuringiensis serovar konkukian str. 97-27]
          Length = 305

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 89/310 (28%), Positives = 147/310 (47%), Gaps = 7/310 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    +   L     +  G  +++  LK  T  + GG A+V   P +  +++  +     
Sbjct: 1   MNMQEVYEYLSTVLPE--GHVKQDEMLKNHTHIKVGGKADVFVAPTNYDEIQEVIKYANK 58

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +IP+T +G GSN++++D GIRG+ + L               ++     +   ++  AL
Sbjct: 59  YNIPVTFLGNGSNVIIKDGGIRGITVSLI---HITGVTVTGTTIVAQCGAAIIDVSRIAL 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            H + G  F  GIPGS+GGA YMNAGA   E S  + E   +   G    + +E  ++ Y
Sbjct: 116 DHNLTGLEFACGIPGSVGGALYMNAGAYGGEISFVLTEAVVMTGDGELRTLTKEAFEFGY 175

Query: 180 RSSEITKDLII-THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S    +  I               I A + ++   RE+ QP++  + GS FK P  + 
Sbjct: 176 RKSVFANNHYIILEARFELEEGLYEEIKAKMDDLTFKRESKQPLEYPSCGSVFKRPPNNF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI++SG +G   GG ++S  H  FM+N DN T  D   L   V+K V  + G+ LE 
Sbjct: 236 AGKLIQESGLQGKRIGGVEVSLKHAGFMVNVDNGTAQDYIDLIHFVQKTVEEKFGVKLER 295

Query: 299 EIKRLGDFFD 308
           E++ +G+  +
Sbjct: 296 EVRIIGEDKE 305


>gi|15893801|ref|NP_347150.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           acetobutylicum ATCC 824]
 gi|29336903|sp|Q97LP4|MURB_CLOAB RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|15023372|gb|AAK78490.1|AE007565_9 UDP-N-acetylenolpyruvoylglucosamine reductase (murB) [Clostridium
           acetobutylicum ATCC 824]
 gi|325507924|gb|ADZ19560.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           acetobutylicum EA 2018]
          Length = 305

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 100/305 (32%), Positives = 156/305 (51%), Gaps = 7/305 (2%)

Query: 3   YGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-D 61
           +      L    K+     + + P+K  T F+ GG  +V+  P+   ++   + L    D
Sbjct: 4   FQDFIAALSNFIKK--DNLKIDVPMKNHTSFKVGGPVDVLVMPEKYEEINRIIELCEKYD 61

Query: 62  IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRH 121
           +   I+G GSN+LVRD G+RGV ++L       I    + ++I G       L+  A   
Sbjct: 62  VNYYIIGNGSNLLVRDGGLRGVAIKLLKLNKLQI---GNNKIIAGCGVPLGYLSRKARDK 118

Query: 122 GIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS 181
            + G  F  GIPGS+GGA  MNAGA N E S  V  V  ID KG    + R++L++ YRS
Sbjct: 119 SLTGLEFACGIPGSVGGAVAMNAGAYNGEISNVVESVLVIDNKGKMKRLYRDELQFGYRS 178

Query: 182 S-EITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
           S  +    I   V        +  I+  I ++   R   QP++  + GSTFK P GH A 
Sbjct: 179 SAILKHKYIALEVTFTLQKGDREKIANRIDDLMRRRIEKQPLEYPSAGSTFKRPVGHFAA 238

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LIE SG +G   GGA++S+ H  F+IN ++AT  D+  L + V+  V ++  + L+ E+
Sbjct: 239 KLIEDSGLKGKGIGGAQVSDKHSGFIINKNDATAKDILDLIKFVQNTVKSKFNVELDTEV 298

Query: 301 KRLGD 305
           + +G+
Sbjct: 299 RIIGE 303


>gi|30265114|ref|NP_847491.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. Ames]
 gi|47530624|ref|YP_021973.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. 'Ames Ancestor']
 gi|49187925|ref|YP_031178.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. Sterne]
 gi|65317059|ref|ZP_00390018.1| COG0812: UDP-N-acetylmuramate dehydrogenase [Bacillus anthracis
           str. A2012]
 gi|165870055|ref|ZP_02214712.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. A0488]
 gi|167636558|ref|ZP_02394853.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. A0442]
 gi|167641794|ref|ZP_02400036.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. A0193]
 gi|170689386|ref|ZP_02880579.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. A0465]
 gi|170709088|ref|ZP_02899516.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. A0389]
 gi|177655393|ref|ZP_02936891.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. A0174]
 gi|190569223|ref|ZP_03022119.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           Tsiankovskii-I]
 gi|196033132|ref|ZP_03100545.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus W]
 gi|196039462|ref|ZP_03106767.1| UDP-N-acetylmuramate dehydrogenase [Bacillus cereus NVH0597-99]
 gi|218906268|ref|YP_002454102.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           AH820]
 gi|227817845|ref|YP_002817854.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. CDC 684]
 gi|228917704|ref|ZP_04081245.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|228930099|ref|ZP_04093109.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis serovar pondicheriensis BGSC 4BA1]
 gi|228948799|ref|ZP_04111075.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
 gi|229094186|ref|ZP_04225265.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           Rock3-42]
 gi|229124609|ref|ZP_04253794.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           95/8201]
 gi|229604037|ref|YP_002869307.1| UDP-N-acetylmuramate dehydrogenase [Bacillus anthracis str. A0248]
 gi|254686484|ref|ZP_05150343.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. CNEVA-9066]
 gi|254724483|ref|ZP_05186267.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. A1055]
 gi|254735691|ref|ZP_05193398.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. Western North America USA6153]
 gi|254744223|ref|ZP_05201903.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. Kruger B]
 gi|254750983|ref|ZP_05203022.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. Vollum]
 gi|254756975|ref|ZP_05209003.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. Australia 94]
 gi|301056560|ref|YP_003794771.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           CI]
 gi|47605857|sp|Q81XC5|MURB2_BACAN RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase 2;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase 2
 gi|30259791|gb|AAP28977.1| UDP-N-acetylmuramate dehydrogenase [Bacillus anthracis str. Ames]
 gi|47505772|gb|AAT34448.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. 'Ames Ancestor']
 gi|49181852|gb|AAT57228.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. Sterne]
 gi|164714378|gb|EDR19898.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. A0488]
 gi|167510277|gb|EDR85681.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. A0193]
 gi|167528031|gb|EDR90834.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. A0442]
 gi|170125990|gb|EDS94889.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. A0389]
 gi|170666682|gb|EDT17452.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. A0465]
 gi|172080144|gb|EDT65238.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. A0174]
 gi|190559663|gb|EDV13652.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           Tsiankovskii-I]
 gi|195994561|gb|EDX58516.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus W]
 gi|196029622|gb|EDX68224.1| UDP-N-acetylmuramate dehydrogenase [Bacillus cereus NVH0597-99]
 gi|218535148|gb|ACK87546.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           AH820]
 gi|227007705|gb|ACP17448.1| UDP-N-acetylmuramate dehydrogenase [Bacillus anthracis str. CDC
           684]
 gi|228658949|gb|EEL14604.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           95/8201]
 gi|228689178|gb|EEL43000.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           Rock3-42]
 gi|228810856|gb|EEM57201.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228829598|gb|EEM75225.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis serovar pondicheriensis BGSC 4BA1]
 gi|228841941|gb|EEM87047.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|229268445|gb|ACQ50082.1| UDP-N-acetylmuramate dehydrogenase [Bacillus anthracis str. A0248]
 gi|300378729|gb|ADK07633.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           biovar anthracis str. CI]
          Length = 305

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 89/310 (28%), Positives = 147/310 (47%), Gaps = 7/310 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    +   L     +  G  +++  LK  T  + GG A+V   P +  +++  +     
Sbjct: 1   MNMQEVYEYLSTVLPE--GHVKQDEMLKNHTHIKVGGKADVFVAPTNYDEIQEVIKYANK 58

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +IP+T +G GSN++++D GIRG+ + L               ++     +   ++  AL
Sbjct: 59  YNIPVTFLGNGSNVIIKDGGIRGITVSLI---HITGVTVTGTTIVAQCGAAIIDVSRIAL 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            H + G  F  GIPGS+GGA YMNAGA   E S  + E   +   G    + +E  ++ Y
Sbjct: 116 DHNLTGLEFACGIPGSVGGALYMNAGAYGGEISFVLTEAVVMTGDGELRTLTKEAFEFGY 175

Query: 180 RSSEITKDLII-THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S    +  I               I A + ++   RE+ QP++  + GS FK P  + 
Sbjct: 176 RKSVFANNHYIILEARFELEEGVYEEIKAKMDDLTFKRESKQPLEYPSCGSVFKRPPNNF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI++SG +G   GG ++S  H  FM+N DN T  D   L   V+K V  + G+ LE 
Sbjct: 236 AGKLIQESGLQGKRIGGVEVSLKHAGFMVNVDNGTAQDYIDLIHFVQKTVEEKFGVKLER 295

Query: 299 EIKRLGDFFD 308
           E++ +G+  +
Sbjct: 296 EVRIIGEDKE 305


>gi|313905018|ref|ZP_07838388.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Eubacterium
           cellulosolvens 6]
 gi|313470088|gb|EFR65420.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Eubacterium
           cellulosolvens 6]
          Length = 303

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 94/305 (30%), Positives = 143/305 (46%), Gaps = 10/305 (3%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS- 60
           I+ +  ++L E       +     P+ + T FR GG A+    P    +++  +      
Sbjct: 5   IFKKFQKILGE------DQVIYGEPMSRHTTFRIGGPADYFLTPAGAEEIRDVIAYCREV 58

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           ++P  I+G GSN+LV D G RG V+++ +             +   A       A  A  
Sbjct: 59  ELPYFILGNGSNLLVSDEGFRGAVIQVDHRMQEITVEGRA--IRAQAGVLLSKAAAVARD 116

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
           H + G  F  GIPG++GG   MNAGA   E    +V V  +DR      I    L   YR
Sbjct: 117 HSLTGLEFASGIPGTLGGGVSMNAGAYGGELKDVLVRVRVVDRDLQIRDIEAGDLDLGYR 176

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRET-VQPIKEKTGGSTFKNPTGHSA 239
            S I  + ++   V     E +    ++  N      T  QP++  + GSTFK P G+ A
Sbjct: 177 HSRIQDEEMVVTDVTLELMEGRMEEISSRMNELREARTSKQPLEFPSAGSTFKRPEGYFA 236

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LI  +G +G   G A++SE HC F+IN   AT  D+  L E V++K+  + G+LLE E
Sbjct: 237 GKLIMDAGLKGFRVGDAQVSEKHCGFVINRGAATAKDVCTLIESVQEKIREKDGVLLEPE 296

Query: 300 IKRLG 304
           I+ LG
Sbjct: 297 IRFLG 301


>gi|312863297|ref|ZP_07723535.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus vestibularis
           F0396]
 gi|311100833|gb|EFQ59038.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus vestibularis
           F0396]
          Length = 300

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 95/300 (31%), Positives = 146/300 (48%), Gaps = 6/300 (2%)

Query: 9   LLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITI 66
           +L E  + L G   + + PLK  T+ + GG A+ +  P++ ++L   +      DIP  +
Sbjct: 1   MLDELKEDLVGIDIRFDEPLKGYTYTKVGGPADYLAFPRNRYELSRIVKFANKHDIPWMV 60

Query: 67  VGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGF 126
           +G  SN++VRD GIRG V+         +   N  ++   A  +  +    A    + GF
Sbjct: 61  LGNASNLIVRDGGIRGFVIMFDKLNGIAV---NGYQVEAEAGANLIATTKVARFQSLTGF 117

Query: 127 HFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK 186
            F  GIPGSIGGA +MNAGA   E +  +V    + + G    I    +++ YR S + +
Sbjct: 118 EFAAGIPGSIGGAVFMNAGAYGGEIAHILVSAQVLTKDGEIRTIDARDMRFGYRRSVLQE 177

Query: 187 -DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEK 245
              ++        P     I   +  + H RE  QP++  + GS FK P GH A QLI +
Sbjct: 178 TGEVVISAKFNLKPGDYEQIKNEMNRLNHLRELKQPLEYPSCGSVFKRPLGHFAGQLIME 237

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +  +G   GG ++S  H  FM+N D  T  D E L   V  KV   SG+ LE E++ +GD
Sbjct: 238 ANLKGHRIGGVEVSTKHAGFMVNVDQGTAKDYEDLIADVIAKVKENSGVTLEPEVRIIGD 297


>gi|169831591|ref|YP_001717573.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Candidatus
           Desulforudis audaxviator MP104C]
 gi|169638435|gb|ACA59941.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Candidatus
           Desulforudis audaxviator MP104C]
          Length = 300

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 106/297 (35%), Positives = 154/297 (51%), Gaps = 4/297 (1%)

Query: 12  ERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTL-LPSDIPITIVGLG 70
           +    +RG  +    L   T +R GG A+   +P  I DL++ L       +P+T++G G
Sbjct: 6   DLKAGIRGSIRVGEMLGAHTTWRVGGPADYFVEPAVIEDLQFVLRFTAERGLPLTVMGNG 65

Query: 71  SNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFY 130
           SN+LV DAG+RGVV+R+ +     +       ++         L  +A   G+GG  F  
Sbjct: 66  SNLLVSDAGLRGVVVRMGSGMDRVVLD--GNVILAQGGVRLSRLLRTAWESGLGGLEFMA 123

Query: 131 GIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLII 190
           GIP S+GGA  MNAGAN       V EV  +DR G        +L ++YR S I     I
Sbjct: 124 GIPASLGGAVVMNAGANGLCMGDRVEEVTMVDRSGTVQRRSAGELGFRYRWSNIQAGKEI 183

Query: 191 THVVL-RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
              V  R FP+ ++ I   I    + R   QP+++ + G  FKNP G SA +LIE +G +
Sbjct: 184 VTAVALRCFPKDRDEIGREIERFLNRRRETQPLEQPSAGCVFKNPPGDSAGRLIEAAGGK 243

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           GL  GGA++S  H NF++N   AT  D+  L  QVR+ V ++ GI L  E+  +GDF
Sbjct: 244 GLRVGGAEVSYKHANFVLNTGGATARDIMELIRQVRQLVGDKFGIELGLEVNLMGDF 300


>gi|325689820|gb|EGD31824.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK115]
 gi|325696659|gb|EGD38548.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK160]
          Length = 301

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 97/302 (32%), Positives = 152/302 (50%), Gaps = 6/302 (1%)

Query: 7   SRLLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPI 64
            + L +   +L G   + N PL Q T+ + GG A+ +  P++ ++L   +      +IP 
Sbjct: 1   MQKLEKLKSELEGIDIRFNEPLSQYTYTKVGGAADFLVFPRNRYELARIVNFANQENIPW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G  SNI+VRD GIRG V+         +   +   +   A  +     + AL++ + 
Sbjct: 61  MVLGNASNIIVRDGGIRGFVIMFDKLNNVAV---DGYMIEAEAGANLIQTTHIALQNSLT 117

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           GF F  GIPGS+GGA +MNAGA   E +  +V    +  +G    +    +K+ YR S +
Sbjct: 118 GFEFACGIPGSVGGAVFMNAGAYGGEIAHVLVSCKVLTPQGQVKTLDVRDMKFGYRHSLV 177

Query: 185 TK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            +   I+        P     I   +  + H RE  QP++  + GS FK P GH A QLI
Sbjct: 178 QETGDIVISAKFALSPGVHRTIRQEMERLTHLRELKQPLEYPSCGSVFKRPLGHFAGQLI 237

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
            ++G +G   GG ++SE+H  FMIN D  T  D E L   V ++V   SGI LE E++ +
Sbjct: 238 SEAGLKGHRIGGVEVSEMHAGFMINVDKGTAQDYENLIAHVIERVRENSGITLEREVRII 297

Query: 304 GD 305
           G+
Sbjct: 298 GE 299


>gi|118480151|ref|YP_897302.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis str. Al Hakam]
 gi|196047552|ref|ZP_03114761.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           03BB108]
 gi|217962551|ref|YP_002341123.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           AH187]
 gi|222098520|ref|YP_002532578.1| udp-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus Q1]
 gi|225867054|ref|YP_002752432.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           03BB102]
 gi|229141804|ref|ZP_04270332.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           BDRD-ST26]
 gi|229187315|ref|ZP_04314459.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus BGSC
           6E1]
 gi|118419376|gb|ABK87795.1| UDP-N-acetylmuramate dehydrogenase [Bacillus thuringiensis str. Al
           Hakam]
 gi|196021586|gb|EDX60284.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           03BB108]
 gi|217067379|gb|ACJ81629.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           AH187]
 gi|221242579|gb|ACM15289.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus Q1]
 gi|225787361|gb|ACO27578.1| UDP-N-acetylmuramate dehydrogenase [Bacillus cereus 03BB102]
 gi|228596166|gb|EEK53842.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus BGSC
           6E1]
 gi|228641640|gb|EEK97943.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           BDRD-ST26]
          Length = 305

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 89/310 (28%), Positives = 147/310 (47%), Gaps = 7/310 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    +   L     +  G  +++  LK  T  + GG A+V   P +  +++  +     
Sbjct: 1   MNMQEVYEYLSTVLPE--GHVKQDEMLKNHTHIKVGGKADVFVAPTNYDEIQKVIKYANK 58

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +IP+T +G GSN++++D GIRG+ + L               ++     +   ++  AL
Sbjct: 59  YNIPVTFLGNGSNVIIKDGGIRGITVSLI---HITGVTVTGTTIVAQCGAAIIDVSRIAL 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            H + G  F  GIPGS+GGA YMNAGA   E S  + E   +   G    + +E  ++ Y
Sbjct: 116 DHNLTGLEFACGIPGSVGGALYMNAGAYGGEISYVLTEAVVMTGDGELRTLTKEAFEFGY 175

Query: 180 RSSEITKDLII-THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S    +  I               I A + ++   RE+ QP++  + GS FK P  + 
Sbjct: 176 RKSVFANNHYIILEARFELEEGVYEEIKAKMDDLTFKRESKQPLEYPSCGSVFKRPPNNF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI++SG +G   GG ++S  H  FM+N DN T  D   L   V+K V  + G+ LE 
Sbjct: 236 AGKLIQESGLQGKRIGGVEVSLKHAGFMVNVDNGTAQDYIDLIHFVQKTVEEKFGVKLER 295

Query: 299 EIKRLGDFFD 308
           E++ +G+  +
Sbjct: 296 EVRIIGEDKE 305


>gi|15965927|ref|NP_386280.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sinorhizobium
           meliloti 1021]
 gi|307308237|ref|ZP_07587946.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sinorhizobium
           meliloti BL225C]
 gi|307319704|ref|ZP_07599129.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sinorhizobium
           meliloti AK83]
 gi|30316099|sp|Q92NM1|MURB_RHIME RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|15075196|emb|CAC46753.1| Probable UDP-N-acetylenolpyruvoylglucosamine reductase
           [Sinorhizobium meliloti 1021]
 gi|306894635|gb|EFN25396.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sinorhizobium
           meliloti AK83]
 gi|306901235|gb|EFN31841.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sinorhizobium
           meliloti BL225C]
          Length = 324

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 170/312 (54%), Positives = 221/312 (70%), Gaps = 3/312 (0%)

Query: 1   MIYGRISRLLRERGK---QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTL 57
           M      +LL   G     +RG+   + P+ ++TWFR GG AE+MFQP D  DL  FL L
Sbjct: 1   MKQVNGQKLLDSLGSGVAAIRGRLTPDAPMDRVTWFRAGGLAELMFQPHDTDDLVAFLKL 60

Query: 58  LPSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANS 117
           +P ++P+ +VG+GSN+LVRD GI GVV+RLS  GF ++E+     +  GA C  K++A  
Sbjct: 61  VPEEVPVMVVGVGSNLLVRDGGIPGVVIRLSAKGFGDLELAGENRIKAGAICPDKNIAAM 120

Query: 118 ALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKY 177
           AL HGIGGF+F+YGIPGSIGGA  MNAGAN+ ETS+ VVEVH +DRKGN+HV+ + ++ Y
Sbjct: 121 ALDHGIGGFYFYYGIPGSIGGALRMNAGANSGETSERVVEVHAVDRKGNRHVLSKAEMGY 180

Query: 178 QYRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGH 237
            YR S   K+LI TH +  G+ E +  I   +  V  HRETVQPI+EKTGGSTFKNP GH
Sbjct: 181 GYRHSGAAKELIFTHAIFEGYAEDKTKIRTDMDAVRQHRETVQPIREKTGGSTFKNPDGH 240

Query: 238 SAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLE 297
           SAW+LI+++GCRG+  G A++S LHCNFMIN   ATGY+LEYLGE VR++V   SG+ LE
Sbjct: 241 SAWKLIDEAGCRGMMIGNAQMSPLHCNFMINTGQATGYELEYLGETVRQRVMEHSGVKLE 300

Query: 298 WEIKRLGDFFDH 309
           WEIKR+G+F   
Sbjct: 301 WEIKRVGNFMPG 312


>gi|229586497|ref|YP_002844998.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia africae
           ESF-5]
 gi|228021547|gb|ACP53255.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia africae
           ESF-5]
          Length = 307

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 128/292 (43%), Positives = 178/292 (60%), Gaps = 2/292 (0%)

Query: 13  RGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSN 72
               ++G++++++ LK +TWF+ GGNAE+ F+P D  DLK FL      +PI   G GSN
Sbjct: 15  ILPIVKGEYKKDYNLKHLTWFKVGGNAEIFFKPLDSEDLKSFLIQNKQKLPIKTFGAGSN 74

Query: 73  ILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGI 132
           +++RD GI GVV++L     +   +     +IVG+ C   +LA     + I GF F  GI
Sbjct: 75  VIIRDGGIEGVVIKLGQNFSNIEFID--NHLIVGSSCLNYNLAKFCQANAISGFEFLVGI 132

Query: 133 PGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITH 192
           PG+IGG   MNAGA   E    VV++  ID  GN      E++ ++YRS+ + K+LII  
Sbjct: 133 PGTIGGGVAMNAGAYGSEFKDIVVQIEAIDFAGNFLTFTNEEIGFKYRSNNLPKNLIILK 192

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
            V +        I   +  + + R + QPIKE+TGGSTF NP G  +W+LI+K+G RG  
Sbjct: 193 AVFKINKGDSENILLRMNEIHNARSSTQPIKERTGGSTFANPEGRKSWELIDKAGLRGYR 252

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            GGA +SELHCNFMIN  +AT  DLE LG+ VR+KV   SG+ LEWEIKR+G
Sbjct: 253 IGGASMSELHCNFMINNGDATAKDLEDLGDFVRQKVCEDSGVKLEWEIKRIG 304


>gi|313123347|ref|YP_004033606.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           delbrueckii subsp. bulgaricus ND02]
 gi|312279910|gb|ADQ60629.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           delbrueckii subsp. bulgaricus ND02]
          Length = 297

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 88/288 (30%), Positives = 143/288 (49%), Gaps = 5/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDA 78
             QEN PL + T+ +TGG AE +  P+ + +LK  L     D +PIT++G  SN+++RD 
Sbjct: 12  NLQENIPLSRYTFTQTGGPAEYLAFPKTLAELKELLAAAKEDQLPITVIGNASNLIIRDK 71

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GI+G+V+ L       +      ++   A       + +A   G+ G  F  GIPGS+GG
Sbjct: 72  GIKGLVIILKEMKEIKV---EADKVHAQAGARIIDTSFAAGEAGLSGLEFAAGIPGSVGG 128

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR-G 197
           A +MNAGA   ET   +     + R G        +L + YR S + ++  I        
Sbjct: 129 AVFMNAGAYGGETKDCLESATVVTRDGEVKTYTNAELHFSYRHSLLQENDEIVIAATFAL 188

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
               +  I   +  +   R   QP++  + GS FK PTGH    ++ K+G +G + GGA+
Sbjct: 189 KAGDKATILDQMNYLNALRSYKQPLEYPSCGSVFKRPTGHFVGPMLIKAGLQGKQIGGAQ 248

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S  H  F++N   AT  D   L   ++K +  + GI L+ E++ +G+
Sbjct: 249 VSTKHAGFIVNKGGATATDYLNLIHYIQKTIKEKDGIALQTEVRIIGE 296


>gi|258645509|ref|ZP_05732978.1| UDP-N-acetylmuramate dehydrogenase [Dialister invisus DSM 15470]
 gi|260402863|gb|EEW96410.1| UDP-N-acetylmuramate dehydrogenase [Dialister invisus DSM 15470]
          Length = 301

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 98/290 (33%), Positives = 158/290 (54%), Gaps = 5/290 (1%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKY-FLTLLPSDIPITIVGLGSNILVR 76
           + + + N P+ + T F  GG A+    P+ I +L+   + +  +++P  I+G G+N+LVR
Sbjct: 14  KNQIKLNEPMSRHTTFGIGGAADCFVMPETIEELQKVIVEVTKANVPFFILGGGANLLVR 73

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GIRGVV+           +     + V A  S    A +A+ +G+ G  F  GIPG+I
Sbjct: 74  DKGIRGVVIYTGRLQSI---IHEGNRLRVAAGVSTAKAAKAAMEYGLSGMEFAAGIPGTI 130

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVL 195
           GGAAYMNAGA N E +  VV V   +R G   V  + +L Y YR S   ++  II  + +
Sbjct: 131 GGAAYMNAGAYNGEMADIVVSVLSCNRNGQLSVYNKSKLHYDYRHSLFMENGEIIVEITV 190

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
              P + + I   +      R   QP+++K+ GSTFK P G+   Q+IE+ G +G   G 
Sbjct: 191 ELAPGNIHDIEVMMEEFNRRRRMKQPLEKKSAGSTFKRPAGYFVGQMIEEMGLKGFAVGD 250

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           AK+S  H  F+IN  +A+  D+  L  +++++VF+  G+ L  E++ +G+
Sbjct: 251 AKVSMKHAGFLINDGHASCTDMMNLISEIKRRVFDGYGVELMTEVQIVGE 300


>gi|188585619|ref|YP_001917164.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Natranaerobius
           thermophilus JW/NM-WN-LF]
 gi|179350306|gb|ACB84576.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Natranaerobius
           thermophilus JW/NM-WN-LF]
          Length = 300

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 94/297 (31%), Positives = 146/297 (49%), Gaps = 4/297 (1%)

Query: 9   LLRERGKQL-RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITI 66
           +  E    L +   +    L   T F+ GG AE+   P +I +++  L L+   ++P  +
Sbjct: 6   IYDELLNHLPKDNIKLQHELAPYTTFKIGGPAELFVTPSNIEEVQAVLNLVNQEELPYFV 65

Query: 67  VGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGF 126
           +G  SN+L+ D G+ G+V+ L              E+   +  S   L+  AL+HG+ G 
Sbjct: 66  LGNASNVLIDDNGLSGIVIYLGETFKDI--QVEGTEITAQSGVSLNKLSRMALKHGLTGL 123

Query: 127 HFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK 186
            F  GIPG++GG  YMNAGA   + S  V +V  I     Q+            S+   +
Sbjct: 124 EFAEGIPGTLGGGLYMNAGAFGGQLSNVVKQVTAIVDHQIQNYTRESMDFGYRSSTFQNQ 183

Query: 187 DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKS 246
           + II    L       + I + + ++   R   QP+   + GS FK P G+ A +LIE S
Sbjct: 184 NAIILQATLALQKGDFDQIKSYMEDLKSRRTEKQPLNYPSAGSVFKRPEGYYAGKLIEDS 243

Query: 247 GCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           G +G+E GGAK+SE HC F+IN   AT  D++ L   ++K V  + G+ LE E+K L
Sbjct: 244 GLKGVEIGGAKVSEKHCGFIINTGTATSRDVKELVSYIQKTVKEKFGVTLERELKYL 300


>gi|325125398|gb|ADY84728.1| UDP-n-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           delbrueckii subsp. bulgaricus 2038]
          Length = 297

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 89/287 (31%), Positives = 144/287 (50%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAG 79
            QEN PL + T+ +TGG AE +  P+ + +LK  L     D +PIT++G  SN+++RD G
Sbjct: 13  LQENIPLSRYTFTQTGGPAEYLAFPKTLAELKELLAAAKEDQLPITVIGNASNLIIRDKG 72

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           I+G+V+ L+      +      ++   A       + +A   G+ G  F  GIPGS+GGA
Sbjct: 73  IKGLVIILTEMKEIKV---EADKVHAQAGARIIDTSFAAGEAGLSGLEFAAGIPGSVGGA 129

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR-GF 198
            +MNAGA   ET   +     + R G        +L + YR S + ++  I         
Sbjct: 130 VFMNAGAYGGETKDCLESATVVTRDGEVKTYTNAELHFSYRHSLLQENDEIVIAATFALK 189

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
              +  I   +  +   R   QP++  + GS FK PTGH    L+ K+G +G + GGA++
Sbjct: 190 AGDKATILDQMNYLNALRSYKQPLEYPSCGSVFKRPTGHFVGPLLIKAGLQGKQIGGAQV 249

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           S  H  F++N   AT  D   L   ++K +  + GI L+ E++ +G+
Sbjct: 250 STKHAGFIVNKGGATATDYLNLIHYIQKTIKEKDGIALQTEVRIIGE 296


>gi|261419140|ref|YP_003252822.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus sp.
           Y412MC61]
 gi|297530890|ref|YP_003672165.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus sp.
           C56-T3]
 gi|319765956|ref|YP_004131457.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus sp.
           Y412MC52]
 gi|261375597|gb|ACX78340.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus sp.
           Y412MC61]
 gi|297254142|gb|ADI27588.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus sp.
           C56-T3]
 gi|317110822|gb|ADU93314.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus sp.
           Y412MC52]
          Length = 304

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 103/306 (33%), Positives = 157/306 (51%), Gaps = 11/306 (3%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS- 60
           IY R+  +  ER          + P+K  T  R GG A+ +  P+    +   L L    
Sbjct: 7   IYQRLVEICGER------NVLRDEPMKNHTLVRIGGKADFLVWPETYEQVIEVLRLKEEY 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
            +P T++G GSN+++RD G+RG+V++L +        R    +I  +    K+++  AL 
Sbjct: 61  GLPFTLLGNGSNVIIRDGGLRGIVMQLRHLNRIW---REGNNVIAQSGADIKAVSRFALE 117

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             + G  F  GIPGS+GGA  MNAGA   E    +  V      G    +  E+L+  YR
Sbjct: 118 QHLTGLEFACGIPGSVGGAIMMNAGAYGGEVKDVLDHVKVATLSGELKTLKNEELELGYR 177

Query: 181 SSEITK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
           +S I++   I+  VV    P     I A + ++   RE+ QP++  + GS FK P G+ A
Sbjct: 178 TSIISRTHDIVLEVVFALRPGDYAQIKAKMDDLTFQRESKQPLEYPSVGSVFKRPPGYFA 237

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LI+ SG +G  FGGA++S  H  F+IN +NAT  D     E VRK V  + G+ LE E
Sbjct: 238 GKLIQDSGLQGKGFGGAEVSTKHAGFIINKNNATAADYIATIEMVRKTVKEKFGVDLELE 297

Query: 300 IKRLGD 305
           +K +G+
Sbjct: 298 VKIIGE 303


>gi|194014879|ref|ZP_03053496.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus pumilus
           ATCC 7061]
 gi|194013905|gb|EDW23470.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus pumilus
           ATCC 7061]
          Length = 303

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 93/304 (30%), Positives = 155/304 (50%), Gaps = 7/304 (2%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPI 64
           +  L  E  +   GK  EN PL   T  + GG A+++  P+DI  +K  +  +       
Sbjct: 1   MENLKNELLEAQVGKVLENEPLANHTTMKIGGPADLLIIPKDIDAVKTIMDHVKKHHTNW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRL-SNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           T++G GSN+LV D GIRGVVL+L +      +           +     +      + G+
Sbjct: 61  TVIGRGSNLLVLDKGIRGVVLKLGAGLDHLTVNDEEITVGGGYSVVRLATS---LSKQGL 117

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            G  F  GIPGSIGGA YMNAGA+  + S+ +V+   +   G+   +  EQ+ + YR+S 
Sbjct: 118 SGLEFAAGIPGSIGGAVYMNAGAHGSDISKILVKARILFEDGSIEWLTNEQMNFSYRTSV 177

Query: 184 ITKDLI--ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
           + K+    +   V +   + +  I+  +     +R+  QP      GS F+NP    A Q
Sbjct: 178 LQKERPGIVLEAVFKLKQDDREKITKKMQQNKDYRKETQPYNRPCAGSIFRNPLPEYAGQ 237

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           L+EK+  +G + GGA+IS++H NF++NA  AT  D+  L + ++KK+     + +  E++
Sbjct: 238 LVEKANLKGYQIGGARISDMHGNFIVNAGGATAQDVLDLIQFIQKKIKEDYNVEMHTEVE 297

Query: 302 RLGD 305
            +G+
Sbjct: 298 IIGE 301


>gi|229062740|ref|ZP_04200045.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           AH603]
 gi|228716500|gb|EEL68203.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           AH603]
          Length = 305

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 88/310 (28%), Positives = 149/310 (48%), Gaps = 7/310 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    + + L     +  G  +++  LK  T  + GG A+V   P +  +++  +     
Sbjct: 1   MNMHEVYKYLSTVLPE--GHVKQDEMLKNHTHIKVGGKADVFVAPTNYDEIQEVIKYANE 58

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +IP+T +G GSN++++D GIRG+++ L               ++     +   ++  AL
Sbjct: 59  YNIPVTFLGNGSNVIIKDGGIRGIIVSLI---HITGVTVTGTTIVAQCGAAIIDVSRIAL 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            H + G  F  GIPGS+GGA YMNAGA   E S  + E   +   G    + +E  ++ Y
Sbjct: 116 DHNLTGLEFACGIPGSVGGALYMNAGAYGGEVSFVLTEAVVMTGDGELRTLTKEAFEFGY 175

Query: 180 RSSEITKDLII-THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S    +  I            +  I   + ++   RE+ QP++  + GS FK P  + 
Sbjct: 176 RKSVFANNHYIILEARFELEEGVREEIKEKMDDLTFKRESKQPLEYPSCGSVFKRPPNNF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI++SG +G   GG ++S  H  FM+N DN T  D   L   V+K V  + G+ LE 
Sbjct: 236 AGKLIQESGLQGKRIGGVEVSLKHAGFMVNVDNGTAQDYIDLIHFVQKTVEEKFGVKLER 295

Query: 299 EIKRLGDFFD 308
           E++ +G+  +
Sbjct: 296 EVRIIGEDKE 305


>gi|298507095|gb|ADI85818.1| UDP-N-acetylenolpyruvylglucosamine reductase [Geobacter
           sulfurreducens KN400]
          Length = 300

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 100/299 (33%), Positives = 142/299 (47%), Gaps = 4/299 (1%)

Query: 8   RLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITI 66
           RL      ++RG+   + P+ + T  R GG A+    P D  D++  L +L  +  P   
Sbjct: 4   RLAARLEAEVRGEILRDEPMARHTSLRVGGPADFFVTPADPDDMRALLAILVETGTPWLA 63

Query: 67  VGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGF 126
           VG G N+L+RD G R   + +S A  + +E        VGA  +   L       G+ G 
Sbjct: 64  VGGGYNLLIRDGGFR--GVVISPARMTTLERLERNRAGVGAGVANGRLTAFLRDEGLAGL 121

Query: 127 HFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK 186
            F  GIPG++GGA  MNAGA+       V ++  +          REQL Y YR   +  
Sbjct: 122 EFLCGIPGTVGGALAMNAGAHGGAILDRVEDILTVG-TAGVERKRREQLDYGYRYLRLQP 180

Query: 187 DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKS 246
             II         +    IS  I     HR   Q +     GS FKNP G +AW+LIE +
Sbjct: 181 GEIIIGATFVLDSDDPRWISERIDGYRAHRTASQQVGFPNAGSFFKNPPGQAAWRLIEDA 240

Query: 247 GCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           G RG+  GGA++SE+H NF++N   AT  D   L  +++  V  +SG  LE E+K  GD
Sbjct: 241 GLRGVRVGGAQVSEVHTNFLVNRGGATAADFLALAARIKDAVKLKSGTALEEEVKIFGD 299


>gi|239626640|ref|ZP_04669671.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239516786|gb|EEQ56652.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 302

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 107/303 (35%), Positives = 150/303 (49%), Gaps = 9/303 (2%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           +  +L       R       P+ + T FR GG AEV   P    +L   L +L +  +P 
Sbjct: 7   LKDILESELPGCR----FMEPMSRHTSFRIGGPAEVFISPSGEEELAAVLRVLRTYHVPW 62

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            I+G GSN+LV D+G  G V+ +               + V         A+ AL+H + 
Sbjct: 63  RILGNGSNLLVSDSGCEGAVIAMEGICH---MEACGRFLRVAGGQLLSRAAHLALKHSLT 119

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS GGA  MNAGA   E    + E   +  +G   V+  ++L   YR+S I
Sbjct: 120 GMEFAAGIPGSAGGALVMNAGAYGFEMKDILREARVMTPEGEVLVLDADRLDLGYRTSCI 179

Query: 185 T-KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
             K  I+   V    P  +  I A +  +   R   QP++  + GSTFK P G+ A +LI
Sbjct: 180 PSKGYIVLEAVFGLEPGDRAAIEARMKELSDRRREKQPLEYPSAGSTFKRPQGYFAGKLI 239

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           E +G RG + GGA++SE HC F+IN+ +AT  D+  L   VRKKV   SG+ LE E+KR 
Sbjct: 240 EDAGLRGYQVGGAQVSEKHCGFVINSGSATASDVMALCGHVRKKVMETSGVELEMEVKRW 299

Query: 304 GDF 306
           G F
Sbjct: 300 GRF 302


>gi|315282308|ref|ZP_07870743.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria marthii FSL
           S4-120]
 gi|313614044|gb|EFR87753.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria marthii FSL
           S4-120]
          Length = 298

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 98/287 (34%), Positives = 148/287 (51%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAG 79
            + N PL   T+ +TGG A++   P+ I + +  ++    + IP+TI+G GSN++++D G
Sbjct: 13  IKLNEPLSNYTYTKTGGMADIFVMPKTIEETQEVVSYCHQNKIPLTILGNGSNLIIKDGG 72

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRGV+L L          RN+ ++   +       A  AL   + G  F  GIPGSIGGA
Sbjct: 73  IRGVILHLDLLQTI---ERNNTQITAMSGAKLIDTAKFALDESLSGLEFACGIPGSIGGA 129

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLII-THVVLRGF 198
            +MNAGA   E S  +     + + G    + R +LK  YR S I +   I         
Sbjct: 130 LHMNAGAYGGEISDVLEAATVLTQTGELKKLKRSELKAAYRFSTIAEKHYIVLDATFSLA 189

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
            E +N I A +  +   RE+ QP++  + GS FK P GH A +LI+ SG +G   GGA++
Sbjct: 190 LEDKNAIQAKMDELTAARESKQPLEYPSCGSVFKRPPGHFAGKLIQDSGLQGHIIGGAQV 249

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           S  H  F++N   AT  D   L   V+K V  +  + LE E+K +G+
Sbjct: 250 SLKHAGFIVNIGGATATDYMDLIAYVQKTVREKFDVELETEVKIIGE 296


>gi|229829564|ref|ZP_04455633.1| hypothetical protein GCWU000342_01661 [Shuttleworthia satelles DSM
           14600]
 gi|229791553|gb|EEP27667.1| hypothetical protein GCWU000342_01661 [Shuttleworthia satelles DSM
           14600]
          Length = 297

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 91/289 (31%), Positives = 146/289 (50%), Gaps = 5/289 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDA 78
           + + + P+   T FR GG A++  +P+    L   L  L    +P+ I+G GSN+LV D 
Sbjct: 12  QIRVDEPMSAHTSFRIGGPADLFLEPR-KDQLSPLLAALKEAKVPLMILGNGSNLLVGDK 70

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIRG V+ + N+            +   A      +A  A R G+ G     GIPGS+GG
Sbjct: 71  GIRGAVIHIGNSMNQIRVSE--DRIEAEAGALLVRVARQAQRAGLSGMESLSGIPGSLGG 128

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL-IITHVVLRG 197
           A  MNAGA     +  +  V  +  +G       E++ + YR S +  +  I+   +L+ 
Sbjct: 129 AIMMNAGAYGGTMADVLASVELLTEEGEIRNYSLEEMDFSYRHSRVRDEGGIVLSAILQL 188

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
                  I AA+A++   R   QP++  + GS FK P G+ A +LI+ +G RG   G A+
Sbjct: 189 TRGDAGEIDAAMADLTRRRTARQPLEMASAGSAFKRPEGYFAGKLIQDAGLRGYRVGQAQ 248

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           +SE HC F++N   A+  ++  L E VR +V  +  + LE E++ +G+F
Sbjct: 249 VSEKHCGFVVNLGGASAAEVRQLMEDVRARVKEKFHVDLEPEVRFVGEF 297


>gi|206976644|ref|ZP_03237549.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           H3081.97]
 gi|206745130|gb|EDZ56532.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           H3081.97]
          Length = 305

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 90/310 (29%), Positives = 146/310 (47%), Gaps = 7/310 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    +   L     +  G  +++  LK  T  + GG A+V   P +  +++  +     
Sbjct: 1   MNMQEVYEYLSTVLPE--GHVKQDEMLKNHTHIKVGGKADVFVAPTNYDEIQKVIKYANK 58

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +IP+T +G GSN++++D GIRG+ + L               ++     +   ++  AL
Sbjct: 59  YNIPVTFLGNGSNVIIKDGGIRGITVSLI---HITGVTVTGTTIVAQCGAAIIDVSRIAL 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            H + G  F  GIPGS+GGA YMNAGA   E S  + E   +   G    + +E  ++ Y
Sbjct: 116 DHNLTGLEFACGIPGSVGGALYMNAGAYGGEISYVLTEAVVMTGDGELRTLTKEAFEFGY 175

Query: 180 RSSEITKDLII-THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S    +  I               I A + ++   RE+ QP++  + GS FK P  + 
Sbjct: 176 RKSVFANNHYIILEARFELEEGVHEEIKAKMDDLTFKRESKQPLEYPSCGSVFKRPPNNF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI+ SG +G   GG ++S  H  FM+N DN T  D   L   V+K V  + G+ LE 
Sbjct: 236 AGKLIQDSGLQGKRIGGVEVSLKHAGFMVNVDNGTAQDYIDLIHFVQKTVEEKFGVKLER 295

Query: 299 EIKRLGDFFD 308
           E+K +G+  +
Sbjct: 296 EVKIIGEDKE 305


>gi|163942791|ref|YP_001647675.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           weihenstephanensis KBAB4]
 gi|229014258|ref|ZP_04171378.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus mycoides
           DSM 2048]
 gi|229169792|ref|ZP_04297489.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           AH621]
 gi|163864988|gb|ABY46047.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           weihenstephanensis KBAB4]
 gi|228613642|gb|EEK70770.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           AH621]
 gi|228747035|gb|EEL96918.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus mycoides
           DSM 2048]
          Length = 305

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 84/307 (27%), Positives = 147/307 (47%), Gaps = 7/307 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    + + L     +  G  +++  LK  T  + GG A+V   P +  +++  +     
Sbjct: 1   MNMHEVYKYLSTVLPE--GHVKQDEMLKNHTHIKVGGKADVFVSPTNYDEIQEVIKYANQ 58

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +IP+T +G GSN++++D G+RG+ + L +     +              +   ++  AL
Sbjct: 59  YNIPVTFLGNGSNVIIKDGGLRGITVSLIHITNVTVTGTAIVAGC---GAAIIDVSRIAL 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            H + G  F  GIPGS+GGA YMNAGA   E +  + E   +   G    + ++  ++ Y
Sbjct: 116 DHCLTGLEFACGIPGSVGGALYMNAGAYGGEVAYVLTEAVVMTGDGELRTLTKDAFEFGY 175

Query: 180 RSSEITKDLII-THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S    +  I            +  I   + ++ + RE+ QP++  + GS FK P  + 
Sbjct: 176 RKSVFANNHYIILEARFELEEGVREEIKEKMDDLTYKRESKQPLEYPSCGSVFKRPPNNF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI++SG +G   GG ++S  H  FM+N DN T  D   L   V+  V  + G+ LE 
Sbjct: 236 AGKLIQESGLQGKRIGGVEVSLKHAGFMVNVDNGTAQDYIDLIHFVQTTVEEKFGVKLER 295

Query: 299 EIKRLGD 305
           E++ +G+
Sbjct: 296 EVRIIGE 302


>gi|323701290|ref|ZP_08112965.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Desulfotomaculum
           nigrificans DSM 574]
 gi|323533892|gb|EGB23756.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Desulfotomaculum
           nigrificans DSM 574]
          Length = 303

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 101/303 (33%), Positives = 157/303 (51%), Gaps = 4/303 (1%)

Query: 5   RISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIP 63
            ++ L  E    L+G  + N  +   T +R GG A++   P    D++  +       IP
Sbjct: 2   NLAALAGELRPMLQGSVRVNELMSNHTTWRIGGPADIFIDPVGKEDVQRAVRYARVKGIP 61

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           +T++G GSN+LVRD GIRG+V+++              E+  GA      LA +A R G+
Sbjct: 62  LTVIGNGSNLLVRDGGIRGMVIKIGRGLSDI--TVAGNEIKAGAGAILPELAAAARRAGL 119

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
           GGF F  GIPGS+GGA  MNAGA N   +  +  V  +D +    ++ +E+L + YRSS 
Sbjct: 120 GGFEFAAGIPGSLGGAVVMNAGAMNGCVADVLKSVLVLDERNEFVLLSKEELAFSYRSSL 179

Query: 184 ITKDLI-ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
           + K           G P+ + +I     +    R+++QP      GS FKNP G SA +L
Sbjct: 180 LQKKQYICLETSWVGCPKDRAVIEQETRDYLAKRKSLQPQGWPNAGSVFKNPPGDSAGRL 239

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IE +  +GL  G A++S  H N+++N   AT  D+  L +QV+  V  + G+ L  E++ 
Sbjct: 240 IEAAQGKGLRVGDAEVSPKHANWILNLGQATATDVLSLIKQVQHLVQERFGVALHLEVRV 299

Query: 303 LGD 305
           LG+
Sbjct: 300 LGE 302


>gi|210631756|ref|ZP_03296998.1| hypothetical protein COLSTE_00883 [Collinsella stercoris DSM 13279]
 gi|210159876|gb|EEA90847.1| hypothetical protein COLSTE_00883 [Collinsella stercoris DSM 13279]
          Length = 316

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 91/289 (31%), Positives = 147/289 (50%), Gaps = 7/289 (2%)

Query: 25  FPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAGIRGV 83
            P++  T F+ GG A+VM  P     L   L      ++P+T+VG GS++LV D G+RGV
Sbjct: 28  EPMRDHTTFKIGGPADVMVTPTTPEALVRVLDTCYLGNVPVTVVGNGSDLLVGDRGVRGV 87

Query: 84  VLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMN 143
           V+ L +         +   +   A    + +A +A   G+ G    +GIP ++GGA +MN
Sbjct: 88  VVLLRDNLSEVELDASRWRVTAQAGALLRDVALAAADAGLSGMEPLWGIPATVGGACFMN 147

Query: 144 AGANNCETSQYVVEVHGIDRKGNQHV-----IPREQLKYQYRSSEITKDLIITHV-VLRG 197
           AGA +  T + +  V         +      +    L   YR S +  D +I      + 
Sbjct: 148 AGAYDGTTGEVLESVRAYVPSKQGNRGSVVTLEARDLNMGYRKSRVHDDGLIVISATFKL 207

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P +  ++ AA+ +    RE  QP++  + GSTFK P G+ A +LI  +G RG   G A+
Sbjct: 208 SPSTPAMVRAAMDDYQARREEKQPLEMASAGSTFKRPAGYFAGKLIMDAGLRGARVGDAQ 267

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           +SE HC F++N  +A+  D+  L E V+ +V  Q G+ LE E++ +G+F
Sbjct: 268 VSEKHCGFVVNTGHASAKDVLGLIEHVQSEVKAQFGVDLEPEVRMVGEF 316


>gi|229816069|ref|ZP_04446390.1| hypothetical protein COLINT_03125 [Collinsella intestinalis DSM
           13280]
 gi|229808383|gb|EEP44164.1| hypothetical protein COLINT_03125 [Collinsella intestinalis DSM
           13280]
          Length = 316

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 95/289 (32%), Positives = 151/289 (52%), Gaps = 7/289 (2%)

Query: 25  FPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAGIRGV 83
            P+++ T F+ GG A+V+  P+    L   L    +  +P+TIVG GS++LV D GIRGV
Sbjct: 28  EPMREHTTFKIGGPADVLVTPRTADALVRVLDTCYAGGVPVTIVGNGSDLLVGDRGIRGV 87

Query: 84  VLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMN 143
           V+ L +          H  +   A    + +A +A   G+ G    +GIP ++GGA +MN
Sbjct: 88  VVLLRDNFAGIEVDAPHWRVTAEAGALLRDVALAAADQGLSGMEPLWGIPATVGGACFMN 147

Query: 144 AGANNCETSQYVVEVHGIDRKGNQHV-----IPREQLKYQYRSSEITKDLIITHV-VLRG 197
           AGA +  T + +  V       + +      +    L   YR S +  D +I      + 
Sbjct: 148 AGAYDGTTGEVLEFVRVYVPSKHGNRGSVVTLEARDLNLGYRKSRVHDDGLIVISATFKL 207

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P S+ +I AA+ +    RE  QP++  + GSTFK P G+ A +LI  +G RG   G A+
Sbjct: 208 SPASEGMIRAAMDDYQRRREEKQPLEMASAGSTFKRPEGYFAGKLIMDAGLRGACVGDAQ 267

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           +SE HC F++N   A+  D+  L E V+ +V +Q G+ LE E++ +G+F
Sbjct: 268 VSEKHCGFVVNTGRASAKDVLGLIEHVQGEVKSQFGVDLEPEVRMIGEF 316


>gi|223937419|ref|ZP_03629324.1| UDP-N-acetylenolpyruvoylglucosamine reductase [bacterium Ellin514]
 gi|223893970|gb|EEF60426.1| UDP-N-acetylenolpyruvoylglucosamine reductase [bacterium Ellin514]
          Length = 303

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 100/301 (33%), Positives = 155/301 (51%), Gaps = 5/301 (1%)

Query: 8   RLLRERGKQLRGK--FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           +LL E   ++      + + PL + T  R GGNA+V  +P    +L   L +      PI
Sbjct: 4   QLLTELKSKVSANTILRADEPLAKRTTMRVGGNADVYVEPASETELAQVLQICNRLHAPI 63

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            I+G GSN+LVRD GI GVV+ L +  FS +E   +     GA    K +A  + +H + 
Sbjct: 64  FILGRGSNLLVRDGGIHGVVICLVHPNFSKVEFSGYLM-HCGAGAKLKQVAMDSKKHQLT 122

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPG++GGA  MNAGA    T   V  +  +D  G  H     ++K +YRS  +
Sbjct: 123 GLEFLEGIPGTVGGALRMNAGAMGGWTFDVVESIRYMDYGGEVHEQQATEIKVEYRSCPL 182

Query: 185 TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIE 244
            K  I    VL+G P ++ ++   +      R   QP    + G  FKNP    A +LI+
Sbjct: 183 LKTHIALGAVLKGHPSNREVVEKRLKTFSAKRWESQPA-APSAGCIFKNPGTIPAGKLID 241

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           + G +G   GGA +S+ H NF+IN   AT  D+  L + ++++  ++ G+ LE E++ +G
Sbjct: 242 ELGMKGTRVGGAMVSQEHGNFIINEGQATAKDVLNLIQLIKQRARSERGVELETEVEIVG 301

Query: 305 D 305
           +
Sbjct: 302 E 302


>gi|157692197|ref|YP_001486659.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus pumilus
           SAFR-032]
 gi|167017278|sp|A8FCY2|MURB_BACP2 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|157680955|gb|ABV62099.1| UDP-N-acetylmuramate dehydrogenase [Bacillus pumilus SAFR-032]
          Length = 303

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 93/304 (30%), Positives = 154/304 (50%), Gaps = 7/304 (2%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDI-PI 64
           +  L  E  +   GK  EN PL   T  + GG A+++  P+DI  +K  +  +       
Sbjct: 1   MENLKNELLEAQVGKVLENEPLANHTTMKIGGPADLLIIPKDIDAVKTIMDHVKKHQTNW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNA-GFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           T++G GSN+LV D GIRGVVL+L        +           +     +      + G+
Sbjct: 61  TVIGRGSNLLVLDKGIRGVVLKLGTGLDHLTVNDEEITVGGGYSVVRLATS---LSKQGL 117

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            G  F  GIPGSIGGA YMNAGA+  + S+ +V+   +   G+   +  EQ+ + YR+S 
Sbjct: 118 SGLEFAAGIPGSIGGAVYMNAGAHGSDISKILVKARILFEDGSIEWLTNEQMNFSYRTSV 177

Query: 184 ITKDLI--ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQ 241
           + K+    +   V +   + +  I+  +     +R+  QP      GS F+NP    A Q
Sbjct: 178 LQKERPGIVLEAVFKLKQDDREKITKKMQQNKDYRKETQPYNRPCAGSIFRNPLPEYAGQ 237

Query: 242 LIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIK 301
           L+EK+  +G + GGA+IS++H NF++NA  AT  D+  L + ++KK+     + +  E++
Sbjct: 238 LVEKANLKGYQLGGARISDMHGNFIVNAGGATAQDVLDLIQFIQKKIKEDYNVEMHTEVE 297

Query: 302 RLGD 305
            +G+
Sbjct: 298 IIGE 301


>gi|104773742|ref|YP_618722.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           delbrueckii subsp. bulgaricus ATCC 11842]
 gi|116513741|ref|YP_812647.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           delbrueckii subsp. bulgaricus ATCC BAA-365]
 gi|122275489|sp|Q04BG3|MURB_LACDB RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|123077315|sp|Q1GB18|MURB_LACDA RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|103422823|emb|CAI97475.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           delbrueckii subsp. bulgaricus ATCC 11842]
 gi|116093056|gb|ABJ58209.1| UDP-N-acetylmuramate dehydrogenase [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC BAA-365]
          Length = 297

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 88/287 (30%), Positives = 144/287 (50%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAG 79
            QEN PL + T+ +TGG AE +  P+ + +LK  L     D +PIT++G  SN+++RD G
Sbjct: 13  LQENIPLSRYTFTQTGGPAEYLAFPKTLAELKELLAAAKEDQLPITVIGNASNLIIRDKG 72

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           I+G+V+ L+      +      ++   A       + +A   G+ G  F  GIPGS+GGA
Sbjct: 73  IKGLVIILTEMKEIKV---EADKVHAQAGARIIDTSFAAGEAGLSGLEFAAGIPGSVGGA 129

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR-GF 198
            +MNAGA   ET   +     + R G        +L + YR S + ++  I         
Sbjct: 130 VFMNAGAYGGETKDCLESATVVTRDGEVKTYTNAELHFSYRHSLLQENDEIVIAATFALK 189

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
              +  I   +  +   R   QP++  + GS FK PTGH    ++ K+G +G + GGA++
Sbjct: 190 AGDKATILDQMNYLNALRSYKQPLEYPSCGSVFKRPTGHFVGPMLIKAGLQGKQIGGAQV 249

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           S  H  F++N   AT  D   L   ++K +  + GI L+ E++ +G+
Sbjct: 250 STKHAGFIVNKGGATATDYLNLIHYIQKTIKEKDGIALQTEVRIIGE 296


>gi|20139045|sp|Q92IT8|MURB_RICCN RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
          Length = 295

 Score =  213 bits (542), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 129/292 (44%), Positives = 177/292 (60%), Gaps = 2/292 (0%)

Query: 13  RGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSN 72
               ++G++++++ LK +TWF+ GGNAE+ F+P D  DLK FL      +PI   G GSN
Sbjct: 3   ILPIVKGEYKKDYNLKHLTWFKVGGNAEIFFKPLDSEDLKSFLIQNKQKLPIKTFGAGSN 62

Query: 73  ILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGI 132
           I++RD GI GVV++L     +   V     +IVG+ C   +LA     + I GF F  GI
Sbjct: 63  IIIRDGGIEGVVIKLGQNFSNIEFVD--NHLIVGSSCLNYNLAKFCQANAISGFEFLVGI 120

Query: 133 PGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITH 192
           PG+IGG   MNAGA   E    VV++  ID  GN      E++ ++YRS+ + K+LII  
Sbjct: 121 PGTIGGGVAMNAGAYGSEFKDIVVQIEAIDFAGNFLTFTNEEIGFKYRSNNLPKNLIILK 180

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
            V +        I   +  + + R + QPIKE+TGGSTF NP G  +W+LI+K+G RG  
Sbjct: 181 AVFKINKGDSENILLRMNEIKNARSSTQPIKERTGGSTFANPEGRKSWELIDKAGLRGYR 240

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            GGA +SE HCNFMIN  +AT  DLE LG+ VR+KV   SG+ LEWEIKR+G
Sbjct: 241 IGGASMSEFHCNFMINNGDATAKDLEDLGDFVRQKVCEDSGVKLEWEIKRIG 292


>gi|309390055|gb|ADO77935.1| UDP-N-acetylmuramate dehydrogenase [Halanaerobium praevalens DSM
           2228]
          Length = 308

 Score =  213 bits (542), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 92/311 (29%), Positives = 156/311 (50%), Gaps = 8/311 (2%)

Query: 1   MIYGRISRLLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFL-TLL 58
           M Y      L ++ K +   + +    L     F+ GG A++   P++I  L+  +  + 
Sbjct: 1   MNYQAHINSLTKKLKNINSLQVETKVKLADYCSFKVGGPADLFLTPKNIASLQKIMPVIY 60

Query: 59  PSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSA 118
            S +P  I+G GSN+++ D G R     +   G  N        +          LA+ A
Sbjct: 61  KSQLPYFILGKGSNLIISDKGYR---GIIIYTGQLNKFQVKENLITAQTGIKLSELADIA 117

Query: 119 LRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQ 178
            ++ +GGF F  GIPG++GGA YMNAGA   E    + + + I++KG    + ++ L+  
Sbjct: 118 CQNNLGGFEFAAGIPGTLGGALYMNAGAYGGEIKDIIKKANLINKKGEIETLTKKDLELS 177

Query: 179 YRSSEITKDLIITHV---VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPT 235
           YR+S + K           ++    +Q  I+A +  +   R T QP++  + GS FK P 
Sbjct: 178 YRNSLLQKQSQKLIAVSLEIKLEITAQEQITAKMEELHQKRWTKQPMELPSAGSIFKRPP 237

Query: 236 GHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGIL 295
            +    LIE++  +G + GGA++S  H  F++N  NAT  D+  L  +V+K+V+ +SGI 
Sbjct: 238 NNYTGPLIEQAELKGYQIGGAQVSTKHAGFIVNKGNATAEDIVNLINKVKKEVYKKSGIQ 297

Query: 296 LEWEIKRLGDF 306
           L+ E + LG+F
Sbjct: 298 LKVEPRFLGEF 308


>gi|229135907|ref|ZP_04264670.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           BDRD-ST196]
 gi|228647549|gb|EEL03621.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           BDRD-ST196]
          Length = 305

 Score =  213 bits (542), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 87/307 (28%), Positives = 147/307 (47%), Gaps = 7/307 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    + + L     +  G  +++  LK  T  + GG A+V   P +  +++  +     
Sbjct: 1   MNMHEVYKYLSTVLPE--GHVKQDEMLKNHTHIKVGGKADVFVSPTNYDEIQEVIKYANQ 58

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +IP+T +G GSN++++D G+RG+ + L               ++     +   ++  AL
Sbjct: 59  YNIPVTFLGNGSNVIIKDGGLRGITVSLI---HITGVTVTGTTIVAQCGAAIIDVSRIAL 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            H + G  F  GIPGS+GGA YMNAGA   E S  + E   +   G    + +E  ++ Y
Sbjct: 116 DHNLTGLEFACGIPGSVGGALYMNAGAYGGEVSFVLTEAVVMTGDGELRTLTKEAFEFGY 175

Query: 180 RSSEITKDLII-THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S    +  I            +  I   + ++   RE+ QP++  + GS FK P  + 
Sbjct: 176 RKSVFANNHYIILEARFELQEGVREEIKEKMDDLTFKRESKQPLEYPSCGSVFKRPPNNF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI++SG +G   GG ++S  H  FM+N DN T  D   L   V+K V  + G+ LE 
Sbjct: 236 AGKLIQESGLQGKRIGGVEVSLKHAGFMVNVDNGTAQDYIDLIHFVQKTVEEKFGVKLER 295

Query: 299 EIKRLGD 305
           E++ +G+
Sbjct: 296 EVRIIGE 302


>gi|172056590|ref|YP_001813050.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Exiguobacterium
           sibiricum 255-15]
 gi|254764183|sp|B1YJK3|MURB_EXIS2 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|171989111|gb|ACB60033.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Exiguobacterium
           sibiricum 255-15]
          Length = 304

 Score =  213 bits (542), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 100/307 (32%), Positives = 155/307 (50%), Gaps = 7/307 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-P 59
           M+  ++   L E   +       N PLK  T+ + GG A++   P    +  + +     
Sbjct: 1   MMTEQLLAGLYEGIAK--EAVLINEPLKNHTYTKMGGLADLFLIPSTYEETAFAVRYAYE 58

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            D+P+T++G GSN++VRD GIRG+VL        ++      E+I  +  +    +  A 
Sbjct: 59  HDLPLTMLGNGSNLVVRDGGIRGIVLSFEKLTDISV---EGHELIAQSGAAIIQASRIAY 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            H + G  F  GIPG+IGGA  MNAGA   E    +     + RKG    I  E+L+  Y
Sbjct: 116 DHALSGLEFACGIPGTIGGALIMNAGAYGGEVKDCLHSATVLTRKGELLNISHEELELGY 175

Query: 180 RSSEI-TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R+S    K+ II             +I   + ++ H RET QP++  + GS FK P G+ 
Sbjct: 176 RTSCFSKKEYIILEGRFSLTEGDPALIKEMMDDLTHKRETKQPLEYPSCGSVFKRPEGYF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI+ SG +G   GGA++S+ H  F++N  +AT  D   L   V++ V  + GILLE 
Sbjct: 236 AGKLIQDSGLQGARIGGAEVSQKHAGFIVNIKDATATDYISLIRHVQETVQEKFGILLEP 295

Query: 299 EIKRLGD 305
           E+K +G+
Sbjct: 296 EVKIIGE 302


>gi|322387534|ref|ZP_08061143.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus infantis ATCC
           700779]
 gi|321141401|gb|EFX36897.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus infantis ATCC
           700779]
          Length = 304

 Score =  213 bits (542), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 97/302 (32%), Positives = 150/302 (49%), Gaps = 6/302 (1%)

Query: 7   SRLLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPI 64
             +L +  + L G   + N PLK  T+ + GG A+ +  P + +++   +      +I  
Sbjct: 4   MTVLDKLKETLEGIDIRFNEPLKTYTYTKVGGKADYLAFPSNHYEMARVVKFANQENISW 63

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G  SNI+VR+ GIRG V+        ++   +   +   A  +       ALRH + 
Sbjct: 64  MVLGNASNIIVREGGIRGFVIMCDKLNNVSV---DGYTIEAEAGANLIETTRIALRHSLT 120

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           GF F  GIPGS+GGA +MNAGA   E S  +     + + G    +  + L + YR S I
Sbjct: 121 GFEFACGIPGSVGGAVFMNAGAYGGEISNILQSCKVLTKDGEIETLSAKDLAFGYRHSAI 180

Query: 185 TK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
                ++        P +   I+  +  + H RE  QP++  + GS FK P GH A QLI
Sbjct: 181 QDSGAVVLSAKFALSPGNYETINQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLI 240

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
            ++G +G   GG ++SE H  FMIN  + T  D E L E V +KV   SG+ LE E++ L
Sbjct: 241 SEAGLKGYRIGGVEVSEKHAGFMINVADGTARDYEDLIESVIEKVKEHSGVTLEREVRIL 300

Query: 304 GD 305
           G+
Sbjct: 301 GE 302


>gi|313608807|gb|EFR84608.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes FSL F2-208]
          Length = 298

 Score =  213 bits (542), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 100/288 (34%), Positives = 151/288 (52%), Gaps = 5/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDA 78
           + + N PL + T+ +TGG A+V   P+ I + +  +     + I +TI+G GSN++++D 
Sbjct: 12  EIKLNEPLSKYTYTKTGGEADVFVMPKTIEEAQEVVAYCHQNKISLTILGNGSNLIIKDG 71

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIRGV+L L          RN+ ++I  +       A  AL   + G  F  GIPGSIGG
Sbjct: 72  GIRGVILHLDLLQTI---ERNNTQIIAMSGAKLIDTAKFALDESLSGLEFACGIPGSIGG 128

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLRG 197
           A +MNAGA   E S  +     + + G    + R +LK  YR S I  K+ I+       
Sbjct: 129 ALHMNAGAYGGEISDVLEAATVLTQTGELKKLKRSELKAAYRFSTIAEKNYIVLDATFSL 188

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
             E +N+I A +  +   RE  QP++  + GS FK P GH A +LI+ SG +G   GGA+
Sbjct: 189 ALEEKNLIQAKMDELTAAREAKQPLEYPSCGSVFKRPPGHFAGKLIQDSGLQGHIIGGAQ 248

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S  H  F++N   AT  D   L   V+K V  +  + LE E+K +G+
Sbjct: 249 VSLKHAGFIVNIGGATATDYMNLIAYVQKTVREKFDVELETEVKIIGE 296


>gi|322516298|ref|ZP_08069227.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus vestibularis ATCC
           49124]
 gi|322125230|gb|EFX96606.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus vestibularis ATCC
           49124]
          Length = 309

 Score =  213 bits (542), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 94/302 (31%), Positives = 147/302 (48%), Gaps = 6/302 (1%)

Query: 7   SRLLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPI 64
           + +L E  + L G   + + PLK  T+ + GG A+ +  P++ ++L   +      DIP 
Sbjct: 8   NNMLDELKEDLVGIDIRFDEPLKGYTYTKVGGPADYLAFPRNRYELSRIVKFANKHDIPW 67

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G  SN++VRD GIRG V+         +   N  ++   A  +  +    A    + 
Sbjct: 68  MVLGNASNLIVRDGGIRGFVIMFDKLNGIAV---NGYQVEAEAGANLIATTKVARFQSLT 124

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           GF F  GIPGSIGGA +MNAGA   E +  +V    + + G    I    +++ YR S +
Sbjct: 125 GFEFAAGIPGSIGGAVFMNAGAYGGEIAHILVSAQVLTKDGEIRTIDARDMRFGYRRSVL 184

Query: 185 TK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            +   ++        P     I   +  + H RE  QP++  + GS FK P GH A QLI
Sbjct: 185 QETGEVVISAKFNLKPGDYEQIKNEMNRLNHLRELKQPLEYPSCGSVFKRPLGHFAGQLI 244

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
            ++  +G   GG ++S  H  FM+N +  T  D E L   V  KV   SG+ LE E++ +
Sbjct: 245 MEANLKGHRIGGVEVSTKHAGFMVNVNQGTAKDYEDLIADVIAKVKENSGVTLEPEVRII 304

Query: 304 GD 305
           GD
Sbjct: 305 GD 306


>gi|257439797|ref|ZP_05615552.1| UDP-N-acetylmuramate dehydrogenase [Faecalibacterium prausnitzii
           A2-165]
 gi|257197706|gb|EEU95990.1| UDP-N-acetylmuramate dehydrogenase [Faecalibacterium prausnitzii
           A2-165]
          Length = 312

 Score =  213 bits (542), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 98/307 (31%), Positives = 142/307 (46%), Gaps = 13/307 (4%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVG 68
           L+++ +    +F EN  L     F+ GG A+V  +P+    L   + L  + D+   ++G
Sbjct: 4   LKQQLQAEEIRFAENESLAAHCTFKIGGPADVFARPETEEQLCRVIALCKACDVKYYLLG 63

Query: 69  LGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEM-----------IVGARCSGKSLANS 117
            GSNIL  D G RGVV+  +        + N               I GA     +L  +
Sbjct: 64  NGSNILFEDGGYRGVVVDTTALKMGIGFLENVSHPGAEPGAVYDAVIAGAGLKLSALCKA 123

Query: 118 ALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKY 177
           AL   + G  F YGIPG++GGA YMNAGA   E    +V V  + R+G         L  
Sbjct: 124 ALDSSLTGLEFAYGIPGTVGGAVYMNAGAYGGEMKDVLVSVTYLTREGEIVTEDAANLDL 183

Query: 178 QYRSSEITKDL-IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTG 236
            YR S   ++   I              I A +  +   R   QP+ + + GSTFK P G
Sbjct: 184 SYRHSIFEENGGCILSAKFHLKRGDSAAIKARMDELMQKRIDKQPLDKPSAGSTFKRPVG 243

Query: 237 HSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILL 296
             A  LI++ G RG   GGA +SE HC F++N   AT  D+  L ++VR  V  ++G  L
Sbjct: 244 AFAAALIDQCGLRGYRHGGAAVSEKHCGFVVNLGGATCADVLALCDEVRAVVKEKTGYDL 303

Query: 297 EWEIKRL 303
           E EI+ +
Sbjct: 304 EKEIRVV 310


>gi|228993788|ref|ZP_04153693.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           pseudomycoides DSM 12442]
 gi|228765999|gb|EEM14648.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           pseudomycoides DSM 12442]
          Length = 305

 Score =  213 bits (542), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 87/307 (28%), Positives = 149/307 (48%), Gaps = 7/307 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-P 59
           M    + + LR    +     +++  LK  T  + GG A+V  QP    +++  +     
Sbjct: 1   MNMQEVYKYLRTVLPE--EHVKQDEMLKNHTHIKVGGKADVFVQPTTYTEIQQVVQYANK 58

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +IPIT +G GSN++++D GIRG+ L L++     +  +        +  +   ++  AL
Sbjct: 59  HNIPITFLGNGSNVIIKDGGIRGITLSLTHITDVTVNEQTIV---AQSGAAIIDISRIAL 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            H + G  F  GIPGS+GGA YMNAGA   E +  + +   + ++G    + ++   + Y
Sbjct: 116 EHSLTGLEFACGIPGSVGGALYMNAGAYGGEVAYVLTKAVVMTKEGELITLSKDDFDFGY 175

Query: 180 RSSEITKDLII-THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S    +  I               I   + ++ + RE+ QP++  + GS FK P  + 
Sbjct: 176 RKSRFANNHYIILEATFELENGVYEEIKEKMDDLTYKRESKQPLEYPSCGSVFKRPPNNF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI+ S  +G   GG ++S  H  FM+N DN T  D   L   V+K V  + G+ LE 
Sbjct: 236 AGKLIQDSELQGTRIGGVEVSTKHAGFMVNVDNGTAQDYIDLIHFVQKTVKEKFGVTLER 295

Query: 299 EIKRLGD 305
           E++ +G+
Sbjct: 296 EVRIIGE 302


>gi|163868711|ref|YP_001609923.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella
           tribocorum CIP 105476]
 gi|187609724|sp|A9IWA3|MURB_BART1 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|161018370|emb|CAK01928.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella
           tribocorum CIP 105476]
          Length = 327

 Score =  213 bits (542), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 157/299 (52%), Positives = 211/299 (70%)

Query: 16  QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILV 75
            +RGK   N  ++++TWFRTGG AE+ +QP D  DL  FL  LP  +P+TIVG+GSN+LV
Sbjct: 24  NIRGKLTPNVEMRKVTWFRTGGLAELFYQPVDEEDLALFLHNLPECVPVTIVGIGSNLLV 83

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD G+ GVV+RLS   F  ++  +    +VGA  + K LA +AL+  I GFHF++GIPG 
Sbjct: 84  RDGGVPGVVIRLSPKNFGQVQQVSSKGFLVGAGTADKHLAAAALKAEIAGFHFYHGIPGG 143

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           +GGA  MNAGAN  ET+  VVEV+ +DRKG +H++  + + Y YR  +I +D I T  +L
Sbjct: 144 LGGALKMNAGANGVETAARVVEVYALDRKGQRHILSLKDMHYSYRHCDIPEDFIFTAALL 203

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
            G P +++ I AA+  V  HRETVQPI+EKTGGSTFKNP   SAW++I+++GCRGL+ GG
Sbjct: 204 EGEPGNKDAIRAAMDEVALHRETVQPIREKTGGSTFKNPKDTSAWRVIDEAGCRGLQIGG 263

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFDHQIVDA 314
           A++SE+HCNFMIN   ATGYDLE LGE VR +VF  S  LL+WEI+R+G F   + V +
Sbjct: 264 AQMSEMHCNFMINTGQATGYDLEALGETVRARVFAHSAHLLQWEIERIGQFEQGRSVAS 322


>gi|240850890|ref|YP_002972290.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella grahamii
           as4aup]
 gi|240268013|gb|ACS51601.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bartonella grahamii
           as4aup]
          Length = 327

 Score =  213 bits (542), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 157/290 (54%), Positives = 209/290 (72%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RGK   N  ++++TWFRTGG AE+ +QP D  DL  FL  LP  +P+TIVG+GSN+LVR
Sbjct: 25  VRGKLTPNVEMRKVTWFRTGGLAELFYQPVDEQDLALFLQNLPEFVPVTIVGIGSNLLVR 84

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ GVV+RLS   F  ++  +    +VGA  + K LA +AL+ GI GFHF++GIPG++
Sbjct: 85  DGGVPGVVIRLSPKNFGQVQQVSPKGFLVGAGTADKHLAVAALKAGIAGFHFYHGIPGAL 144

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAGAN  ET+  VVEV+ +DRKG +H++  + + Y YR  +I KD I T  +L 
Sbjct: 145 GGALKMNAGANGIETAARVVEVYALDRKGQRHILSLKDMHYSYRHCDIPKDFIFTAALLE 204

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
           G   +++ I AA+  V  HRETVQPI+EKTGGSTFKNP   SAW++I+++GCRGL+ GGA
Sbjct: 205 GKLGNKDDIRAAMDEVSLHRETVQPIREKTGGSTFKNPENGSAWRVIDEAGCRGLQIGGA 264

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           ++SE+HCNFMIN   ATGYDLE LGE VR +VF  S  LL+WEI+R+G F
Sbjct: 265 QMSEMHCNFMINTGQATGYDLEALGETVRARVFANSAHLLQWEIERIGQF 314


>gi|288553160|ref|YP_003425095.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           pseudofirmus OF4]
 gi|288544320|gb|ADC48203.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           pseudofirmus OF4]
          Length = 305

 Score =  213 bits (542), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 89/301 (29%), Positives = 152/301 (50%), Gaps = 4/301 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           +  ++++  ++  G  + + PL Q T ++ GG A+V+ +P +I  L   + ++    +P 
Sbjct: 1   MEHVIQKLKEKEVGTIKVSEPLSQHTTWKIGGPADVLVEPANIEGLINTMEIVKEAGVPW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
             +G GSN+LV D GI GVV++L               + VG       L     R G+ 
Sbjct: 61  RAIGRGSNLLVSDEGIEGVVIKLGKGLDHLEIDDEE--ITVGGGYPLIKLVTIISRQGLS 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA +MNAGA+  E +  +++   +   G    I    +++ YR+S +
Sbjct: 119 GLEFAGGIPGSVGGAVFMNAGAHGAEVADILIKARVLYPDGRLEWIKGSDMQFSYRTSRL 178

Query: 185 -TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
             +  I    V +     +  I   +     +R   QP    T GS F+NP  + A  LI
Sbjct: 179 QHEKGICVEAVFKLKKGEKEEIVKHMQKNKDYRRETQPWSHPTCGSVFRNPLPNHAGALI 238

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           E++G +G + GGA+IS++H NF++N DNA   D+  L +  ++ +    GI +E E++ +
Sbjct: 239 EEAGLKGYQIGGAQISDMHANFIVNVDNAKAEDVLNLIKHAKETIKESKGIEMETEVEMI 298

Query: 304 G 304
           G
Sbjct: 299 G 299


>gi|210621614|ref|ZP_03292727.1| hypothetical protein CLOHIR_00672 [Clostridium hiranonis DSM 13275]
 gi|210154679|gb|EEA85685.1| hypothetical protein CLOHIR_00672 [Clostridium hiranonis DSM 13275]
          Length = 311

 Score =  213 bits (542), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 102/290 (35%), Positives = 156/290 (53%), Gaps = 4/290 (1%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVR 76
           +     + P+K+   FR GG A+V+ +P++   LK  L  +   +IP  ++G GSN+LV+
Sbjct: 16  KENIMMDEPMKKHASFRVGGPADVLVRPRNEEHLKDILLYIKKENIPYLVIGNGSNLLVK 75

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D GIRG+V+ +S+             + + A      + N+AL+  + GF F  GIPGS 
Sbjct: 76  DGGIRGIVVEISDNYSDFKIDE--NRIEIQAGALLSRIGNAALKAELKGFEFASGIPGSF 133

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVL 195
           GGA  MNAGA   E    V  V  +D  GN   +  E++ + YR S I  K+ I    V+
Sbjct: 134 GGALAMNAGAYGGEIKDIVKTVKVMDIDGNIFELSNEEMNFGYRKSAIVEKNYIALSAVV 193

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
                S + I A + ++   R + QP+   + GSTFK P G+ A +LI+ SG +GL  G 
Sbjct: 194 ELEKGSYDDIKATMDDLKERRTSKQPLNFASAGSTFKRPEGYFAGKLIQDSGLKGLSIGD 253

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           A++SE H  F+IN  NAT  +L  L   V+  V  + G++LE E+K +G+
Sbjct: 254 AQVSEKHSGFVINRGNATAKELLDLMFAVKATVNAKFGVMLEEEVKIVGE 303


>gi|47095371|ref|ZP_00232981.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes str. 1/2a F6854]
 gi|254827708|ref|ZP_05232395.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes FSL N3-165]
 gi|254898414|ref|ZP_05258338.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes J0161]
 gi|254912095|ref|ZP_05262107.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes J2818]
 gi|254936422|ref|ZP_05268119.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes F6900]
 gi|47016192|gb|EAL07115.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes str. 1/2a F6854]
 gi|258600087|gb|EEW13412.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes FSL N3-165]
 gi|258609014|gb|EEW21622.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes F6900]
 gi|293590063|gb|EFF98397.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Listeria
           monocytogenes J2818]
          Length = 298

 Score =  213 bits (542), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 98/287 (34%), Positives = 150/287 (52%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAG 79
            + N PL + T+ +TGG A+V   P+ I + +  +     + IP+TI+G GSN++++D G
Sbjct: 13  IKLNEPLSKYTYTKTGGAADVFVMPKTIEEAQEVVAYCHQNKIPLTILGNGSNLIIKDGG 72

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRGV+L L          RN+ +++  +       A  AL   + G  F  GIPGSIGGA
Sbjct: 73  IRGVILHLDLLQTI---ERNNTQIVAMSGAKLIDTAKFALNESLSGLEFACGIPGSIGGA 129

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD-LIITHVVLRGF 198
            +MNAGA   E S  +     + + G    + R +LK  YR S I +   I+        
Sbjct: 130 LHMNAGAYGGEISDVLEAATVLTQTGELKKLKRSELKAAYRFSTIAEKSYIVLDATFSLA 189

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
            E +N+I A +  +   RE  QP++  + GS FK P GH A +LI+ SG +G   GGA++
Sbjct: 190 LEEKNLIQAKMDELTAAREAKQPLEYPSCGSVFKRPPGHFAGKLIQDSGLQGHIIGGAQV 249

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           S  H  F++N   AT  D   L   V++ V  +  + LE E+K +G+
Sbjct: 250 SLKHAGFIVNIGGATATDYMNLIAYVQQTVREKFDVELETEVKIIGE 296


>gi|291518009|emb|CBK73230.1| UDP-N-acetylmuramate dehydrogenase [Butyrivibrio fibrisolvens 16/4]
          Length = 287

 Score =  213 bits (542), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 98/283 (34%), Positives = 149/283 (52%), Gaps = 3/283 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIRG 82
           + P+K  T FR GG A++  +P  I+ +   +  L   D P  ++G GSN+L+ D GI G
Sbjct: 2   DEPMKTHTTFRIGGPADIYVEP-SIYQMVPLIAYLREIDAPFMVIGNGSNLLISDDGIEG 60

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           VV+ L  A    +   +   ++  A     S+AN A   G+ G  F  GIPG+IGGA YM
Sbjct: 61  VVVALGKAMSEIVIDESTQTVVAAAGAMLSSVANRAAEAGLTGLEFASGIPGTIGGAIYM 120

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHV-VLRGFPES 201
           NAGA   E    +V    ++  G    I  + L   YR S + ++  I     L+    +
Sbjct: 121 NAGAYGGEMKDVIVSATILEGNGELKEIYVDDLDLSYRHSALMENEWIVISAKLQLAAGN 180

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
            + I A IA++   R   QP+   + GSTFK P G+ A +LI+ +G RG   GGA++SE 
Sbjct: 181 VDEIKATIADIRDKRIEKQPLNFPSAGSTFKRPEGYFAGKLIDDAGLRGYTVGGAQVSEK 240

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           HC F+IN  +AT  D+  L + V + V+ + G+ L  E++ +G
Sbjct: 241 HCGFVINKSDATASDVLQLMKNVDQIVYEKFGVHLTPEVRIIG 283


>gi|169824783|ref|YP_001692394.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Finegoldia magna
           ATCC 29328]
 gi|167831588|dbj|BAG08504.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Finegoldia magna
           ATCC 29328]
          Length = 301

 Score =  213 bits (541), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 92/288 (31%), Positives = 144/288 (50%), Gaps = 4/288 (1%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRD 77
           G+   + P+K  T F+ GGN +VM  PQ+   +   L L+  +D    I+G GSN+LV D
Sbjct: 14  GEILYDEPMKNHTTFKIGGNCDVMIFPQNEEQIINSLQLIKQNDFAYRIIGNGSNLLVSD 73

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G+R VV++L +         +   +I  +     S++  A+ +   GF    GIPG IG
Sbjct: 74  DGLREVVIKLHDNFNEI--RIDGDLLIAQSGALLSSVSKLAINNSYAGFEAVSGIPGDIG 131

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL-IITHVVLR 196
           GA  MNAGA   E    V  V  ID       +  +++ + YR S +  +  ++  V   
Sbjct: 132 GAITMNAGAYGTEMKDIVHRVKVIDTDLKVKYLNCDEMDFSYRHSRVQDEKLVVLEVEFI 191

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
                Q  I     +    R + QP++  + GS FK P GH A QLI+++G RG  +  A
Sbjct: 192 LKKGDQKEILDNFHDYTERRTSKQPLELPSCGSVFKRPEGHFAGQLIDEAGLRGYRYNDA 251

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            +SE HC F++N  +A   D+  + E V+K VF +  + LE E++ +G
Sbjct: 252 MVSEKHCGFIVNVGDAKCSDVVAVIEHVQKVVFEKFNVKLEPEVRIIG 299


>gi|56419453|ref|YP_146771.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus
           kaustophilus HTA426]
 gi|81347827|sp|Q5L1H7|MURB_GEOKA RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|56379295|dbj|BAD75203.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus
           kaustophilus HTA426]
          Length = 304

 Score =  213 bits (541), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 103/306 (33%), Positives = 157/306 (51%), Gaps = 11/306 (3%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS- 60
           IY R+  +  ER          + P+K  T  R GG A+ +  P+    +   L L    
Sbjct: 7   IYQRLVEICGER------NVLRDEPMKNHTLVRIGGKADFLVWPETYEQVIEVLRLKEEY 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
            +P T++G GSN+++RD G+RG+V++L +        R    +I  +    K+++  AL 
Sbjct: 61  GLPFTLLGNGSNVIIRDGGLRGIVMQLKHLNRIW---REGNNVIAQSGADIKAVSRFALE 117

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             + G  F  GIPGS+GGA  MNAGA   E    +  V      G    +  E+L+  YR
Sbjct: 118 QHLTGLEFACGIPGSVGGAIMMNAGAYGGEVKDVLDHVKVATLSGELKTLKNEELELGYR 177

Query: 181 SSEITK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
           +S I++   I+  VV    P     I A + ++   RE+ QP++  + GS FK P G+ A
Sbjct: 178 TSLISRTHDIVLEVVFALRPGDYAQIKAKMDDLTFQRESKQPLEYPSVGSVFKRPPGYFA 237

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LI+ SG +G  FGGA++S  H  F+IN +NAT  D     E VRK V  + G+ LE E
Sbjct: 238 GKLIQDSGLQGKGFGGAEVSTKHAGFIINKNNATAADYIATIEMVRKTVKEKFGVDLELE 297

Query: 300 IKRLGD 305
           +K +G+
Sbjct: 298 VKIIGE 303


>gi|327469460|gb|EGF14929.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis SK330]
          Length = 301

 Score =  213 bits (541), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 97/302 (32%), Positives = 151/302 (50%), Gaps = 6/302 (1%)

Query: 7   SRLLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPI 64
            + L +   +L G   + N PL Q T+ + GG A+ +  P++ ++L   +      DIP 
Sbjct: 1   MQKLEKLKTELEGIDIRFNEPLSQYTYTKVGGAADFLVFPRNRYELARIVNFANQEDIPW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G  SNI+VRD GIRG V+         +   +   +   A  +     + AL++ + 
Sbjct: 61  MVLGNASNIIVRDGGIRGFVIMFDKLNNVAV---DGYMIEAEAGANLIQTTHIALQNSLT 117

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           GF F  GIPGS+GGA +MNAGA   E +  +V    +  +G    +    +K+ YR+S +
Sbjct: 118 GFEFACGIPGSVGGAVFMNAGAYGGEIAHVLVSCKVLTPQGQVKTLDVRDMKFGYRNSLV 177

Query: 185 TK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            +   I+        P     I   +  + H RE  QP++  + GS FK P G+ A QLI
Sbjct: 178 QETGDIVISAKFALSPGVHRTIRQEMERLTHLRELKQPLEYPSCGSVFKRPLGYFAGQLI 237

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
            ++G +G   GG ++SE H  FMIN D  T  D E L   V  +V   SGI LE E++ +
Sbjct: 238 SEAGLKGHRIGGVEVSEKHAGFMINVDKGTAQDYENLIAHVIGRVRENSGITLEREVRII 297

Query: 304 GD 305
           G+
Sbjct: 298 GE 299


>gi|308271442|emb|CBX28050.1| UDP-N-acetylenolpyruvoylglucosamine reductase [uncultured
           Desulfobacterium sp.]
          Length = 316

 Score =  213 bits (541), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 93/317 (29%), Positives = 147/317 (46%), Gaps = 15/317 (4%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKY-FLTLLP 59
           M+  +  R  +        K + + P+ + T+F+ GG AEV   P+ I  L    L  + 
Sbjct: 1   MMLDQDMR--KWFANYFGSKVRFDEPMSKHTYFKVGGPAEVFVAPESIEQLAELILWSVE 58

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNH---CEMIVGARCSGKSLAN 116
            ++P  + G GSN+LV D GI+G+V+ L+        V+       +   A    + L  
Sbjct: 59  KNVPYIVAGDGSNLLVSDKGIKGIVIVLTKCLNRIFRVKEEKESVIIKAMAGTRTQELCR 118

Query: 117 SALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLK 176
            A+  G+ G +F  GIPG++GGA  MNAG +    S  +  V+ +   G+   I +  + 
Sbjct: 119 FAIDEGLSGLNFALGIPGTVGGAIMMNAGTSTGTISDILESVNVMAASGDILKIEKADID 178

Query: 177 YQYRSSEI--------TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGG 228
           + YRS            +D +I     R        +      +   R   QP      G
Sbjct: 179 FSYRSLIWKRKINISGNEDPVILEGTFRLGKSDTLELKKEAQVILKKRNESQPTGLPCAG 238

Query: 229 STFKNPT-GHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKK 287
             FKNPT G +A QLI+ +G +G   GG+ ISE H NF++N  NA+  D+  L + V+  
Sbjct: 239 CFFKNPTSGKTAGQLIDMAGLKGTRIGGSNISERHANFIVNTGNASASDILALMQLVQNT 298

Query: 288 VFNQSGILLEWEIKRLG 304
           VF +  I L+ E+K +G
Sbjct: 299 VFEKFNINLQPEVKIVG 315


>gi|241894743|ref|ZP_04782039.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Weissella
           paramesenteroides ATCC 33313]
 gi|241871955|gb|EER75706.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Weissella
           paramesenteroides ATCC 33313]
          Length = 298

 Score =  213 bits (541), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 94/300 (31%), Positives = 146/300 (48%), Gaps = 6/300 (2%)

Query: 7   SRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPIT 65
            ++L E         Q N  L   T  R GG A+  F P+   +L+  +      D+PIT
Sbjct: 1   MKMLNEMFPSY--NIQANVNLGDYTNTRVGGPADWCFWPKTQQELQQVVHFANETDLPIT 58

Query: 66  IVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGG 125
           ++G  SN+++ D G +GVV+ L++     IEV     +   A      +A  A  + + G
Sbjct: 59  VLGNASNLVITDDGRQGVVIFLTDMHQ--IEVFKKNSITAEAGAWIIEVAQVAYDYSLTG 116

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT 185
             +  GIPGSIGGA +MNAGA   +  Q +  V  I   G        +L + YR S + 
Sbjct: 117 LEWAAGIPGSIGGAVFMNAGAYGGQIDQVLQSVDVITPVGEIKTYSAAELAFGYRHSLVQ 176

Query: 186 K-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIE 244
           +   +I        P  ++ I   +A+    R   QP++  + GS FK PTG+ A +LI 
Sbjct: 177 ETGDVIIRATFTMQPGKRSEIGEKMADFNTRRAQKQPLEFPSCGSVFKRPTGYFAGKLIM 236

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            SG +G + GGA++S  H  F++N   ATG D   L + V+  V+ +  + LE E++ LG
Sbjct: 237 DSGLQGYQIGGAQVSTKHAGFIVNRGQATGSDYVQLIKHVQDVVYEKFSVNLETEVRVLG 296


>gi|49482995|ref|YP_040219.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus MRSA252]
 gi|257424858|ref|ZP_05601285.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus 55/2053]
 gi|257427526|ref|ZP_05603925.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus 65-1322]
 gi|257430157|ref|ZP_05606541.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus 68-397]
 gi|257432858|ref|ZP_05609218.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus E1410]
 gi|257435762|ref|ZP_05611810.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus M876]
 gi|282903368|ref|ZP_06311259.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus C160]
 gi|282905148|ref|ZP_06313005.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus Btn1260]
 gi|282908124|ref|ZP_06315955.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus WW2703/97]
 gi|282910383|ref|ZP_06318187.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus WBG10049]
 gi|282913578|ref|ZP_06321367.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus M899]
 gi|282918531|ref|ZP_06326268.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus C427]
 gi|282923497|ref|ZP_06331177.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus C101]
 gi|283957570|ref|ZP_06375023.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus A017934/97]
 gi|293500623|ref|ZP_06666474.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus 58-424]
 gi|293509571|ref|ZP_06668282.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus M809]
 gi|293524157|ref|ZP_06670844.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus M1015]
 gi|295427315|ref|ZP_06819950.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus EMRSA16]
 gi|297590332|ref|ZP_06948971.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus MN8]
 gi|56749243|sp|Q6GIQ3|MURB_STAAR RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|49241124|emb|CAG39802.1| putative UDP-N-acetylenolpyruvoylglucosamine reductase
           [Staphylococcus aureus subsp. aureus MRSA252]
 gi|257272428|gb|EEV04551.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus 55/2053]
 gi|257275719|gb|EEV07192.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus 65-1322]
 gi|257279354|gb|EEV09955.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus 68-397]
 gi|257282273|gb|EEV12408.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus E1410]
 gi|257284953|gb|EEV15072.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus M876]
 gi|282314365|gb|EFB44755.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus C101]
 gi|282317665|gb|EFB48037.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus C427]
 gi|282322610|gb|EFB52932.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus M899]
 gi|282325775|gb|EFB56083.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus WBG10049]
 gi|282327789|gb|EFB58071.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus WW2703/97]
 gi|282331555|gb|EFB61067.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus Btn1260]
 gi|282596323|gb|EFC01284.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus C160]
 gi|283791021|gb|EFC29836.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus A017934/97]
 gi|290921120|gb|EFD98181.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus M1015]
 gi|291095628|gb|EFE25889.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus 58-424]
 gi|291467668|gb|EFF10183.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus M809]
 gi|295128703|gb|EFG58334.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           aureus subsp. aureus EMRSA16]
 gi|297576631|gb|EFH95346.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus MN8]
 gi|312438837|gb|ADQ77908.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus aureus subsp.
           aureus TCH60]
 gi|315194357|gb|EFU24749.1| putative UDP-N-acetylenolpyruvoylglucosamine reductase
           [Staphylococcus aureus subsp. aureus CGS00]
          Length = 307

 Score =  213 bits (541), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 97/307 (31%), Positives = 161/307 (52%), Gaps = 7/307 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-P 59
           MI   I + L++       K + + PLK+ T+ +TGGNA+    P    +++  +     
Sbjct: 1   MINKDIYQALQQLIPN--EKIKVDEPLKRYTYTKTGGNADFYITPTKNVEVQAVVKYAYQ 58

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
           ++IP+T +G GSNI++R+ GIRG+V+ L +     +       +I G+  +   ++  A 
Sbjct: 59  NEIPVTYLGNGSNIIIREGGIRGIVISLLSLDHIEVSDDA---IIAGSGAAIIDVSRVAR 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            + + G  F  GIPGSIGGA YMNAGA   E    +     ++ +G+   +  ++L+  Y
Sbjct: 116 DYALTGLEFACGIPGSIGGAVYMNAGAYGGEVKDCIDYALCVNEQGSLVKLTTKELELDY 175

Query: 180 RSSEITKDL-IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R+S I K+  ++        P     I A + ++   RE+ QP++  + GS F+ P GH 
Sbjct: 176 RNSIIQKEHLVVLEAAFTLAPGKMTEIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI+ S  +G   GG ++S  H  FM+N DN T  D E L   V+K V  + GI L  
Sbjct: 236 AGKLIQDSNLQGHRIGGVEVSTKHAGFMVNVDNGTATDYENLIHYVQKTVKEKFGIELNR 295

Query: 299 EIKRLGD 305
           E++ +G+
Sbjct: 296 EVRIIGE 302


>gi|256848054|ref|ZP_05553498.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           coleohominis 101-4-CHN]
 gi|256715114|gb|EEU30091.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           coleohominis 101-4-CHN]
          Length = 298

 Score =  213 bits (541), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 87/301 (28%), Positives = 150/301 (49%), Gaps = 7/301 (2%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPI 64
           ++  ++ R  ++    +EN PL + T+  TGG A+ +  P+++  ++  +T     D+PI
Sbjct: 1   MAENIKTRFPEI--DIKENEPLAKYTFTHTGGPADWVAFPKNVDQVRQLVTFAKGHDLPI 58

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G  SN++V+D GI G+VL L+      +  +        A  +   +   A  H + 
Sbjct: 59  MVLGNASNLIVKDGGIAGLVLILTAMKSITVHGQTVT---ADAGAAYIEVTKVARDHSLS 115

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA +MNAGA   ET   V +   ++R G    +  + L + YR S +
Sbjct: 116 GIEFAAGIPGSVGGAVFMNAGAYGGETKNAVAKATVMNRTGEIFDLDNQALDFGYRHSAV 175

Query: 185 TKDL-IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
                I+        P     I A + ++   R   QP+   + GS FK P G+ A +LI
Sbjct: 176 QDQHLIVLSADFALQPGDFTAIKAEMDDLNARRAAKQPLDLPSCGSVFKRPKGYFAGKLI 235

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
             +G +G   GGA++S+ H  F++N ++ T  D   +   V+  V  + G+ LE E++ +
Sbjct: 236 HDAGLQGYTSGGAQVSKKHAGFIVNINHGTATDYLNVIHHVQATVKEKFGVDLETEVRII 295

Query: 304 G 304
           G
Sbjct: 296 G 296


>gi|294085899|ref|YP_003552659.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292665474|gb|ADE40575.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 309

 Score =  213 bits (541), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 113/298 (37%), Positives = 153/298 (51%), Gaps = 2/298 (0%)

Query: 7   SRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITI 66
              L  R  ++RG +     +   TWF  GG A+V+F P D  DL +FL    +DIPI  
Sbjct: 1   MTDLITRLPKVRGDYAMKDAMSAHTWFGVGGPADVIFSPVDEDDLSHFLAHCDADIPILP 60

Query: 67  VGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGF 126
           +G GSN+LVRD G+ GVV++L++                        +A  A + G+ G 
Sbjct: 61  IGAGSNLLVRDGGVSGVVIKLTDHMKHIHHDGTVVTAQT--GALDAEVARYASKAGLTGL 118

Query: 127 HFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK 186
            F  GIPG++GG   MNAGA   E     +  HG DR GN       ++   YR S+   
Sbjct: 119 EFLIGIPGTVGGGLRMNAGAYGSEFKDITMIAHGFDRAGNPISATPTEMGMAYRHSDAPA 178

Query: 187 DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKS 246
           D I T   ++  P     I   +  +   R   QP   +TGGSTF NP G  AWQ I+++
Sbjct: 179 DWIFTSASMQARPGDHAAIRTRMKEIVTSRGDAQPRGVRTGGSTFANPDGGKAWQEIDRA 238

Query: 247 GCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           GCRGL  G A++SE HCNF+IN   AT  ++E LGE VR +V    G  L WEI+R+G
Sbjct: 239 GCRGLAVGAAQVSEKHCNFLINNGGATAEEIETLGETVRARVLASGGPDLRWEIRRIG 296


>gi|172037287|ref|YP_001803788.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Cyanothece sp. ATCC
           51142]
 gi|171698741|gb|ACB51722.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Cyanothece sp. ATCC
           51142]
          Length = 315

 Score =  213 bits (541), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 90/292 (30%), Positives = 140/292 (47%), Gaps = 4/292 (1%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRD 77
           GK   N  L   T +R GG A     P++  +L+         D+P+ ++G GSN+L+ D
Sbjct: 23  GKIYPNVSLAPHTSYRVGGQARWYAAPRNWDELQGTFEWFQKQDMPLMLLGAGSNLLISD 82

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            GI G+VL                 + V A     S+A  A + G  G  +  GIPG++G
Sbjct: 83  RGIEGLVLSTRYLRHRRF-DEETGRITVAAGQPIVSVAWQAAKRGWRGLEWAVGIPGTVG 141

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRG 197
           GA  MNAGA+N   +  +V    +   G    +  E L Y YR+S +     +       
Sbjct: 142 GAVVMNAGAHNQCAADCLVSAVVVSPDGKVETLTPEDLNYSYRTSALQGGQRLVIEATFQ 201

Query: 198 FPE--SQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
                S+  ++A   +    R++ QP  + + GS F+NPT ++A  LIE+ G +G   G 
Sbjct: 202 LQPGFSREAVTATTQDNLWKRKSSQPYDKPSCGSVFRNPTPYAAGWLIEQLGLKGYRVGD 261

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFF 307
           A++S+ H NF++N   A   D+  L   V++KV     +LLE E+K LG+F 
Sbjct: 262 AEVSQRHANFILNCGQAKAQDIFRLIHHVQEKVQGHWSLLLEPEVKILGEFS 313


>gi|295397026|ref|ZP_06807140.1| UDP-N-acetylmuramate dehydrogenase [Aerococcus viridans ATCC 11563]
 gi|294974717|gb|EFG50430.1| UDP-N-acetylmuramate dehydrogenase [Aerococcus viridans ATCC 11563]
          Length = 311

 Score =  213 bits (541), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 96/310 (30%), Positives = 159/310 (51%), Gaps = 6/310 (1%)

Query: 9   LLRERGKQL-RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITI 66
            L +  K   +   + N PL   T+ +TGG A+V+  P+   +++  +     +  PI +
Sbjct: 2   FLNDLRKAFPQSTIKFNEPLNNYTYTKTGGPADVLIFPETPEEIQALVRFANKAHEPILV 61

Query: 67  VGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGF 126
           +G  SN+++ D G+ GVVL L+      I   +   +  GA      ++ SA   G+ GF
Sbjct: 62  LGNSSNVIISDEGVSGVVLMLTEMDHIQI---DGTHIKAGAGSKIIDVSRSAGAEGLTGF 118

Query: 127 HFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK 186
            F  GIPGS GGA YMNAGA   E S+ +VEV  + + G  + +  E L   YR S++ +
Sbjct: 119 EFACGIPGSTGGAVYMNAGAYGGEISEVLVEVDVVTKAGRMYTLKNEDLNLSYRHSDLQE 178

Query: 187 -DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEK 245
              I+     +        I A +  + + RE+ QP++  + GS FK P GH   +LI++
Sbjct: 179 TGDIVVEARFKLKKGDLKSILAKMDELTYLRESKQPLEYPSCGSVFKRPEGHFTGKLIQE 238

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +G +G   GGA+IS+ H  F+IN   AT  D   +   +++ +++ + + LE E++ LG 
Sbjct: 239 AGLQGYTIGGAQISKKHAGFIINVGGATATDYINMIHHIQEVIWDLNKVALEPEVRILGK 298

Query: 306 FFDHQIVDAT 315
              +  VDA 
Sbjct: 299 RSKYDTVDAA 308


>gi|13787122|pdb|1HSK|A Chain A, Crystal Structure Of S. Aureus Murb
          Length = 326

 Score =  212 bits (540), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 96/312 (30%), Positives = 161/312 (51%), Gaps = 7/312 (2%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PS 60
           I   I + L++       K + + PLK+ T+ +TGGNA+    P    +++  +     +
Sbjct: 14  INKDIYQALQQLIPN--EKIKVDEPLKRYTYTKTGGNADFYITPTKNEEVQAVVKYAYQN 71

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           +IP+T +G GSNI++R+ GIRG+V+ L +     +       +I G+  +   ++  A  
Sbjct: 72  EIPVTYLGNGSNIIIREGGIRGIVISLLSLDHIEVSDDA---IIAGSGAAIIDVSRVARD 128

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
           + + G  F  GIPGSIGGA YMNAGA   E    +     ++ +G+   +  ++L+  YR
Sbjct: 129 YALTGLEFACGIPGSIGGAVYMNAGAYGGEVKDCIDYALCVNEQGSLIKLTTKELELDYR 188

Query: 181 SSEITKDL-IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
           +S I K+  ++        P     I A + ++   RE+ QP++  + GS F+ P GH A
Sbjct: 189 NSIIQKEHLVVLEAAFTLAPGKMTEIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHFA 248

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LI+ S  +G   GG ++S  H  FM+N DN T  D E L   V+K V  + GI L  E
Sbjct: 249 GKLIQDSNLQGHRIGGVEVSTKHAGFMVNVDNGTATDYENLIHYVQKTVKEKFGIELNRE 308

Query: 300 IKRLGDFFDHQI 311
           ++ +G+     +
Sbjct: 309 VRIIGEHPKESL 320


>gi|302380214|ref|ZP_07268686.1| UDP-N-acetylmuramate dehydrogenase [Finegoldia magna
           ACS-171-V-Col3]
 gi|302311997|gb|EFK94006.1| UDP-N-acetylmuramate dehydrogenase [Finegoldia magna
           ACS-171-V-Col3]
          Length = 301

 Score =  212 bits (540), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 92/288 (31%), Positives = 145/288 (50%), Gaps = 4/288 (1%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRD 77
           G+   + P+K  T F+ GGN +VM  PQ+   +   L L+  +D    I+G GSN+LVRD
Sbjct: 14  GEILYDEPMKNHTTFKIGGNCDVMIFPQNEEQIINSLQLIKQNDFAYRIIGNGSNLLVRD 73

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G+R VV++L +         +   +I  +     S++  A+ +   GF    GIPG IG
Sbjct: 74  DGLREVVIKLHDNFNEI--RIDGDLLIAQSGALLSSVSKLAINNSYAGFEAVSGIPGDIG 131

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL-IITHVVLR 196
           GA  MNAGA   E    V  V  ID       +  +++ + YR S +  +  ++  V   
Sbjct: 132 GAITMNAGAYGTEMKDIVHRVKVIDTDLKVKYLNCDEMDFSYRHSRVQDEKLVVLEVEFI 191

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
                Q  I     +    R + QP++  + GS FK P GH A QLI+++G RG  +  A
Sbjct: 192 LKKGDQKEILDNFHDYTERRTSKQPLELPSCGSVFKRPEGHFAGQLIDEAGLRGYRYNDA 251

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            +SE HC F++N  +A   D+  + + V+K VF +  + LE E++ +G
Sbjct: 252 MVSEKHCGFIVNVGDAKCSDVVAVIDHVQKVVFEKFNVKLEPEVRIIG 299


>gi|56696093|ref|YP_166447.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Ruegeria pomeroyi
           DSS-3]
 gi|81350283|sp|Q5LU58|MURB_SILPO RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|56677830|gb|AAV94496.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Ruegeria pomeroyi
           DSS-3]
          Length = 308

 Score =  212 bits (540), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 114/305 (37%), Positives = 166/305 (54%), Gaps = 15/305 (4%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RGK   N  L ++TW R GG A+ +FQP DI DL+ FL +LP+DI +  +G+GSN++VR
Sbjct: 7   IRGKLTPNRDLSELTWLRVGGPADWLFQPADIDDLQTFLRMLPADIAVFPMGVGSNLIVR 66

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+R VV+RL     +   +    + +     +  +              F   IPGSI
Sbjct: 67  DGGLRAVVIRLGRGFNA---IDVAGDTVTAGAAALDAHVARKAADAGVDLTFLRTIPGSI 123

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR 196
           GGA  MNAG     T+        + R G    +   +L ++YR S++ +  ++    L+
Sbjct: 124 GGAVRMNAGCYGSYTADVFRSAQVVLRSGELATLGAAELNFRYRQSDLPEGAVLVSASLQ 183

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGH------------SAWQLIE 244
           G P     + A +      R+  QP KE++ GSTF+NP G              AW++I+
Sbjct: 184 GVPGDPEALHARMQAQLDKRDQTQPTKERSAGSTFRNPAGFSSTGRADDTHELKAWKVID 243

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           ++G RG   GGA++SE+H NF+IN   AT  DLE LGE+VRKKV++ SGI LEWEI R+G
Sbjct: 244 EAGMRGARLGGAQMSEMHSNFLINTGGATAADLEGLGEEVRKKVYDTSGITLEWEIMRVG 303

Query: 305 DFFDH 309
           D  D 
Sbjct: 304 DPLDG 308


>gi|251797874|ref|YP_003012605.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Paenibacillus sp.
           JDR-2]
 gi|247545500|gb|ACT02519.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Paenibacillus sp.
           JDR-2]
          Length = 301

 Score =  212 bits (540), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 92/302 (30%), Positives = 150/302 (49%), Gaps = 4/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPI 64
           +   + E  +   G+   N PL + T ++ GG A+V+F P     L   + LL    +P 
Sbjct: 1   METYITELEQAGLGQILYNEPLAKHTTWKIGGPADVLFIPHGKDQLVSAIRLLHKHGVPW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T +G GSN+LV D GIR   + +      +        +  GA  S   L+  + R G+ 
Sbjct: 61  TNLGRGSNMLVSDKGIR--GVVVKTRDGLDYVRFEGTLVHAGASFSFVKLSRMSGREGLT 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPG++GGA YMNAGA+  + S+       +   G      RE +++ YR S +
Sbjct: 119 GLEFAGGIPGTVGGAVYMNAGAHGSDVSRIFRSAEIVLETGELVRFDREAMQFSYRHSIL 178

Query: 185 TK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            +   ++           +N ISA +A     R   QP++    GS F+NP    A +LI
Sbjct: 179 HELKGVVVEASFELAEGDRNEISATLAAYQERRLRTQPLQLACAGSVFRNPPNDFAARLI 238

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           +++G +G+ FGGA++SELH NF++N   AT  D+  L   ++  + ++ G+ L  E+  +
Sbjct: 239 QEAGLKGVRFGGAEVSELHANFIVNRGQATAEDVLTLMTHIQGTIADRYGVRLVPEVLVV 298

Query: 304 GD 305
           G+
Sbjct: 299 GE 300


>gi|119364521|sp|Q5LYN3|MURB_STRT1 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|119364522|sp|Q5M396|MURB_STRT2 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
          Length = 304

 Score =  212 bits (540), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 95/301 (31%), Positives = 148/301 (49%), Gaps = 6/301 (1%)

Query: 8   RLLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPIT 65
            +L E  + L G   + + PLK+ T+ + GG A+ +  P++ ++L   +      +IP  
Sbjct: 4   NMLDELKEDLVGIDIRFDEPLKRYTYTKVGGPADYLAFPRNRYELFRIVKFANKHNIPWM 63

Query: 66  IVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGG 125
           ++G  SN++VRD GIRG V+         +   N  ++   A  +  +    A  H + G
Sbjct: 64  VLGNASNLIVRDGGIRGFVIMFDKLNGIAV---NGYQVEAEAGANLIATTKVACFHSLTG 120

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT 185
           F F  GIPGSIGGA +MNAGA   E +  +V    + + G+   I    +++ YR S + 
Sbjct: 121 FEFAAGIPGSIGGAVFMNAGAYGGEIAHILVSAQVLTKDGDIRTIDARDMRFGYRRSVLQ 180

Query: 186 K-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIE 244
           +   ++        P     I   +  + H RE  QP++  + GS FK P GH A QLI 
Sbjct: 181 ETGEVVISAKFNLKPGDYEQIKHEMNRLNHLRELKQPLEYPSCGSVFKRPPGHFAGQLIM 240

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           ++   G   GG ++S  H  FM+N D  T  D E L   V  KV   SG+ LE E++ +G
Sbjct: 241 EANLEGHRIGGVEVSTKHAGFMVNVDQGTAKDYEDLIADVIAKVKENSGVTLEPEVRIIG 300

Query: 305 D 305
           D
Sbjct: 301 D 301


>gi|289422276|ref|ZP_06424130.1| UDP-N-acetylmuramate dehydrogenase [Peptostreptococcus anaerobius
           653-L]
 gi|289157327|gb|EFD05938.1| UDP-N-acetylmuramate dehydrogenase [Peptostreptococcus anaerobius
           653-L]
          Length = 306

 Score =  212 bits (540), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 90/303 (29%), Positives = 152/303 (50%), Gaps = 6/303 (1%)

Query: 8   RLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITI 66
            LL+    +   +   + P+     F+ GG A+++ +P+   +++    +   ++IP  I
Sbjct: 8   ELLKNELDK--SEIMVDEPMHNHISFKVGGPADILVRPRTEEEIQKVFKIAKENNIPFII 65

Query: 67  VGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGF 126
            G GSNIL++D G RG+V+ +++             M V A      +   A+   + GF
Sbjct: 66  KGNGSNILIKDGGFRGLVIEIADNFSDYKIEEET--MTVQAGALLSIIGKKAMEASLTGF 123

Query: 127 HFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK 186
            F  GIPG++GGA  MNAGA   E    V  V  +D  GN      E++ + YR S ++ 
Sbjct: 124 EFASGIPGTLGGALAMNAGAYGGEMKNIVESVRIMDEDGNIKEYSNEEMAFSYRHSRLSD 183

Query: 187 -DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEK 245
              I     ++        I   + ++   R + QP++  + GSTFK P G+ A +LI+ 
Sbjct: 184 TKHIALSARIKLQKGIYEDIKEIMDDLRLKRTSKQPLEYPSAGSTFKRPEGYFAGKLIQD 243

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           S  +G + GGA++S  H  F+IN D A+  D+  L + V+++VF   G+ LE E+K LG+
Sbjct: 244 SDLKGYQMGGAQVSSKHSGFIINYDKASAKDIINLIDHVKERVFECFGVRLEEEVKILGE 303

Query: 306 FFD 308
             +
Sbjct: 304 DEE 306


>gi|329115579|ref|ZP_08244301.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acetobacter pomorum
           DM001]
 gi|326695007|gb|EGE46726.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acetobacter pomorum
           DM001]
          Length = 345

 Score =  212 bits (540), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 122/306 (39%), Positives = 171/306 (55%), Gaps = 6/306 (1%)

Query: 4   GRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIP 63
             +  +++     +RG+     PL   TWFR GG AE +FQP D  DL   L  L  ++P
Sbjct: 36  ASMQDMVKHAFANMRGRLTPQAPLGPRTWFRVGGAAEWLFQPADAEDLAGVLQRLSPELP 95

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           IT +G  SN+++RD G+ GVV+R++      I V     +   A C   ++A  A + G+
Sbjct: 96  ITALGACSNVIIRDGGLEGVVVRMARGFAD-ITVEADGIIAGCA-CLDATVAEHAAQAGL 153

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            G  F  GIPGSIGGA  MNAGA   + +  +     I R G+   +    L++ YR S 
Sbjct: 154 AGLEFLAGIPGSIGGAVRMNAGAYGSDIANVLDWAEIITRDGSLIRLDNAALRFGYRRSG 213

Query: 184 ITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA---- 239
           + +   +    LRG P +   ++  IA V   RE  QP++ +TGGSTF+NP   ++    
Sbjct: 214 LPEGAFVIRARLRGTPANAQDVANRIAEVRAARELSQPVRARTGGSTFRNPDAETSARKA 273

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
           W+LI+ +GCRGL  G A++SE HCNF+IN  NAT  DLE LGE VR +V   SG+ L WE
Sbjct: 274 WELIDAAGCRGLRHGDAQVSEKHCNFLINLGNATATDLEELGEDVRTRVAQNSGVSLHWE 333

Query: 300 IKRLGD 305
           IKRLG 
Sbjct: 334 IKRLGK 339


>gi|147678194|ref|YP_001212409.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Pelotomaculum
           thermopropionicum SI]
 gi|189028925|sp|A5D143|MURB_PELTS RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|146274291|dbj|BAF60040.1| UDP-N-acetylmuramate dehydrogenase [Pelotomaculum thermopropionicum
           SI]
          Length = 313

 Score =  212 bits (540), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 103/298 (34%), Positives = 162/298 (54%), Gaps = 4/298 (1%)

Query: 9   LLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIV 67
             RE  + L G+ +   P+K+ T +R GG ++V  +P+   +L+  +      D P+ ++
Sbjct: 6   FYRELAELLPGRVRAGEPMKKHTTWRIGGPSDVFVEPEGREELRRVVCYASRRDAPLYVI 65

Query: 68  GLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFH 127
           G GSN+LV D G+RG+V+++              ++I  A      +A +A   G+GGF 
Sbjct: 66  GNGSNLLVADGGVRGIVVKIGKGLSRI--SIKGNKIIAEAGARLAGVAAAAGEAGLGGFE 123

Query: 128 FFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK- 186
           F  GIPG+IGGA  MNAGAN       V EV  +D  G      +E++K+ YRSS I K 
Sbjct: 124 FLAGIPGTIGGAVAMNAGANGFSLGNLVEEVLLLDFHGEFCRKTKEEMKFGYRSSIIQKA 183

Query: 187 DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKS 246
            LI+   +   +P ++  I   +      R+  QP+   + GS FKNP G +A +LIE +
Sbjct: 184 PLILVEALFSCYPRNKEEIREEMERFLARRKLTQPLCYPSAGSVFKNPPGDTAGRLIEMA 243

Query: 247 GCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           G +G+  G A+IS LH NF++N  +AT  D+  L E+ R+ V  + G+ L+ E+K +G
Sbjct: 244 GLKGMRVGDAQISTLHANFIVNLGSATARDVLALIEKAREAVLARFGVELKLEVKIIG 301


>gi|303235067|ref|ZP_07321691.1| UDP-N-acetylmuramate dehydrogenase [Finegoldia magna BVS033A4]
 gi|302493922|gb|EFL53704.1| UDP-N-acetylmuramate dehydrogenase [Finegoldia magna BVS033A4]
          Length = 301

 Score =  212 bits (540), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 89/288 (30%), Positives = 141/288 (48%), Gaps = 4/288 (1%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRD 77
           G+   + P+K  T F+ GGN + M  PQ+   +   L L+  +D    I+G GSN+LV D
Sbjct: 14  GEILYDEPMKNHTTFKIGGNCDAMIFPQNEEQIINSLQLIKQNDFAYRIIGNGSNLLVSD 73

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G+R VV++L +         +   +   +     S++  A+ +   GF    GIPG IG
Sbjct: 74  DGLREVVIKLHDNFNEI--RIDGDVLKAQSGALLSSVSKLAINNSYAGFEAVSGIPGDIG 131

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLII-THVVLR 196
           GA  MNAGA   E    V  V  ID       +  +++ + YR S +  +  +   V   
Sbjct: 132 GAITMNAGAYGTEMKDIVHRVKVIDTDLEVKYLNCDEMDFSYRHSRVQDEKFVVLEVEFI 191

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
                Q  I     +    R + QP++  + GS FK P GH A QLI+++G RG  +  A
Sbjct: 192 LKKGDQKEILDNFHDYTERRTSKQPLELPSCGSVFKRPEGHFAGQLIDEAGLRGYRYNDA 251

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            +SE HC F++N  +A   D+  + + V+K VF +  + LE E++ +G
Sbjct: 252 MVSEKHCGFIVNVGDAKCSDVVAVIDHVQKVVFEKFNVKLEPEVRIIG 299


>gi|160945125|ref|ZP_02092351.1| hypothetical protein FAEPRAM212_02644 [Faecalibacterium prausnitzii
           M21/2]
 gi|158442856|gb|EDP19861.1| hypothetical protein FAEPRAM212_02644 [Faecalibacterium prausnitzii
           M21/2]
          Length = 298

 Score =  212 bits (540), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 98/299 (32%), Positives = 142/299 (47%), Gaps = 4/299 (1%)

Query: 7   SRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPIT 65
              L++        ++EN PL     F+ GG A +  QP D   L   + L     +   
Sbjct: 1   MEQLKQLLTAAGIAYKENEPLAAHCTFKIGGPARLFVQPADRAQLCRAVALCKAQGVRYY 60

Query: 66  IVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGG 125
           ++G GSNIL  D G  GVVL +S+   +        ++  GA     +L  +AL H + G
Sbjct: 61  LLGNGSNILFADEGYNGVVLDISSMQDTVEVH--GTQLTAGAGVRLSALCKTALEHSLTG 118

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT 185
             F YGIPG++GGA YMNAGA   E    +  V  +  +G        +L  +YR S   
Sbjct: 119 LEFAYGIPGTVGGAVYMNAGAYGGEMKDVLTTVQYLTAEGKVKEAAAAELDLRYRHSIFE 178

Query: 186 KDL-IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIE 244
           ++   I        P    +I A +  +   R   QP+ + + GSTFK P G  A  LI+
Sbjct: 179 ENGGCILSAQFALTPGEPEVIRAKMDELMAKRLDKQPLDKPSAGSTFKRPVGAFAAALID 238

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           + G RG   GGA +SE HC F++N   AT  D+  L E+VR  V  ++G  LE EI+ +
Sbjct: 239 QCGLRGYRHGGAAVSEKHCGFVVNLGGATCADVLALCEEVRTIVKEKTGYDLEKEIRVV 297


>gi|320161743|ref|YP_004174968.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Anaerolinea
           thermophila UNI-1]
 gi|319995597|dbj|BAJ64368.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Anaerolinea
           thermophila UNI-1]
          Length = 309

 Score =  212 bits (540), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 90/310 (29%), Positives = 140/310 (45%), Gaps = 8/310 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-P 59
           M +      LRE         QEN PL   T  R GG A+      D+  L+  + LL  
Sbjct: 1   MTFALPMNRLREA---FGDALQENVPLAAYTTARVGGPADAFLPVHDLAQLERAVRLLWD 57

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            ++P  I+G GSN+LV DAG RGVV+                 +   +  +   +A    
Sbjct: 58  LNVPYLILGSGSNLLVSDAGYRGVVIFNRARNVKIDVHHQPPSVWAESGANLSHVARQTA 117

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
             G+ G  +   +PG++GGA Y NAGA   + +  +     +  +  +     E++ Y Y
Sbjct: 118 LRGLSGLEWAATVPGTVGGAVYGNAGAFGGDMAGNLALAEILHPELGKVHWSAEEMGYGY 177

Query: 180 RSSEITKDLII---THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTG 236
           R+S + ++          +     +   + A I      R   QP    T GS FKNP G
Sbjct: 178 RTSILKREKSKAVILAARMNLTQSTVEEVQARIETFSAKRRATQPPGA-TMGSMFKNPPG 236

Query: 237 HSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILL 296
             A +LIE +G +G   G A+IS +H NF +N   AT  D+  L +  +K V ++ G+ L
Sbjct: 237 DYAGRLIEAAGLKGKRIGKAEISPVHANFFVNLGGATAADILQLIQIAQKTVQDKFGVTL 296

Query: 297 EWEIKRLGDF 306
           E EI+ +G++
Sbjct: 297 ELEIECIGEW 306


>gi|223933875|ref|ZP_03625840.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus suis
           89/1591]
 gi|302023703|ref|ZP_07248914.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus suis
           05HAS68]
 gi|330832738|ref|YP_004401563.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus suis
           ST3]
 gi|223897464|gb|EEF63860.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus suis
           89/1591]
 gi|329306961|gb|AEB81377.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus suis
           ST3]
          Length = 302

 Score =  212 bits (539), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 99/306 (32%), Positives = 154/306 (50%), Gaps = 7/306 (2%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPI 64
           +   +R   + +    + + PLK+ T+ + GG  + +  P++ +++   +       IP 
Sbjct: 1   MKDKIRLELEGI--DIRFDEPLKEYTYTKVGGAVDYLAFPRNRYEIVRIVEFAKREGIPW 58

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G  SNI+VRD GIRG V+R+       +   +   +   A  +       AL H + 
Sbjct: 59  QVLGNSSNIIVRDGGIRGFVIRMDKLNSVTV---SGYTIEAEAGANLIETTKVALFHSLS 115

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           GF F  GIPGSIGGA YMNAGA   E +  +V    +   G    +   +L++ YRSS +
Sbjct: 116 GFEFACGIPGSIGGAVYMNAGAYGGEVAHILVSAQILTPAGYVETLDNRELRFGYRSSIL 175

Query: 185 TKDL-IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            ++  I+        P +  +I   +A + H RE  QP++  + GS FK P GH A QLI
Sbjct: 176 QENGAIVLSAKFALKPGNHTVIQQEMARLTHLRELKQPLEYPSCGSVFKRPLGHFAGQLI 235

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
             +G +G   GG ++SE H  FM+N +N T  D E L   V + V   SGI LE E++ +
Sbjct: 236 MDAGLKGYRIGGVEVSEKHAGFMVNIENGTASDYENLIAHVIEVVEKSSGITLEREVRII 295

Query: 304 GDFFDH 309
           GD  D 
Sbjct: 296 GDPADT 301


>gi|254555845|ref|YP_003062262.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           plantarum JDM1]
 gi|300767634|ref|ZP_07077544.1| UDP-N-acetylmuramate dehydrogenase [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
 gi|308179824|ref|YP_003923952.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           plantarum subsp. plantarum ST-III]
 gi|254044772|gb|ACT61565.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           plantarum JDM1]
 gi|300494619|gb|EFK29777.1| UDP-N-acetylmuramate dehydrogenase [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
 gi|308045315|gb|ADN97858.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           plantarum subsp. plantarum ST-III]
          Length = 302

 Score =  212 bits (539), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 91/302 (30%), Positives = 157/302 (51%), Gaps = 7/302 (2%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           +++ +      +  + ++N  L   T  +TGG A+ +  P+ I + K  +T     ++P+
Sbjct: 1   MTKDVLATFPAI--EIKKNESLSHYTNTKTGGPADYVAFPKSISETKALITFANEQNLPL 58

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T++G  SN++V+D GIRG+ + L+     +    +  +++  A  +  +    A    + 
Sbjct: 59  TVIGNASNLIVKDGGIRGLTIILTRMKQIH---ASGTKVVAEAGAAIIATTKVACGASLT 115

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA +MNAGA   E S+ V  V  +   G    +  ++L + YR S I
Sbjct: 116 GLEFAAGIPGSVGGAIFMNAGAYGGEMSEVVETVTVLTPAGQLKTLDHDELDFGYRHSTI 175

Query: 185 TK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
              D I+  V     P +Q  I A +  +   R   QP++  + GS FK PTG+   +LI
Sbjct: 176 QDYDDIVVSVTFGLKPGNQTKIQARMDELNTLRAAKQPLEWPSCGSVFKRPTGYFTGKLI 235

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
             +G +G   GGA++S+ H  F+IN D+AT  D   +   V+K VF + G+ L+ E++ +
Sbjct: 236 HDAGLQGHRIGGAEVSKKHAGFIINVDHATATDYMDMIHYVQKVVFERFGVHLQTEVRII 295

Query: 304 GD 305
           G+
Sbjct: 296 GE 297


>gi|301794431|emb|CBW36865.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae INV104]
          Length = 316

 Score =  212 bits (539), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 96/298 (32%), Positives = 149/298 (50%), Gaps = 6/298 (2%)

Query: 11  RERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVG 68
            +  + L G   +   PL   ++ + GG A+ +  P++  +L   +      +IP  ++G
Sbjct: 5   EKMLEILEGIDIRFQEPLHSYSYTKVGGEADYLVFPRNRFELARLVKFANQENIPWMVLG 64

Query: 69  LGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHF 128
             SNI+VRD GIRG V+        ++   +   +   A  +       ALRH + GF F
Sbjct: 65  NASNIIVRDGGIRGFVILCDKLNNVSV---DGYTIEAEAGANLIETTRIALRHSLTGFEF 121

Query: 129 FYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-D 187
             GIPGS+GGA +MNAGA   E +  +     + + G    +  + L + YR S I +  
Sbjct: 122 ACGIPGSVGGAVFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAKDLAFGYRHSAIQESG 181

Query: 188 LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSG 247
            ++  V     P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G
Sbjct: 182 AVVLSVKFALAPGTHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAG 241

Query: 248 CRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            +G   GG ++SE H  FMIN  + T  D E L + V +KV   SGI LE E++ LG+
Sbjct: 242 LKGYRIGGVEVSEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGITLEREVRILGE 299


>gi|188589074|ref|YP_001922470.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           botulinum E3 str. Alaska E43]
 gi|254764147|sp|B2UZY4|MURB_CLOBA RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|188499355|gb|ACD52491.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           botulinum E3 str. Alaska E43]
          Length = 304

 Score =  212 bits (539), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 98/288 (34%), Positives = 156/288 (54%), Gaps = 5/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDA 78
           + QEN  + +   FR GG  +++  P     +   + +   + IP  ++G GSN+LV+D+
Sbjct: 19  QIQENAKMSEHINFRVGGPVDILLTPNTKEQIVETIKICKENKIPFYVLGNGSNVLVKDS 78

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIRGVV++LS        VR    +   +    K ++  AL+  + GF F  GIPGS+GG
Sbjct: 79  GIRGVVIKLSEFDNI---VRTGNTIKAESGALLKDVSAEALKASLTGFEFACGIPGSVGG 135

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRG 197
           A +MNAGA + E S  + E   +   G    + ++QL+  YR+S I K + I+       
Sbjct: 136 AVFMNAGAYDGEISFVIKEAEVMSEDGKIITLSKDQLELGYRTSAIMKKNYIVITATFCF 195

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
               ++ I   ++ + + RE  QP++  + GSTFK P GH A +LI+ +G +    GGA 
Sbjct: 196 ESGEKDKIEGRVSELTNKREEKQPLEFPSAGSTFKRPEGHFAGKLIQDAGLKDFTLGGAA 255

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S  HC F+IN  NAT  D+  L E V+K+V  Q G+ L  E++ +G+
Sbjct: 256 VSGKHCGFIINKSNATAKDILDLIEYVQKEVKKQFGVDLYPEVRIIGE 303


>gi|295105631|emb|CBL03175.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Faecalibacterium
           prausnitzii SL3/3]
          Length = 298

 Score =  212 bits (539), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 99/299 (33%), Positives = 143/299 (47%), Gaps = 4/299 (1%)

Query: 7   SRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPIT 65
              L++        ++EN PL     F+ GG A +  QP D   L   + L     +   
Sbjct: 1   MEQLKQLLTAAGIAYKENEPLAAHCTFKIGGPARLFVQPADRAQLCRAVALCKAQGVRYY 60

Query: 66  IVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGG 125
           ++G GSNIL  D G  GVVL +S+   +        ++  GA     +L  +AL HG+ G
Sbjct: 61  LLGNGSNILFADEGYNGVVLDISSMQDTVEVH--GTQLTAGAGVRLSALCKTALEHGLTG 118

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT 185
             F YGIPG++GGA YMNAGA   E    +  V  +  +G        +L  +YR S   
Sbjct: 119 LEFAYGIPGTVGGAVYMNAGAYGGEMKDVLTTVQYLTAEGEVKEAAAAELDLRYRHSIFE 178

Query: 186 KDL-IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIE 244
           ++   I        P    +I A +  +   R   QP+ + + GSTFK P G  A  LI+
Sbjct: 179 ENGGCILSAQFALTPGEPEVIRAKMDELMAKRLDKQPLDKPSAGSTFKRPVGAFAAALID 238

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           + G RG   GGA +SE HC F++N   AT  D+  L E+VR  V  ++G  LE EI+ +
Sbjct: 239 QCGLRGYRHGGAAVSEKHCGFVVNLGGATCADVLALCEEVRTIVKEKTGYDLEKEIRVV 297


>gi|15892255|ref|NP_359969.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia conorii
           str. Malish 7]
 gi|15619393|gb|AAL02870.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rickettsia conorii
           str. Malish 7]
          Length = 378

 Score =  212 bits (539), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 129/292 (44%), Positives = 177/292 (60%), Gaps = 2/292 (0%)

Query: 13  RGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSN 72
               ++G++++++ LK +TWF+ GGNAE+ F+P D  DLK FL      +PI   G GSN
Sbjct: 86  ILPIVKGEYKKDYNLKHLTWFKVGGNAEIFFKPLDSEDLKSFLIQNKQKLPIKTFGAGSN 145

Query: 73  ILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGI 132
           I++RD GI GVV++L     +   V     +IVG+ C   +LA     + I GF F  GI
Sbjct: 146 IIIRDGGIEGVVIKLGQNFSNIEFVD--NHLIVGSSCLNYNLAKFCQANAISGFEFLVGI 203

Query: 133 PGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITH 192
           PG+IGG   MNAGA   E    VV++  ID  GN      E++ ++YRS+ + K+LII  
Sbjct: 204 PGTIGGGVAMNAGAYGSEFKDIVVQIEAIDFAGNFLTFTNEEIGFKYRSNNLPKNLIILK 263

Query: 193 VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLE 252
            V +        I   +  + + R + QPIKE+TGGSTF NP G  +W+LI+K+G RG  
Sbjct: 264 AVFKINKGDSENILLRMNEIKNARSSTQPIKERTGGSTFANPEGRKSWELIDKAGLRGYR 323

Query: 253 FGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            GGA +SE HCNFMIN  +AT  DLE LG+ VR+KV   SG+ LEWEIKR+G
Sbjct: 324 IGGASMSEFHCNFMINNGDATAKDLEDLGDFVRQKVCEDSGVKLEWEIKRIG 375


>gi|148997557|ref|ZP_01825162.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP11-BS70]
 gi|168575850|ref|ZP_02721765.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae MLV-016]
 gi|307068043|ref|YP_003877009.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus pneumoniae AP200]
 gi|147756612|gb|EDK63653.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP11-BS70]
 gi|183578214|gb|EDT98742.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae MLV-016]
 gi|306409580|gb|ADM85007.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus pneumoniae AP200]
          Length = 316

 Score =  212 bits (539), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 96/298 (32%), Positives = 149/298 (50%), Gaps = 6/298 (2%)

Query: 11  RERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVG 68
            +  + L G   +   PL   ++ + GG A+ +  P++  +L   +      +IP  ++G
Sbjct: 5   EKMLEILEGIDIRFQEPLHSYSYTKVGGEADYLVFPRNRFELARVVKFANQENIPWMVLG 64

Query: 69  LGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHF 128
             SNI+VRD GIRG V+        ++   +   +   A  +       ALRH + GF F
Sbjct: 65  NASNIIVRDGGIRGFVILCDKLNNVSV---DGYTIEAEAGANLIETTRIALRHSLTGFEF 121

Query: 129 FYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-D 187
             GIPGS+GGA +MNAGA   E +  +     + + G    +  + L + YR S I +  
Sbjct: 122 ACGIPGSVGGAVFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAKDLAFGYRHSAIQESG 181

Query: 188 LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSG 247
            ++  V     P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G
Sbjct: 182 AVVLSVKFALAPGTHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAG 241

Query: 248 CRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            +G   GG ++SE H  FMIN  + T  D E L + V +KV   SGI LE E++ LG+
Sbjct: 242 LKGYRIGGVEVSEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGITLEREVRILGE 299


>gi|251779399|ref|ZP_04822319.1| UDP-N-acetylmuramate dehydrogenase [Clostridium botulinum E1 str.
           'BoNT E Beluga']
 gi|243083714|gb|EES49604.1| UDP-N-acetylmuramate dehydrogenase [Clostridium botulinum E1 str.
           'BoNT E Beluga']
          Length = 304

 Score =  212 bits (539), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 98/288 (34%), Positives = 155/288 (53%), Gaps = 5/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDA 78
           + QEN  + +   FR GG  +++  P     +   + +   + IP  ++G GSN+LV+D+
Sbjct: 19  QIQENAKMSEHINFRVGGPVDILLTPNTKEQIVETIKICKENKIPFYVLGNGSNVLVKDS 78

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GIRGVV++LS        VR    +   +    K ++  AL+  + GF F  GIPGS+GG
Sbjct: 79  GIRGVVIKLSEFDNI---VRTGNTIKAESGALLKEVSAEALKASLTGFEFACGIPGSVGG 135

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRG 197
           A +MNAGA + E S  + E   +   G    + ++QL+  YR+S I K + I+       
Sbjct: 136 AVFMNAGAYDGEISFVIKEAEVMSEDGKIITLSKDQLELGYRTSAIMKKNYIVITATFCF 195

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
               ++ I   +  + + RE  QP++  + GSTFK P GH A +LI+ +G +    GGA 
Sbjct: 196 KSGEKDKIEGRVYELTNKREEKQPLEFPSAGSTFKRPEGHFAGKLIQDAGLKDFTLGGAA 255

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S  HC F+IN  NAT  D+  L E V+K+V  Q G+ L  E++ +G+
Sbjct: 256 VSGKHCGFIINKSNATAKDILDLIEYVQKEVKKQFGVDLYPEVRIIGE 303


>gi|89099611|ref|ZP_01172486.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus sp. NRRL
           B-14911]
 gi|89085764|gb|EAR64890.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus sp. NRRL
           B-14911]
          Length = 302

 Score =  212 bits (539), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 98/302 (32%), Positives = 152/302 (50%), Gaps = 5/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           +  L+        GK +E  PL   T  + GG A++  +P  I +    + L+   DI  
Sbjct: 1   MDELISRLKDMQVGKVKEQEPLANHTTMKIGGPADLFVEPSSIDNFIKTMELIREHDIKW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G GSN+LV D GI G V++L           +      G   S  SL+    R G+ 
Sbjct: 61  RVIGRGSNLLVSDKGIEGAVIKLGPGLDKLEVDGSEVT--AGGGFSIVSLSVQISRKGLS 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA+  + S+ + +   +   G    +  EQ+K+ YR+S +
Sbjct: 119 GLEFASGIPGSVGGAVYMNAGAHGSDISKILKKAFVLFEDGTMEWLTNEQMKFSYRTSVL 178

Query: 185 TKDLI--ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
            K+    +   V       ++ I A +     +R+  QP      GS F+NP    A QL
Sbjct: 179 QKERPGIVLEAVFSLQEGERDSIVAEMQKNKDYRKETQPYNYPCAGSIFRNPLPQYAGQL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IE +G +G   GGAKISELH NF++NA +A+  D+  L E V+  +++Q  + +E E++ 
Sbjct: 239 IESAGLKGHSIGGAKISELHGNFIVNAGSASAEDVLGLIEHVKDTIYSQFKVKMETEVEI 298

Query: 303 LG 304
           +G
Sbjct: 299 IG 300


>gi|150397281|ref|YP_001327748.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sinorhizobium
           medicae WSM419]
 gi|187609740|sp|A6UB83|MURB_SINMW RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|150028796|gb|ABR60913.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sinorhizobium
           medicae WSM419]
          Length = 324

 Score =  212 bits (539), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 170/312 (54%), Positives = 220/312 (70%), Gaps = 3/312 (0%)

Query: 1   MIYGRISRLLRERGK---QLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTL 57
           M      +LL   G     +RG+   + P+ ++TWFR GG AE+MFQP D  DL  FL L
Sbjct: 1   MKQVNGQKLLESLGNGVSAIRGRITPDAPMDRVTWFRAGGLAELMFQPHDTDDLTTFLKL 60

Query: 58  LPSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANS 117
           +P ++P+ +VG+GSN+LVRD GI GVV+RLS  GF ++E+     +  GA C  K+LA  
Sbjct: 61  VPEEVPVLVVGVGSNLLVRDGGIPGVVIRLSAKGFGDLELAGEHRIKAGAICPDKNLAAM 120

Query: 118 ALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKY 177
           AL HGIGGF+F+YGIPGSIGGA  MNAGAN  ETS  V+EVH +DRKG++HV+ + ++ Y
Sbjct: 121 ALDHGIGGFYFYYGIPGSIGGALRMNAGANAGETSARVLEVHAVDRKGDRHVLSKSEMGY 180

Query: 178 QYRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGH 237
            YR S   KDLI TH +  G+ E +  I   +  V  HRETVQPI+EKTGGSTFKNP GH
Sbjct: 181 GYRHSGAAKDLIFTHAIFEGYAEDKAKIRNDMDAVRQHRETVQPIREKTGGSTFKNPEGH 240

Query: 238 SAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLE 297
           SAW+LI+++GCRG+  G A++S LHCNFMIN   ATGY+LEYLGE VR++V + SG+ LE
Sbjct: 241 SAWKLIDEAGCRGMMIGNAQMSPLHCNFMINTGQATGYELEYLGETVRQRVMDHSGVKLE 300

Query: 298 WEIKRLGDFFDH 309
           WEIKR+G+F   
Sbjct: 301 WEIKRVGNFMPG 312


>gi|229823689|ref|ZP_04449758.1| hypothetical protein GCWU000282_00990 [Catonella morbi ATCC 51271]
 gi|229786728|gb|EEP22842.1| hypothetical protein GCWU000282_00990 [Catonella morbi ATCC 51271]
          Length = 300

 Score =  212 bits (539), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 90/287 (31%), Positives = 157/287 (54%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAG 79
            + N PL   T+ +TGG A+++  P+ + +++  L  +   ++P+T++G  SN++V+D G
Sbjct: 16  IKANEPLSNYTYTKTGGPADLLVFPRSVEEVQRVLAAVKQENLPLTVLGNASNLIVKDGG 75

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRG+V+ L++       V    ++   +  +    +  A   G+ G  F  GIPGSIGGA
Sbjct: 76  IRGLVMILTDMQE---LVLEGNQLKAASGAALIEASRQAAAAGLTGLEFACGIPGSIGGA 132

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            YMNAGA   E    + +V  + R G           + YR S   + D +I  V     
Sbjct: 133 IYMNAGAYGGEVKDVISQVQTMTRDGQLKTYAGADCDFSYRHSRFQEGDEVILGVTFDLA 192

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P  Q+ I + +A + H R++ QP++  + GS FK P G+ A +LI+ +G +G + GGA++
Sbjct: 193 PGDQSTIDSKVAELTHLRQSKQPLEYPSCGSVFKRPEGYFAGKLIQDAGLQGYQVGGAQV 252

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           S  H  F++N D+AT  D   + E +R  V+ ++G+ +E E++ +G+
Sbjct: 253 STKHAGFIVNVDHATATDYLEVIEHIRLVVWARTGVFMEPEVRIIGE 299


>gi|302385502|ref|YP_003821324.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           saccharolyticum WM1]
 gi|302196130|gb|ADL03701.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           saccharolyticum WM1]
          Length = 303

 Score =  212 bits (539), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 104/291 (35%), Positives = 154/291 (52%), Gaps = 3/291 (1%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVR 76
           +   +    +++ T FR GG A     P D  +L   + L   + +P  I+G GSN+LV 
Sbjct: 14  KDHIKIGEEMRKHTSFRVGGPAACFVIPADETELSGVMALCREEEVPFFILGNGSNLLVG 73

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G  GVV+ + +   S    +    +  GA  S K +A  A +  + GF F  GIPG++
Sbjct: 74  DEGFDGVVISMDSFC-SCQVNKETGIVTAGAGASLKRIAQEAYKASLTGFEFAAGIPGTL 132

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSS-EITKDLIITHVVL 195
           GGA  MNAGA   E  + +  V  +   G    +P +QL   YR+S  I K  ++    +
Sbjct: 133 GGAVVMNAGAYGSEMKEVLKSVRVMTAGGEVRDLPADQLSLGYRTSCIIPKQYVVLEARI 192

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
           R     +  I   +  +   R   QP++  + GSTFK P G+ A +LIE++G RG   GG
Sbjct: 193 RLRDGDEVSIKNRMDELAGRRREKQPLEYPSAGSTFKRPEGYFAGKLIEEAGLRGFSLGG 252

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           A++SE HC F+IN D+AT  D+  L E+V+K+VF  SG+ LE E+K LG F
Sbjct: 253 AQVSEKHCGFVINKDHATAADIRDLCEEVKKRVFKNSGVALEMEVKTLGKF 303


>gi|325684507|gb|EGD26671.1| UDP-N-acetylmuramate dehydrogenase [Lactobacillus delbrueckii
           subsp. lactis DSM 20072]
          Length = 297

 Score =  212 bits (539), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 88/288 (30%), Positives = 143/288 (49%), Gaps = 5/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDA 78
             QEN PL + T+ +TGG AE +  P+ + +LK  L     D +PIT++G  SN+++RD 
Sbjct: 12  NLQENIPLSRYTFTQTGGPAEYLAFPKTLAELKELLAATKEDQLPITVIGNASNLIIRDK 71

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           GI+G+V+ L       +      ++   A       + +A   G+ G  F  GIPGS+GG
Sbjct: 72  GIKGLVIILKEMKEIKV---EADKVHAQAGARIIDTSFAAGEAGLSGLEFAAGIPGSVGG 128

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR-G 197
           A +MNAGA   ET   +     + R G        +L + YR S + ++  I        
Sbjct: 129 AVFMNAGAYGGETKDCLESATVVTRDGEVKTYTNAELHFSYRHSLLQENDEIVIAATFAL 188

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
               +  I   +  +   R   QP++  + GS FK PTGH    ++ K+G +G + GGA+
Sbjct: 189 KAGDKATILDQMNYLNALRSYKQPLEYPSCGSVFKRPTGHFVGPMLIKAGLQGKQIGGAQ 248

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S  H  F++N   AT  D   L   ++K +  + GI L+ E++ +G+
Sbjct: 249 VSTKHAGFIVNKGGATATDYLNLIHYIQKTIKEKDGIALQTEVRIIGE 296


>gi|228999837|ref|ZP_04159409.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus mycoides
           Rock3-17]
 gi|229007391|ref|ZP_04164988.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus mycoides
           Rock1-4]
 gi|228753779|gb|EEM03220.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus mycoides
           Rock1-4]
 gi|228759779|gb|EEM08753.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus mycoides
           Rock3-17]
          Length = 305

 Score =  212 bits (539), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 88/307 (28%), Positives = 151/307 (49%), Gaps = 7/307 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-P 59
           M    + + LR    +     +++  LK  T  + GG A+V  QP    +++  +     
Sbjct: 1   MNMQEVYKYLRTVLPE--EHVKQDEMLKNHTHIKVGGKADVFVQPTTYTEIQQVVQYANK 58

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +IPIT +G GSN++++D GIRG+ L L++     +  +        +  +   ++  AL
Sbjct: 59  HNIPITFLGNGSNVIIKDGGIRGITLSLTHITDVTVNEQTIV---AQSGAAIIDISRIAL 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
           +H + G  F  GIPGS+GGA YMNAGA   E +  + +   + ++G    + ++   + Y
Sbjct: 116 KHSLTGLEFACGIPGSVGGALYMNAGAYGGEVAYVLTKAVVMTKEGELITLSKDDFDFGY 175

Query: 180 RSSEITKDLII-THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S    +  I               I   + ++ + RE+ QP++  + GS FK P  + 
Sbjct: 176 RKSIFANNHYIILEATFELENGVYEEIKEKMDDLTYKRESKQPLEYPSCGSVFKRPPNNF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI+ SG +G   GG ++S  H  FM+N DN T  D   L   V+K V  + G+ LE 
Sbjct: 236 AGKLIQDSGLQGKRIGGVEVSTKHAGFMVNVDNGTAQDYIDLIHFVQKTVKEKCGVTLER 295

Query: 299 EIKRLGD 305
           E++ +G+
Sbjct: 296 EVRIIGE 302


>gi|260583958|ref|ZP_05851706.1| UDP-N-acetylmuramate dehydrogenase [Granulicatella elegans ATCC
           700633]
 gi|260158584|gb|EEW93652.1| UDP-N-acetylmuramate dehydrogenase [Granulicatella elegans ATCC
           700633]
          Length = 300

 Score =  211 bits (538), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 100/302 (33%), Positives = 163/302 (53%), Gaps = 7/302 (2%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPI 64
           +    +E+  ++  K   + PLK+ T+ +TGG AE +  P+D H+    +  L    IPI
Sbjct: 1   MKEWWKEQFPEV--KVCFHEPLKKYTYTKTGGEAECLIFPKDKHETAKIIKALQEKQIPI 58

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T++G  SN++VRD GI+G V+ L+      +      +++  A  S   +   AL   + 
Sbjct: 59  TVLGNASNVIVRDGGIKGAVILLNEMTAMKVM---GNKILAEAGVSLIEVTKCALEQSLT 115

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA   E  + V  V  + R G    +  E+L++ YR S +
Sbjct: 116 GLEFACGIPGSVGGAMYMNAGAYGGEVCEVVEFVDVVTRTGEIKRLTNEELEFSYRHSAL 175

Query: 185 TK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            +   ++  V     P  +  I A +  + H RE+ QP++  + GS FK P GH   +LI
Sbjct: 176 QESGDLVIDVCFNLSPGKRESIKAKMEELTHLRESKQPLEYPSCGSVFKRPEGHFTGKLI 235

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           + +G +G + GGA++S+ H  F++N D+AT  D   + + V++ VF Q  + LE E+K +
Sbjct: 236 QDAGLQGFQIGGAQVSKKHAGFIVNIDHATATDYLAVIQHVQEIVFEQFQVRLEPEVKII 295

Query: 304 GD 305
           G+
Sbjct: 296 GE 297


>gi|289551402|ref|YP_003472306.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           lugdunensis HKU09-01]
 gi|315658909|ref|ZP_07911776.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus lugdunensis
           M23590]
 gi|289180933|gb|ADC88178.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           lugdunensis HKU09-01]
 gi|315496033|gb|EFU84361.1| UDP-N-acetylmuramate dehydrogenase [Staphylococcus lugdunensis
           M23590]
          Length = 307

 Score =  211 bits (538), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 96/311 (30%), Positives = 158/311 (50%), Gaps = 7/311 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP- 59
           M    I   L++     R   + N PLK  T+ +TGGNA+    P    +++  +     
Sbjct: 1   MSQEDILTDLQKLVP--RDIIKINEPLKHYTYTKTGGNADFYLSPTKNEEVQAIVRYARQ 58

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            DIP+T +G GSNI++R+ GIRG+V+ L +     +       +I G+  +   ++ +A 
Sbjct: 59  HDIPVTYLGNGSNIIIREGGIRGIVISLLSLNHIAVSDDA---IIAGSGAAIIDVSKAAR 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            H + G  F  GIPGSIGGA YMNAGA   E    +     ++ +G+      ++L+  Y
Sbjct: 116 DHALTGLEFACGIPGSIGGAVYMNAGAYGGEVKDCIDYALCVNEQGDLLKFTNQELELDY 175

Query: 180 RSSEITKDL-IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R+S + +   ++        P   + I A + ++   RE+ QP++  + GS F+ P GH 
Sbjct: 176 RNSIVQQQHLVVLEAAFTLAPGQLDDIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI+ S  +G   GG ++S+ H  FM+N DN T  D E L   V++ V  +  + L  
Sbjct: 236 AGKLIQDSNLQGHRIGGVEVSKKHAGFMVNVDNGTATDYENLIHHVQQVVKEKFDVELHR 295

Query: 299 EIKRLGDFFDH 309
           E++ +GD  D 
Sbjct: 296 EVRIIGDPPDK 306


>gi|199597304|ref|ZP_03210735.1| UDP-N-acetylmuramate dehydrogenase [Lactobacillus rhamnosus HN001]
 gi|199591820|gb|EDY99895.1| UDP-N-acetylmuramate dehydrogenase [Lactobacillus rhamnosus HN001]
          Length = 287

 Score =  211 bits (538), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 90/287 (31%), Positives = 149/287 (51%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAG 79
              + PL   T+ +TGG A+++  P+D+ +++  + +    D+P+T++G  SN++VRD G
Sbjct: 1   MLHDEPLSHYTFTKTGGPADLLAFPKDVAEVQALVEMARERDMPLTVIGNASNLIVRDGG 60

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRG+VL L+      +   N  ++   A         +A R G+ G  F  GIPGS+GGA
Sbjct: 61  IRGLVLILTAMKKITV---NGNDVTAQAGARLIDTTEAAYRAGLTGLEFAAGIPGSVGGA 117

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            +MNAGA N E    + + H + R G        +L ++YR S +     I+  V     
Sbjct: 118 LFMNAGAYNGEVCSVISQAHVLTRAGELKTYNHRELNFRYRHSVVQDTGDIVLSVTFSMK 177

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
              +  I A +  +   R   QP++  + GS FK P  H    +I+K+G +G   GGA++
Sbjct: 178 FGDKPTIRAKMDELNARRAAKQPLEYPSCGSVFKRPPDHFVGPMIQKAGLQGHIIGGAQV 237

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           S+ H  F+IN  NAT  D   +   ++K V  + G+ LE E++ +G+
Sbjct: 238 SKKHAGFIINLGNATATDYLDMIHLIQKTVKAKFGVDLEPEVRIIGE 284


>gi|270292480|ref|ZP_06198691.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sp. M143]
 gi|270278459|gb|EFA24305.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sp. M143]
          Length = 301

 Score =  211 bits (538), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 98/302 (32%), Positives = 153/302 (50%), Gaps = 6/302 (1%)

Query: 7   SRLLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPI 64
             L+ +  +QL G   +   PLK  T+ + GG A+ +  P++ +++   +      +IP 
Sbjct: 1   MTLVTKIQEQLEGIDIRFKEPLKTYTYTKVGGRADYLVLPRNRYEMARVVQFANQENIPW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G  SNI+VR+ GIRG V+        ++   +   +   A  +       ALRH + 
Sbjct: 61  MVLGNASNIIVREGGIRGFVILCDKLNNVSV---DGYTIEAEAGANLIETTRIALRHSLT 117

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           GF F  GIPGSIGGA +MNAGA   E +  +     + ++G    +  + L + YR S I
Sbjct: 118 GFEFACGIPGSIGGAVFMNAGAYGGEIAHILQSCQILTKEGEIETLSAKDLAFGYRHSAI 177

Query: 185 TK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
                ++        P +  II   +  + H RE  QP++  + GS FK P GH A QLI
Sbjct: 178 QDSGAVVLSAKFALAPGNHQIIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLI 237

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
            ++G +G   GG ++SE H  FMIN  + T  D E L + V +KV   SG+ LE E++ L
Sbjct: 238 SEAGLKGYRIGGVEVSEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGVTLEREVRIL 297

Query: 304 GD 305
           G+
Sbjct: 298 GE 299


>gi|312144351|ref|YP_003995797.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Halanaerobium sp.
           'sapolanicus']
 gi|311905002|gb|ADQ15443.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Halanaerobium sp.
           'sapolanicus']
          Length = 308

 Score =  211 bits (538), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 94/311 (30%), Positives = 172/311 (55%), Gaps = 8/311 (2%)

Query: 1   MIYGRISRLLRERGKQLR-GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL- 58
           M       +L ++ +++   + ++N  L + T F+ GG A+++ +PQ+I   +  + L+ 
Sbjct: 1   MNTKSTINILSKKLEKINYLEIEKNKKLAEFTSFKVGGPADLLLKPQEIEAAQKLIPLIM 60

Query: 59  PSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSA 118
            S +P  I+G GSN++V D G RGV++   +     I+  +   +   +    + +A+ A
Sbjct: 61  KSKLPFFILGQGSNLIVSDKGYRGVIIYTGDLNDYQIKGES---ISAESGIELEEIADIA 117

Query: 119 LRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQ 178
           L++ + G  F  GIPGS+GGA YMNAGA + E    +     +++KG    + +++L+  
Sbjct: 118 LKNSLSGLEFASGIPGSLGGALYMNAGAYDGEMKDIITSALFVNQKGELLKLSKKELELD 177

Query: 179 YRSSEITK---DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPT 235
           YR+S +     + +   V L+   + +  I A +  +   R + QP++  + GS FK P 
Sbjct: 178 YRNSILQNKSLNYLALKVNLKLKKDKKANIKAKMEELHQKRWSKQPMELPSAGSIFKRPE 237

Query: 236 GHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGIL 295
           GH    LIEK+G +G + GGA++S+ H  F++N  +AT  D+  L E+++ +++  SG+ 
Sbjct: 238 GHYTGALIEKAGLKGYQIGGAQVSKKHAGFIVNKGDATAEDIIKLIEKIKDEIYKMSGVQ 297

Query: 296 LEWEIKRLGDF 306
           LE E + LGDF
Sbjct: 298 LEVEPRFLGDF 308


>gi|282882198|ref|ZP_06290837.1| UDP-N-acetylmuramate dehydrogenase [Peptoniphilus lacrimalis 315-B]
 gi|300814226|ref|ZP_07094502.1| UDP-N-acetylmuramate dehydrogenase [Peptoniphilus sp. oral taxon
           836 str. F0141]
 gi|281297963|gb|EFA90420.1| UDP-N-acetylmuramate dehydrogenase [Peptoniphilus lacrimalis 315-B]
 gi|300511650|gb|EFK38874.1| UDP-N-acetylmuramate dehydrogenase [Peptoniphilus sp. oral taxon
           836 str. F0141]
          Length = 295

 Score =  211 bits (538), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 94/288 (32%), Positives = 150/288 (52%), Gaps = 4/288 (1%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRD 77
           G+F EN P+K  T F+ GG  E+  +P+D   L   L ++  ++    I+G  +N++V+D
Sbjct: 10  GEFLENEPMKNHTSFKVGGPCELFVRPKDEKSLIEILKIIRKNNYNFYILGNATNVIVKD 69

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G +G+++ + N             +  GA  S K L+ +A  + + G  F  GIPG++G
Sbjct: 70  QGYKGIIISIKNRLKDVKVDGLK--ITAGAGLSLKELSQTAYENSLSGLEFANGIPGTVG 127

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVLR 196
           GA  MNAGA + E    V  V  ID  GN      E++ + YR S++  ++LI+      
Sbjct: 128 GAMTMNAGAYDGEMKNVVESVRFIDNLGNIREYSNEEMDFSYRHSKVGDENLIVLSATFV 187

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
                +  I          R+  QP+   + GSTFK P G+ A +LI+ SG RG    GA
Sbjct: 188 LEKGDKEKIREKFQEFDRRRKEKQPLDLPSAGSTFKRPEGYFAGKLIDDSGLRGFRHNGA 247

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            +S+ HC F++N DNA+  D+    E V+K V+++  + LE E+K +G
Sbjct: 248 GVSQKHCGFVVNYDNASASDVLETIEIVQKVVYDKFSVKLEREVKIIG 295


>gi|268319792|ref|YP_003293448.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           johnsonii FI9785]
 gi|262398167|emb|CAX67181.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           johnsonii FI9785]
          Length = 301

 Score =  211 bits (538), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 88/290 (30%), Positives = 148/290 (51%), Gaps = 3/290 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAG 79
            QEN PL + T+ +TGG A+ +  P+++++L+  +  +  ++IP+T++G  SN+++RD G
Sbjct: 13  IQENIPLSRFTFTKTGGPAQYLAFPKNLNELELLVDTIKENNIPLTVIGNASNLIIRDGG 72

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           I G+VL L+      +  ++   +   A       + +A   G+ G  F  GIPGS+GGA
Sbjct: 73  ISGLVLILTKMDTI-VANKDEATVTADAGARIIDTSEAACEAGLSGLEFAAGIPGSVGGA 131

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            +MNAGA   ET   +  V  + R G       +++++ YR S + +   I+        
Sbjct: 132 VFMNAGAYGGETEFVIKSVCVLTRAGEFKTYTHDEMEFGYRHSLVQETGDIVVSATFGLE 191

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P  +  I A +      R   QP++  + GS FK P GH    +I K+G +G   GGA+ 
Sbjct: 192 PGDKWAIKAKMEYFNGLRRAKQPLEYPSCGSVFKRPAGHFVGPMIIKAGLQGKRIGGAED 251

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFD 308
           S  H  F++N   AT  D   L   ++K +    GI L+ E++ +G   D
Sbjct: 252 SMKHAGFIVNVGGATATDYLDLIHLIQKTIKKNFGIDLQTEVRIIGKEKD 301


>gi|152976271|ref|YP_001375788.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           subsp. cytotoxis NVH 391-98]
 gi|152025023|gb|ABS22793.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cytotoxicus
           NVH 391-98]
          Length = 306

 Score =  211 bits (538), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 92/307 (29%), Positives = 147/307 (47%), Gaps = 5/307 (1%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    + +L +E  +   GK   N  L + T  + GG A++   P  I  ++  L L+  
Sbjct: 1   MGEIIMKQLAKELIEAKVGKVFLNESLARYTTMKIGGPADIFVIPTSISSIEKILALVKK 60

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
             +  T +G GSN+LV D GI GVV+RL                 VG       L+    
Sbjct: 61  YKVNWTAIGRGSNLLVSDKGIEGVVIRLGEGLDHLEVEEATVR--VGGGYPLIKLSTLLS 118

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
           R G+ G  F  GIPGS+GGA YMNAGA+  + S+ +     +   G    + +E++++ Y
Sbjct: 119 RQGLAGLEFASGIPGSVGGAVYMNAGAHKSDISKILTRACVMLEDGTVAWLSKEEMEFSY 178

Query: 180 RSSEITKD--LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGH 237
           R+S +      I+     +    ++  I   +     +R   QP      GS F+NP  H
Sbjct: 179 RTSVLQTKLPGIVLGAEFQLERGNREEIVRIMQKNKEYRRDTQPWSHPCAGSIFRNPLPH 238

Query: 238 SAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLE 297
            A  LIE++G RG + GGAK+SE+H NF++N   A+  D+  L   V++ +  +  I + 
Sbjct: 239 FAGDLIERAGLRGYQIGGAKVSEVHGNFIVNTGTASAQDVLDLIGFVKRNIKEKFDIDMH 298

Query: 298 WEIKRLG 304
            E++ +G
Sbjct: 299 TEVEIIG 305


>gi|159030201|emb|CAO91093.1| murB [Microcystis aeruginosa PCC 7806]
          Length = 292

 Score =  211 bits (538), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 89/289 (30%), Positives = 147/289 (50%), Gaps = 4/289 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAG 79
            + +  L   T +R GG A+   +P ++ +L+         D+P+T++G GSN+L+ D G
Sbjct: 2   IKTSVSLADFTSYRVGGRAQWYAEPVNLEELREVFAWWRAQDLPLTVLGAGSNLLISDRG 61

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           + G+VL   +   S         +   A      +A  A + G  G  +  GIPG++GGA
Sbjct: 62  LPGLVLNTRHLRSSCF-DAETATITAAAGEPLPKIAWRAAKRGWRGLEWAVGIPGTVGGA 120

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRG-- 197
             MNAGA+    +  +V    ++  G    + +E L Y YRSS +  D  +         
Sbjct: 121 VVMNAGAHTSCVADRLVRALVLNPDGQLETLSKEDLNYSYRSSSLQGDQRLVIEATFQLE 180

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
             ++   I A  ++   HR++ QP    + GS F+NP    A  LIE+ G +G + GGA+
Sbjct: 181 ATDNSEEIMAITSHNLRHRKSTQPYDRPSCGSVFRNPKPQYAGALIEEMGLKGYQIGGAQ 240

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           +SELH NF++N  +A   D+  L   V+++VF++  + LE E+K LG+F
Sbjct: 241 VSELHANFILNIGSAKASDILRLIRHVQEQVFDRWSLWLEPEVKVLGEF 289


>gi|300813068|ref|ZP_07093446.1| UDP-N-acetylmuramate dehydrogenase [Lactobacillus delbrueckii
           subsp. bulgaricus PB2003/044-T3-4]
 gi|300495909|gb|EFK31053.1| UDP-N-acetylmuramate dehydrogenase [Lactobacillus delbrueckii
           subsp. bulgaricus PB2003/044-T3-4]
          Length = 297

 Score =  211 bits (538), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 88/287 (30%), Positives = 145/287 (50%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAG 79
            QEN PL + T+ +TGG AE +  P+ + +LK  L  +  D +PIT++G  SN+++RD G
Sbjct: 13  LQENIPLSRYTFTQTGGPAEYLAFPKTLAELKELLAAVKEDQLPITVIGNASNLIIRDKG 72

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           I+G+V+ L+      +      ++   A       + +A   G+ G  F  GIPGS+GGA
Sbjct: 73  IKGLVIILTEMKEIKV---EADKVHAQAGARIIDTSFAAGEAGLSGLEFAAGIPGSVGGA 129

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR-GF 198
            +MNAGA   ET   +     + R G        +L + YR S + ++  I         
Sbjct: 130 VFMNAGAYGGETKDCLESATVVTRDGEVKTYTNAELHFSYRHSLLQENGEIVIAATFALK 189

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
              +  I   +  +   R   QP++  + GS FK PTGH    ++ K+G +G + GGA++
Sbjct: 190 AGDKATILDQMNYLNALRSYKQPLEYPSCGSVFKRPTGHFVGPMLIKAGLQGKQIGGAQV 249

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           S  H  F++N   AT  D   L   ++K +  + GI L+ E++ +G+
Sbjct: 250 STKHAGFIVNKGGATATDYLNLIHYIQKTIKEKDGIALQTEVRIIGE 296


>gi|225859156|ref|YP_002740666.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae 70585]
 gi|254765584|sp|C1C7Z0|MURB_STRP7 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|225721661|gb|ACO17515.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae 70585]
          Length = 301

 Score =  211 bits (538), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 96/298 (32%), Positives = 149/298 (50%), Gaps = 6/298 (2%)

Query: 11  RERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVG 68
            +  + L G   +   PL   ++ + GG A+ +  P++  +L   +      +IP  ++G
Sbjct: 5   EKMLEILEGIDIRFQEPLHSYSYTKVGGEADYLVFPRNRFELARVVKFANQENIPWMVLG 64

Query: 69  LGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHF 128
             SNI+VRD GIRG V+        ++   +   +   A  +       ALRH + GF F
Sbjct: 65  NASNIIVRDGGIRGFVILCDKLNNVSV---DGYTIEAEAGANLIETTRIALRHSLTGFEF 121

Query: 129 FYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-D 187
             GIPGS+GGA +MNAGA   E +  +     + + G    +  + L + YR S I +  
Sbjct: 122 ACGIPGSVGGAVFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAKDLAFGYRHSAIQESG 181

Query: 188 LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSG 247
            ++  V     P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G
Sbjct: 182 AVVLSVKFALAPGTHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAG 241

Query: 248 CRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            +G   GG ++SE H  FMIN  + T  D E L + V +KV   SGI LE E++ LG+
Sbjct: 242 LKGYRIGGVEVSEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGITLEREVRILGE 299


>gi|323140619|ref|ZP_08075543.1| UDP-N-acetylmuramate dehydrogenase [Phascolarctobacterium sp. YIT
           12067]
 gi|322414883|gb|EFY05678.1| UDP-N-acetylmuramate dehydrogenase [Phascolarctobacterium sp. YIT
           12067]
          Length = 300

 Score =  211 bits (538), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 102/287 (35%), Positives = 156/287 (54%), Gaps = 4/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAG 79
                P+ + T FR GG A++M  PQ   +L+  L     S +P+T++G GSN+LVRD G
Sbjct: 15  LLAEEPMAKHTSFRIGGPADLMAMPQSEQELQQLLQRAGESKVPVTLIGNGSNLLVRDKG 74

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRG+V++L N     +     C +  G+  S  + +  A   G+ G  F  GIPGSIGGA
Sbjct: 75  IRGLVIKLGNMLNDVVAD--GCTLTFGSGVSLAAASRKAAELGLSGMEFAVGIPGSIGGA 132

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            YMNAGA + E ++ V  V  ++  G    +    L + YR + +     I+T V +R  
Sbjct: 133 VYMNAGAYDGEMAKVVTGVRVMELDGTISELAAAALDFGYRHTALQGSGKIVTAVTVRLT 192

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
              +  I+  +A+  + R T QP++  + GS FK P+G+ A  LI+++G +G   GGA++
Sbjct: 193 AGDKQAIADKMADFSNRRITKQPLELPSAGSMFKRPSGYFAGTLIDQTGLKGYTVGGAQV 252

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H  F++N   AT  D+  L   V+ KVF   G+ LE E+  LG+
Sbjct: 253 SEKHAGFVVNIGGATAADVLQLICDVQDKVFAAHGVHLEPEVLVLGE 299


>gi|323340232|ref|ZP_08080496.1| UDP-N-acetylmuramate dehydrogenase [Lactobacillus ruminis ATCC
           25644]
 gi|323092423|gb|EFZ35031.1| UDP-N-acetylmuramate dehydrogenase [Lactobacillus ruminis ATCC
           25644]
          Length = 301

 Score =  211 bits (538), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 89/303 (29%), Positives = 150/303 (49%), Gaps = 6/303 (1%)

Query: 6   ISRLLRERGKQLRGKF-QENFPLKQITWFRTGGNAEVMFQPQDIHDL-KYFLTLLPSDIP 63
           +  +  +  ++L+G   + N PL + T  RTGG A+    P    +  K  L    + + 
Sbjct: 1   MDNIETKIMQELKGIIVKPNEPLCKYTNTRTGGPADFAVFPTSTEEARKTVLFTKENGLD 60

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           +T++G  SN++V+D GI GVV+ L+      I   +  +++  A  +      +A   G+
Sbjct: 61  LTVIGNASNLIVKDGGISGVVMILTKMDSVRI---DGDKVVAMAGAALIDATQAAYEAGL 117

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            GF F  GIPGS+GGA +MNAGA + E       V  + R G        +L + YR S 
Sbjct: 118 TGFEFASGIPGSVGGAIFMNAGAYDGEIKDIAESVTVLTRSGEIRTYKNAELDFGYRHSR 177

Query: 184 IT-KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
           +  +D I+           +  I A +  +   R + QP++  + GS FK P GH   +L
Sbjct: 178 LQDEDDIVLEATFLLKHGDKEKIHARMEELSFLRASKQPLEYPSCGSVFKRPVGHYTGKL 237

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           +  +  +G   GGA++S+ H  F++N  NAT  D + + + V+  VF + G+ LE E++ 
Sbjct: 238 VHDANLQGFTIGGAQVSKKHAGFIVNVGNATATDYQNVIKHVQDVVFEKFGVRLETEVRI 297

Query: 303 LGD 305
           +G 
Sbjct: 298 IGK 300


>gi|56965729|ref|YP_177463.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus clausii
           KSM-K16]
 gi|81364905|sp|Q5WAV8|MURB_BACSK RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|56911975|dbj|BAD66502.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus clausii
           KSM-K16]
          Length = 311

 Score =  211 bits (538), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 92/313 (29%), Positives = 151/313 (48%), Gaps = 7/313 (2%)

Query: 3   YGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSD 61
           Y  I + L     +  G   E+  L + T+ + GG A++   PQ   + +  L       
Sbjct: 4   YIEICKPLWTLLPE--GTIHEDERLCKHTYTQMGGAADLFITPQSYEETQTVLKFAHEHR 61

Query: 62  IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRH 121
           +P+T++G GSN++V+D GIRG+ L L              E++     +    +  A   
Sbjct: 62  VPVTLLGNGSNVIVKDGGIRGITLSLKKLNTIT---CTGVELVAQTGATIIEASRRARDA 118

Query: 122 GIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS 181
            + G  F  GIPG++GGA YMNAGA   + +  +  V  +  +G    + +E+  + YR 
Sbjct: 119 ELTGLEFACGIPGTVGGAFYMNAGAYGGQIADVLESVLVLTEQGEFKTLSKEEFDFDYRK 178

Query: 182 SEIT-KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
           S  + K  I      R        I A +  +   RET QP++  + GS FK P G  A 
Sbjct: 179 SVFSAKRYIALEGTFRLQKGDMAQIQAKMDELTIARETKQPLEYPSCGSVFKRPPGMFAG 238

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LI+ SG +G   GGA++S+ H  F++N DNAT  +   L   V++ V ++ G+ LE E+
Sbjct: 239 KLIQDSGLQGTRIGGAEVSKKHAGFIVNVDNATATEYMSLVRHVQQTVKDKFGVELETEV 298

Query: 301 KRLGDFFDHQIVD 313
             +G+  +  + D
Sbjct: 299 ITIGEDIEEPVSD 311


>gi|228992645|ref|ZP_04152571.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           pseudomycoides DSM 12442]
 gi|228766977|gb|EEM15614.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           pseudomycoides DSM 12442]
          Length = 306

 Score =  211 bits (538), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 88/307 (28%), Positives = 150/307 (48%), Gaps = 5/307 (1%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    + +L +E  +   GK  EN  L + T  + GG A+++  P  +  ++  L L+  
Sbjct: 1   MGEIIMKQLAKELIEAEVGKVLENEALARYTTMKIGGPADILIVPSSVAGVENTLDLVKK 60

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +   T +G GSN+LV D GI    + +      +        + VG       L+    
Sbjct: 61  YNTKWTAIGRGSNLLVSDKGIE--GVVIRLGEGLDHLEVEGTTVRVGGGYPLIKLSTLLS 118

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
           R G+ G  F  GIPGS+GGA YMNAGA+  + S+ ++    +   G    + +E++ + Y
Sbjct: 119 RQGLAGLEFASGIPGSVGGAVYMNAGAHKSDMSEILMSARIMFEDGTMKWLTKEEMGFSY 178

Query: 180 RSSEITKDLI--ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGH 237
           R+S +       +    L+    ++  I   +     +R   QP      GS F+NP  +
Sbjct: 179 RTSVLQTKRPGIVVEAKLQLKEGNREEIVGVMQKNKDYRRETQPWNHPCAGSIFRNPLPN 238

Query: 238 SAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLE 297
            A  L+E++G RG + GGAKISE+H NF++NA +A+  D+  L   V+K +  + G+ + 
Sbjct: 239 FAGDLVERAGLRGHQIGGAKISEMHGNFIVNAGSASAQDVLDLIAFVKKTIKEKFGVDMH 298

Query: 298 WEIKRLG 304
            E++ +G
Sbjct: 299 TEVEIIG 305


>gi|312111932|ref|YP_003990248.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus sp.
           Y4.1MC1]
 gi|311217033|gb|ADP75637.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus sp.
           Y4.1MC1]
          Length = 308

 Score =  211 bits (538), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 100/309 (32%), Positives = 165/309 (53%), Gaps = 9/309 (2%)

Query: 1   MIYGRISRLLRERGKQLRGK--FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL 58
           M+Y     ++ +   ++ G+     + PLK  T  + GG A+ +  P+    +   + L 
Sbjct: 1   MMYEN--NVIYQELVRICGEKNVLRDEPLKYHTLVKIGGKADFLVWPETYEQVVEVIRLK 58

Query: 59  -PSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANS 117
               +P T++G GSN++VRD GIRG+V++L +     +E      +I  +    K+++  
Sbjct: 59  EKHHLPFTLLGNGSNVIVRDGGIRGIVVQLKHLTEIKVEGEK---IIAQSGADIKAVSRV 115

Query: 118 ALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKY 177
           AL H + G  F  GIPGS+GGA  MNAGA + E    +  V  + + G Q ++ ++ L+ 
Sbjct: 116 ALEHSLTGLEFACGIPGSVGGAIMMNAGAYDGEIKDVIDHVKVVTQTGEQKILRKDDLQL 175

Query: 178 QYRSSEITK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTG 236
            YR+S I+K + I+   V +        I   + ++   RE+ QP++  + GS FK P G
Sbjct: 176 GYRTSIISKTNDIVLEAVFQLKKGDPQKIKEKMDDLTFRRESKQPLEYPSVGSVFKRPPG 235

Query: 237 HSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILL 296
           + A +LI+ SG +G   GGA++S  H  F+IN +NAT  D     E VRK V  + G+ L
Sbjct: 236 YFAGKLIQDSGLQGKGVGGAEVSTKHAGFIINKNNATASDYIATIELVRKTVKEKFGVDL 295

Query: 297 EWEIKRLGD 305
           E E+K +G+
Sbjct: 296 ELEVKIIGE 304


>gi|146318458|ref|YP_001198170.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus suis
           05ZYH33]
 gi|146320651|ref|YP_001200362.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus suis
           98HAH33]
 gi|253751592|ref|YP_003024733.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus suis
           SC84]
 gi|253753493|ref|YP_003026634.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus suis
           P1/7]
 gi|253755681|ref|YP_003028821.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus suis
           BM407]
 gi|187609741|sp|A4W0S3|MURB_STRS2 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|187609742|sp|A4VUI1|MURB_STRSY RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|145689264|gb|ABP89770.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus suis 05ZYH33]
 gi|145691457|gb|ABP91962.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus suis 98HAH33]
 gi|251815881|emb|CAZ51492.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus suis
           SC84]
 gi|251818145|emb|CAZ55942.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus suis
           BM407]
 gi|251819739|emb|CAR45602.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus suis
           P1/7]
 gi|292558243|gb|ADE31244.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus suis GZ1]
          Length = 302

 Score =  211 bits (538), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 99/306 (32%), Positives = 154/306 (50%), Gaps = 7/306 (2%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPI 64
           +   +R   + +    + + PLK+ T+ + GG  + +  P++ +++   +       IP 
Sbjct: 1   MKDKIRLELEGI--DIRFDEPLKEYTYTKVGGAVDYLAFPRNRYEIVRIVEFAKREGIPW 58

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G  SNI+VRD GIRG V+R+       +   +   +   A  +       AL H + 
Sbjct: 59  QVLGNSSNIIVRDGGIRGFVIRMDKLNSVTV---SGYTIEAEAGANLIETTKVALFHSLS 115

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           GF F  GIPGSIGGA YMNAGA   E +  +V    +   G    +   +L++ YRSS +
Sbjct: 116 GFEFACGIPGSIGGAVYMNAGAYGGEVAHILVSAQILTPAGYVETLDNRELRFGYRSSIL 175

Query: 185 TKDL-IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            ++  I+        P +  +I   +A + H RE  QP++  + GS FK P GH A QLI
Sbjct: 176 QENGAIVLSAKFALRPGNHTVIQQEMARLTHLRELKQPLEYPSCGSVFKRPLGHFAGQLI 235

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
             +G +G   GG ++SE H  FM+N +N T  D E L   V + V   SGI LE E++ +
Sbjct: 236 MDAGLKGYRIGGVEVSEKHAGFMVNIENGTASDYENLIAHVIQVVEKSSGITLEREVRII 295

Query: 304 GDFFDH 309
           GD  D 
Sbjct: 296 GDPADT 301


>gi|254520587|ref|ZP_05132643.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium sp.
           7_2_43FAA]
 gi|226914336|gb|EEH99537.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium sp.
           7_2_43FAA]
          Length = 306

 Score =  211 bits (538), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 91/302 (30%), Positives = 159/302 (52%), Gaps = 7/302 (2%)

Query: 8   RLLRERGKQL--RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           ++     K+         +  +K    FR GG A+++  P++   +   + +    +IP 
Sbjct: 5   KVFENLFKEFYKSENIILDAEMKNYVHFRVGGPADILLIPENKEQIIRTIEICNEKNIPF 64

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            +VG GSN+LV+D GI GVV++L++    N+       +        K ++N+AL+  + 
Sbjct: 65  YVVGNGSNLLVKDGGIEGVVIKLNDVKNINVY---GDIVEAECGAMLKDVSNAALKSSLT 121

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           GF F  GIPG++GGA +MNAGA N E +  +     ID +G    + +++L+  YRSS +
Sbjct: 122 GFEFACGIPGTVGGAVFMNAGAYNGEIANVIDSAEVIDNEGKILSLSKDELELGYRSSIV 181

Query: 185 TK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            K + I+     +     +  I   + ++   RE+ QP++  + GSTFK P G+ A +LI
Sbjct: 182 MKKNYIVLSAKFKLQNGDEKEIKEVVDDLTCKRESKQPLEYPSAGSTFKRPEGYFAGKLI 241

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           + +G +G   GGA +SE H  F+IN + AT  D+  L   ++ +V  Q  + L  E++ +
Sbjct: 242 QDAGLKGYSIGGAAVSEKHSGFVINKNGATAKDILDLIAYIQSEVKRQFDVELHPEVRII 301

Query: 304 GD 305
           G+
Sbjct: 302 GE 303


>gi|306824973|ref|ZP_07458316.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sp. oral taxon
           071 str. 73H25AP]
 gi|304432800|gb|EFM35773.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sp. oral taxon
           071 str. 73H25AP]
          Length = 304

 Score =  211 bits (538), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 96/302 (31%), Positives = 154/302 (50%), Gaps = 6/302 (1%)

Query: 7   SRLLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPI 64
             L+ +  +QL G   +   PLK  T+ + GG A+ +  P++ +++   +      +IP 
Sbjct: 4   MTLVTKIQEQLEGIDIRFKEPLKTYTYTKVGGRADYLVLPRNRYEMARVVQFANQENIPW 63

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G  SNI+VRD GIRG V+        ++   +   +   A  +       ALRH + 
Sbjct: 64  MVLGNASNIIVRDGGIRGFVILCDKLNNVSV---DGYTIEAEAGANLIETTRIALRHSLT 120

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           GF F  GIPGS+GGA +MNAGA   E +  +     + ++G    +  ++L + YR S +
Sbjct: 121 GFEFACGIPGSVGGAVFMNAGAYGGEIAHILQSCQILTKEGEIETLSAKELAFGYRHSAV 180

Query: 185 TK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
                ++        P +  +I   +  + H RE  QP++  + GS FK P GH A QLI
Sbjct: 181 QDSGAVVLSAKFALSPGNHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLI 240

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
            ++G +G   GG ++SE H  FMIN  + T  D E L + V +KV   SG+ LE E++ L
Sbjct: 241 SEAGLKGYRIGGVEVSEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGVTLEREVRIL 300

Query: 304 GD 305
           G+
Sbjct: 301 GE 302


>gi|74316139|ref|YP_313879.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thiobacillus
           denitrificans ATCC 25259]
 gi|90109794|sp|Q3SMH1|MURB_THIDA RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|74055634|gb|AAZ96074.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Thiobacillus
           denitrificans ATCC 25259]
          Length = 324

 Score =  211 bits (538), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 97/306 (31%), Positives = 148/306 (48%), Gaps = 14/306 (4%)

Query: 14  GKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNI 73
              LRG+F  N P+ +   +R GG+A  ++ P D+ DL + +  +P+D  I +VGLGSN+
Sbjct: 17  APVLRGRFLYNEPMSRHVSWRAGGSARRLYVPADLEDLVWLVRSVPADEAIHMVGLGSNL 76

Query: 74  LVRDAGIRGVVLRLS------------NAGFSNIEVRNHCEMIVGARCSGKSLANSALRH 121
           LVRD G+ GVV+ L             +        R+   +   A  +   LA  A  H
Sbjct: 77  LVRDGGVAGVVILLHGVLTKLALESRTHGLPPAPPARDTAVVYAQAGVASPKLARFAATH 136

Query: 122 GIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS 181
           G+ G  F  GIPG++GGA  MNAG    ET   +V++H +DR+G  +    E+    YR 
Sbjct: 137 GLVGGEFLAGIPGTVGGAIAMNAGCYGSETWDTLVQLHTLDRQGQLNERLPEEYVTGYRH 196

Query: 182 SEI--TKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
           + +    +        R            I ++   R   QP+     GS F+NP G  A
Sbjct: 197 AALKRPHEEWFIGGWFRLERGDGAASRERIRSLLKTRIASQPLNLPNAGSVFRNPPGDFA 256

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LIE  G +G   G A++S  H NF++N   AT  D+E L E V   V  ++ + L  E
Sbjct: 257 ARLIEACGLKGHRIGDAQVSTKHANFIVNVGKATATDIERLIEHVEDSVEARTNVRLMRE 316

Query: 300 IKRLGD 305
           ++ +G+
Sbjct: 317 VRIIGE 322


>gi|302336326|ref|YP_003801533.1| UDP-N-acetylmuramate dehydrogenase [Olsenella uli DSM 7084]
 gi|301320166|gb|ADK68653.1| UDP-N-acetylmuramate dehydrogenase [Olsenella uli DSM 7084]
          Length = 307

 Score =  211 bits (537), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 94/305 (30%), Positives = 144/305 (47%), Gaps = 6/305 (1%)

Query: 4   GRISRLLRERGKQLRGK--FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS- 60
               + L  R +Q+ G+     + P+   T F  GG A++   P DI +    +      
Sbjct: 5   ADHLQALTWRLRQIVGEDGVLVDEPMSAHTTFEIGGPADLFVIPDDIEEACEAIAACREA 64

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
                ++G GS++LV D G RGVV+ LS+   +        EM   A  S +  +  A  
Sbjct: 65  GEECFVLGCGSDLLVSDEGYRGVVIALSDGLLNV--SVEGEEMTCQAGVSLREASEMACE 122

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
            G+ G  F  GIPGS+GGA +MNAGA     +  +  V  +   G+   IP  +L   YR
Sbjct: 123 LGLAGLEFACGIPGSVGGACFMNAGAYGGCIADILSSVCALMPDGSLANIPVGELALGYR 182

Query: 181 SSEITKDL-IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
            S +  +  ++     R        I A + ++   RE  QP+   + GSTFK P GH A
Sbjct: 183 KSRVRDEGLVVLSATFRLREGRPEDIRARMDDLTQRREEKQPLDRPSAGSTFKRPEGHFA 242

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LI  +G +G + GGA +S  H  F++N   AT  D+  +   V+ +V  Q G+ LE E
Sbjct: 243 GKLITDAGLKGYQHGGAGVSSKHAGFVVNLGGATAADVRAVISHVQDEVERQFGVRLEPE 302

Query: 300 IKRLG 304
           ++ LG
Sbjct: 303 VRFLG 307


>gi|322376236|ref|ZP_08050729.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sp. M334]
 gi|321282043|gb|EFX59050.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sp. M334]
          Length = 301

 Score =  211 bits (537), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 96/298 (32%), Positives = 148/298 (49%), Gaps = 6/298 (2%)

Query: 11  RERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVG 68
            +  + L G   +   PL   ++ + GG A+ +  P++  +L   +      +IP  ++G
Sbjct: 5   EKMLEILEGIDIRFKEPLHSYSYTKVGGEADYLVFPRNRFELARVVKFANQENIPWMVLG 64

Query: 69  LGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHF 128
             SNI+VRD GIRG V+        ++   +   +   A  +       ALRH + GF F
Sbjct: 65  NASNIIVRDGGIRGFVILCDKLNNVSV---DGYTIEAEAGANLIETTRIALRHSLTGFEF 121

Query: 129 FYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-D 187
             GIPGS+GGA +MNAGA   E +  +     + + G    +  + L + YR S I +  
Sbjct: 122 ACGIPGSVGGAVFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAQGLAFGYRHSAIQESG 181

Query: 188 LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSG 247
            ++        P S  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G
Sbjct: 182 AVVLSAKFALAPGSHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAG 241

Query: 248 CRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            +G   GG ++SE H  FMIN  + T  D E L E V +KV   SG+ LE E++ LG+
Sbjct: 242 LKGYRIGGVEVSEKHAGFMINVADGTAKDYEDLIESVIEKVKEHSGVTLEREVRILGE 299


>gi|288905429|ref|YP_003430651.1| UDP-N-acetylenolpyruvoylglucosamine [Streptococcus gallolyticus
           UCN34]
 gi|306831510|ref|ZP_07464668.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus gallolyticus
           subsp. gallolyticus TX20005]
 gi|325978419|ref|YP_004288135.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           gallolyticus subsp. gallolyticus ATCC BAA-2069]
 gi|288732155|emb|CBI13720.1| UDP-N-acetylenolpyruvoylglucosamine [Streptococcus gallolyticus
           UCN34]
 gi|304426295|gb|EFM29409.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus gallolyticus
           subsp. gallolyticus TX20005]
 gi|325178347|emb|CBZ48391.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           gallolyticus subsp. gallolyticus ATCC BAA-2069]
          Length = 300

 Score =  211 bits (537), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 95/300 (31%), Positives = 150/300 (50%), Gaps = 6/300 (2%)

Query: 9   LLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITI 66
           +L    ++L+G   + + PLK+ T+ + GG A+ +  P++ ++L   +T    ++IP  +
Sbjct: 1   MLEFLNEELKGIDIRVDEPLKKYTYTKVGGPADYLAFPRNRYELARIVTFANKNNIPWMV 60

Query: 67  VGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGF 126
           +G  SNI+VRD GIRG V+         +   N   +   A  +       A  H + GF
Sbjct: 61  LGNASNIIVRDGGIRGFVIMFDKLNTVTV---NGYVIEAEAGANLIETTRIAKFHSLTGF 117

Query: 127 HFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK 186
            F  GIPGS+GGA +MNAGA   E S  +V    I ++G    I    +K+ YR S +  
Sbjct: 118 EFACGIPGSVGGAVFMNAGAYGGEISHILVSAQVITKEGEIKTIEARDMKFGYRHSAVQD 177

Query: 187 -DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEK 245
              ++        P    +I   +A + H RE  QP++  + GS FK P GH A QLI +
Sbjct: 178 SGDVVISAKFALKPGDYVLIEQEMARLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISE 237

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +  +G   GG ++S+ H  FM+N  +    D E L   V   V   SG+ LE E++ +G+
Sbjct: 238 ANLKGHRIGGVEVSKKHAGFMVNVADGNAQDYEDLIAHVIDTVEQNSGVRLEREVRIIGE 297


>gi|228998691|ref|ZP_04158278.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus mycoides
           Rock3-17]
 gi|229006193|ref|ZP_04163879.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus mycoides
           Rock1-4]
 gi|228755034|gb|EEM04393.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus mycoides
           Rock1-4]
 gi|228761159|gb|EEM10118.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus mycoides
           Rock3-17]
          Length = 306

 Score =  211 bits (537), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 89/307 (28%), Positives = 150/307 (48%), Gaps = 5/307 (1%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    + +L +E  +   GK  EN  L + T  + GG A+++  P  +  ++  L L+  
Sbjct: 1   MGEIIMKQLAKELIEAEVGKVLENEALARYTTMKIGGPADILIVPSSVAGVENTLDLVKK 60

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +   T +G GSN+LV D GI    + +      +        + VG       L+    
Sbjct: 61  YNTKWTAIGRGSNLLVSDKGIE--GVVIRLGEGLDHLEVEGTTVRVGGGYPLIKLSTLLS 118

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
           R G+ G  F  GIPGS+GGA YMNAGA+  + S+ ++    +   G    + +E++ + Y
Sbjct: 119 RQGLAGLEFASGIPGSVGGAVYMNAGAHKSDMSEILMSARIMFEDGTMKWLTKEEMGFSY 178

Query: 180 RSSEITKDLI--ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGH 237
           R+S +       +    L+    ++  I   +     +R   QP      GS F+NP  +
Sbjct: 179 RTSVLQTKRPGIVVEAKLQLKEGNREEIVGVMQKNKDYRRETQPWNHPCAGSIFRNPLPN 238

Query: 238 SAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLE 297
            A  L+EK+G RG + GGAKISE+H NF++NA +A+  D+  L   V+K +  + G+ + 
Sbjct: 239 FAGDLVEKAGLRGHQIGGAKISEMHGNFIVNAGSASAQDVLDLIAFVKKTIKEKFGVDMH 298

Query: 298 WEIKRLG 304
            E++ +G
Sbjct: 299 TEVEIIG 305


>gi|238853259|ref|ZP_04643644.1| UDP-N-acetylmuramate dehydrogenase [Lactobacillus gasseri 202-4]
 gi|238834143|gb|EEQ26395.1| UDP-N-acetylmuramate dehydrogenase [Lactobacillus gasseri 202-4]
          Length = 301

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 86/290 (29%), Positives = 144/290 (49%), Gaps = 3/290 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAG 79
            QEN PL + T+ +TGG A+ +  P+++ +LK  +  +  +++P+T++G  SN+++RD G
Sbjct: 13  IQENIPLSRFTFTKTGGPAQYLAFPKNLEELKILVETVKTNNLPLTVIGNASNLIIRDGG 72

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           I G+VL L+                  A       + +A    + G  F  GIPGS+GGA
Sbjct: 73  IAGLVLILTKMDKIVANQEEATVT-ADAGARIIDTSEAACEASLSGLEFAAGIPGSVGGA 131

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            +MNAGA   ET   +  V  + R+G       +++++ YR S + +   I+        
Sbjct: 132 VFMNAGAYGGETEFVIKSVRVLTREGKFKTYTHDEMEFGYRHSLVQETGDIVISATFGLE 191

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P  +  I A +      R   QP++  + GS FK PTGH    +I K+G +G   GGA+ 
Sbjct: 192 PGDKWAIKAKMEYFNGLRRAKQPLEYPSCGSVFKRPTGHFVGPMIIKAGLQGKRIGGAED 251

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFD 308
           S+ H  F++N   AT  D   L   ++K +     + L+ E++ +G   D
Sbjct: 252 SKKHAGFIVNVGGATATDYLDLIHLIQKTIKKDFDVDLQTEVRIIGKEKD 301


>gi|154707354|ref|YP_001425280.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Coxiella burnetii
           Dugway 5J108-111]
 gi|189028922|sp|A9KER1|MURB_COXBN RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|154356640|gb|ABS78102.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Coxiella burnetii
           Dugway 5J108-111]
          Length = 316

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 103/312 (33%), Positives = 151/312 (48%), Gaps = 18/312 (5%)

Query: 11  RERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLG 70
           +E   +LRG+   + PL + T +R GG AE  ++P D+ DL+ FLT LPSD P+T +GLG
Sbjct: 3   KENFTRLRGELFCDHPLARYTSWRVGGKAERFYRPADLFDLQDFLTQLPSDEPLTWLGLG 62

Query: 71  SNILVRDAGIRGVVLRLSNA------------------GFSNIEVRNHCEMIVGARCSGK 112
           SN+L+RD GI+G V+   N                               +   A  +  
Sbjct: 63  SNVLIRDGGIKGTVILTLNRLKELSVVNSQLVFREKSGTEDFFSGNGKTIIRAEAGVTCA 122

Query: 113 SLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPR 172
            LA   +  G+    FF GIPG++GGA  MNAGA   ET + V+ V  ++ +G       
Sbjct: 123 KLAKFCVSQGLEDGAFFAGIPGTVGGALAMNAGAFGGETWRTVIGVETMNHQGEILKRTP 182

Query: 173 EQLKYQYRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFK 232
           ++ K  YR  E  ++               +    AI  +   R   QPI + + GS F+
Sbjct: 183 DEFKIHYRQVEGLENQFFIAGYFCFNHGDPDKAKTAINALLKKRNLSQPIGKYSCGSVFR 242

Query: 233 NPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQS 292
           NP G  A +LIE +G +G   G A++SE H NF++N  NA+  D+E L   V + V    
Sbjct: 243 NPPGDYAARLIESAGLKGKSIGNAEVSEKHANFILNKGNASAADIEALIHYVAQHVSQNH 302

Query: 293 GILLEWEIKRLG 304
           GI L  E+  +G
Sbjct: 303 GIQLVKEVHIIG 314


>gi|86137676|ref|ZP_01056253.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Roseobacter sp.
           MED193]
 gi|85826011|gb|EAQ46209.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Roseobacter sp.
           MED193]
          Length = 314

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 112/312 (35%), Positives = 166/312 (53%), Gaps = 15/312 (4%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPIT 65
           +S L  +    +RG+  EN  L  +TW R GG A+ +FQP D+ DL++FL  LP+++ + 
Sbjct: 1   MSELKTKTMPSVRGRLTENRSLSDLTWLRVGGAADYLFQPADVEDLRHFLAELPAEVVVF 60

Query: 66  IVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGG 125
            +G+GSN++VRD G+R VV+RL     +   +  +   +     +  +            
Sbjct: 61  PMGVGSNLIVRDGGLRAVVVRLGRGFNA---IETNGNQVTAGAAALDAHVARKAADAGLD 117

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT 185
             F   IPGSIGGA  MNAG      + + V    + R+G    I  E+L++QYR + + 
Sbjct: 118 LTFLRTIPGSIGGAVRMNAGCYGSYIADHFVSAQIVTRQGELRQITAEELQFQYRQTALP 177

Query: 186 KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGH-------- 237
           +  ++    LR        + A +      R+  QP KE++ GSTF+NP G         
Sbjct: 178 EGAVLVSACLRAEVAEPEALHARMEAQLKKRDETQPTKERSAGSTFRNPAGFSSTGRADD 237

Query: 238 ----SAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSG 293
                AW++I+ +G RG   GGA++SE H NFMIN   AT  DLE LGE VRKKV+  SG
Sbjct: 238 VQDLKAWKVIDDAGLRGARIGGAQMSEKHSNFMINTGGATAADLETLGEDVRKKVYANSG 297

Query: 294 ILLEWEIKRLGD 305
           I L+WEI R+G+
Sbjct: 298 IELQWEIMRVGE 309


>gi|148265983|ref|YP_001232689.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacter
           uraniireducens Rf4]
 gi|187609721|sp|A5G8J8|MURB_GEOUR RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|146399483|gb|ABQ28116.1| UDP-N-acetylmuramate dehydrogenase [Geobacter uraniireducens Rf4]
          Length = 300

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 97/294 (32%), Positives = 144/294 (48%), Gaps = 4/294 (1%)

Query: 12  ERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLT-LLPSDIPITIVGLG 70
                LRG+ + N P+ + T  + GG A+    P D  DL+  +  +L   +P  +VG G
Sbjct: 8   RLVAALRGELRFNEPMARHTALKVGGPADFFAIPADPSDLQSLMAVILEMGMPYLVVGGG 67

Query: 71  SNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFY 130
            N+LVRD G R   + +S   F ++E      +   A  + + L   A   G+ G  F  
Sbjct: 68  YNLLVRDGGFR--GVVISLKQFCSMEKLPDNRLRAEAGSTNQQLVRFANGQGLTGLEFLS 125

Query: 131 GIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLII 190
           GIPG +GGA  +NAGA+     + V  +  +   G   V  RE L+Y YR  E+    I+
Sbjct: 126 GIPGMVGGALSVNAGAHGRSVLELVESLTTLQ-GGKITVTFREDLRYGYRHLELKPGEIV 184

Query: 191 THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRG 250
              V          I   I     HR   Q +     GS FKNP G  AW+LI+++G RG
Sbjct: 185 LAAVFSLAAGDAEEIEGRIQGYLEHRRNSQRVGYPNAGSFFKNPEGKQAWRLIDEAGLRG 244

Query: 251 LEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            + GGA++SE+H NF++N   A   D   L + ++ KV  +SGI LE E++ +G
Sbjct: 245 CQIGGAQVSEVHTNFLVNRGGAMAADFLQLAQVIKSKVRERSGIDLEEEVRIVG 298


>gi|82703607|ref|YP_413173.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrosospira
           multiformis ATCC 25196]
 gi|123543906|sp|Q2Y640|MURB_NITMU RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|82411672|gb|ABB75781.1| UDP-N-acetylmuramate dehydrogenase [Nitrosospira multiformis ATCC
           25196]
          Length = 347

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 99/318 (31%), Positives = 146/318 (45%), Gaps = 23/318 (7%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVR 76
           +RG+ + + P+K  T +R GG+AE ++ P D+ DL  FL  LP + P+ ++GLGSN+LVR
Sbjct: 15  VRGELRHDQPMKNYTSWRAGGSAERIYLPGDLPDLAAFLRGLPWNEPVYVMGLGSNLLVR 74

Query: 77  DAGIRGVVLRL--SNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPG 134
           D G+RG V+ L     G           +  GA  +   +A  A   G+GG  F  GIPG
Sbjct: 75  DGGVRGSVVVLHARLNGLQLESDMGQMLIYAGAGVACAKVARFAALQGLGGAEFLAGIPG 134

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-------- 186
           ++GGA  MNAG    ET   V  V  IDR G     P    +  YR   +          
Sbjct: 135 TVGGALAMNAGCYGTETWDIVSSVQTIDRLGILRRRPPGNYEIGYRHVALKAEKSSGSQK 194

Query: 187 -------------DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKN 233
                        D   +        +    +   I  +   R   QP+     GS F+N
Sbjct: 195 MGARENAPDDSLTDEWFSGAWFALPRDHAAAVRQKIKELLARRIHTQPLNLPNAGSVFRN 254

Query: 234 PTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSG 293
           P    A +LIE  G +    GGA +S  H NF++N   AT  D+E +   VR+ V  Q+G
Sbjct: 255 PENDKAARLIESCGLKEFRIGGAMVSPRHANFIVNTGGATASDIEAVIAAVRETVKKQTG 314

Query: 294 ILLEWEIKRLGDFFDHQI 311
           + L+ E++ +G     ++
Sbjct: 315 VELKQEVRIIGTPARPEL 332


>gi|116629922|ref|YP_815094.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           gasseri ATCC 33323]
 gi|282851484|ref|ZP_06260849.1| UDP-N-acetylmuramate dehydrogenase [Lactobacillus gasseri 224-1]
 gi|122273140|sp|Q042G6|MURB_LACGA RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|116095504|gb|ABJ60656.1| UDP-N-acetylmuramate dehydrogenase [Lactobacillus gasseri ATCC
           33323]
 gi|282557452|gb|EFB63049.1| UDP-N-acetylmuramate dehydrogenase [Lactobacillus gasseri 224-1]
          Length = 303

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 89/305 (29%), Positives = 149/305 (48%), Gaps = 4/305 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPI 64
           +   L +  KQ     QEN PL + T+ +TGG A+ +  P+++ +LK  +  +  +++P+
Sbjct: 1   MKMQLMDLKKQ-GIDIQENIPLSRFTFTKTGGPAQYLAFPKNLDELKILVETVKTNNLPL 59

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T++G  SN+++RD GI G+VL L+                  A       + +A    + 
Sbjct: 60  TVIGNASNLIIRDGGISGLVLILTKMDKIVANQEEATVT-ADAGARIIDTSEAACEASLS 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA +MNAGA   ET   +  V  + R+G       +++++ YR S +
Sbjct: 119 GLEFAAGIPGSVGGAVFMNAGAYGGETEFVIKSVRVLTREGKFKTYTHDEMEFGYRHSLV 178

Query: 185 TK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            +   I+        P  +  I A +      R   QP++  + GS FK PTGH    +I
Sbjct: 179 QETGDIVISATFGLEPGDKWAIKAKMEYFNGLRRAKQPLEYPSCGSVFKRPTGHFVGPMI 238

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
            K+G +G   GGA+ S+ H  F++N   AT  D   L   ++K +     + L+ E++ +
Sbjct: 239 IKAGLQGKRIGGAEDSKKHAGFIVNVGGATATDYLDLIHLIQKTIKKDFDVDLQTEVRII 298

Query: 304 GDFFD 308
           G   D
Sbjct: 299 GKEKD 303


>gi|229019112|ref|ZP_04175947.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           AH1273]
 gi|229025356|ref|ZP_04181774.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           AH1272]
 gi|228735941|gb|EEL86518.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           AH1272]
 gi|228742212|gb|EEL92377.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           AH1273]
          Length = 301

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 89/302 (29%), Positives = 152/302 (50%), Gaps = 5/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           + +L++E  +   G+   N PL + T  + GG A+++  P+ + D++  L L+       
Sbjct: 1   MEQLVKELLEANVGRVLVNEPLARYTTMKIGGPADILIVPKHVADIEKTLKLVKKYKAGW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T++G GSN+LV D GI GVV+RL          ++     VGA      L+    R G+ 
Sbjct: 61  TVIGRGSNLLVSDLGIEGVVIRLGEGLDHLEVEKHKVR--VGAGYPLIKLSTLLSRQGLA 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA+  + S  + +   +   G  + +   ++ + YR+S +
Sbjct: 119 GLEFASGIPGSVGGAVYMNAGAHKSDISSVLTKARILFENGTINWLTNTEMGFSYRTSVL 178

Query: 185 TKDLI--ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
                  +     +     +  I  ++     +R   QP      GS F+NP  + A  L
Sbjct: 179 QTKRPGIVLEAEFQLEVGERKEIVRSMQKNKDYRRETQPWNHPCAGSIFRNPVPYFAGDL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IEK+G RG   GGA+ISE+H NF++N   A+  D+  L   +++ + ++ G+ +  E++ 
Sbjct: 239 IEKAGLRGYTIGGAQISEMHGNFIVNTGVASAQDVLDLIALIKRTIKDKFGVDMHTEVEI 298

Query: 303 LG 304
           +G
Sbjct: 299 IG 300


>gi|306829755|ref|ZP_07462944.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus mitis ATCC 6249]
 gi|304428106|gb|EFM31197.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus mitis ATCC 6249]
          Length = 304

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 99/302 (32%), Positives = 153/302 (50%), Gaps = 6/302 (1%)

Query: 7   SRLLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPI 64
             L+ +  +QL G   +   PLK  T+ + GG A+ +  P++ +++   +      +IP 
Sbjct: 4   MTLVTKIQEQLEGIDIRFKEPLKTYTYTKVGGRADYLVLPRNRYEMARVVQFANQENIPW 63

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G  SNI+VR+ GIRG V+        ++   +   +   A  +       ALRH + 
Sbjct: 64  MVLGNASNIIVREGGIRGFVILCDKLNNVSV---DGYTIEAEAGANLIETTRIALRHSLT 120

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           GF F  GIPGSIGGA +MNAGA   E +  +     + ++G    +  + L + YR S I
Sbjct: 121 GFEFACGIPGSIGGAVFMNAGAYGGEIAHILQSCQILTKEGEIETLSAKDLAFGYRHSAI 180

Query: 185 TK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
                I+        P +  +I   +  + H RE  QP++  + GS FK P GH A QLI
Sbjct: 181 QDSGAIVLSAKFALAPGNHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLI 240

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
            ++G +G   GG ++SE H  FMIN  + T  D E L E V +KV   SG+ LE E++ L
Sbjct: 241 SEAGLKGYRIGGVEVSEKHAGFMINVADGTARDYEDLIESVIEKVKEHSGVTLEREVRIL 300

Query: 304 GD 305
           G+
Sbjct: 301 GE 302


>gi|39998158|ref|NP_954109.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacter
           sulfurreducens PCA]
 gi|47605781|sp|P61435|MURB_GEOSL RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|39985104|gb|AAR36459.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacter
           sulfurreducens PCA]
          Length = 288

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 99/290 (34%), Positives = 140/290 (48%), Gaps = 4/290 (1%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLT-LLPSDIPITIVGLGSNILV 75
           +RG+   + P+ + T  R GG A+    P D  D++  L  L  +  P   VG G N+L+
Sbjct: 1   MRGEILRDEPMARHTSLRVGGPADFFVTPADPDDMRALLAILAETGTPWLAVGGGYNLLI 60

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
           RD G R   + +S+A  +++E       +VGA  +   L       G+ G  F  GIPG+
Sbjct: 61  RDGGFR--GVVISSARMTSLERLEGNRAVVGAGVANGRLTAFLRNEGLAGLEFLCGIPGT 118

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL 195
           +GGA  MNAGA+       V E+  I          RE L Y YR  ++    II     
Sbjct: 119 VGGALAMNAGAHGGAILDRVEEILTIG-TAGFECKGRELLDYGYRYLKLQPGEIIIGATF 177

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
               +    IS  I     HR   Q +     GS FKNP G +AW+LIE +G RG   GG
Sbjct: 178 VLDSDDPRRISERIDGCRAHRTASQQVGFPNAGSFFKNPPGQAAWRLIEDAGLRGARVGG 237

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           A++SE+H NF++N   AT  D   L  +++  V  +SG  LE E+K  GD
Sbjct: 238 AQVSEVHTNFLVNRGGATAADFLALAARIKDAVKLKSGTALEEEVKIFGD 287


>gi|311110443|ref|ZP_07711840.1| UDP-N-acetylmuramate dehydrogenase [Lactobacillus gasseri MV-22]
 gi|311065597|gb|EFQ45937.1| UDP-N-acetylmuramate dehydrogenase [Lactobacillus gasseri MV-22]
          Length = 298

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 86/290 (29%), Positives = 144/290 (49%), Gaps = 3/290 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAG 79
            QEN PL + T+ +TGG A+ +  P+++ +LK  +  +  +++P+T++G  SN+++RD G
Sbjct: 10  IQENIPLSRFTFTKTGGPAQYLAFPKNLDELKILVETVKTNNLPLTVIGNASNLIIRDGG 69

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           I G+VL L+                  A       + +A    + G  F  GIPGS+GGA
Sbjct: 70  ISGLVLILTKMDKIVANQEEATVT-ADAGARIIDTSEAACEASLSGLEFAAGIPGSVGGA 128

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            +MNAGA   ET   +  V  + R+G       +++++ YR S + +   I+        
Sbjct: 129 VFMNAGAYGGETEFVIKSVRVLTREGKFKTYTHDEMEFGYRHSLVQETGDIVISATFGLE 188

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P  +  I A +      R   QP++  + GS FK PTGH    +I K+G +G   GGA+ 
Sbjct: 189 PGDKWAIKAKMEYFNGLRRAKQPLEYPSCGSVFKRPTGHFVGPMIIKAGLQGKRIGGAED 248

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFD 308
           S+ H  F++N   AT  D   L   ++K +     + L+ E++ +G   D
Sbjct: 249 SKKHAGFIVNVGGATATDYLDLIHLIQKTIKKDFDVDLQTEVRIIGKEKD 298


>gi|88811836|ref|ZP_01127089.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrococcus mobilis
           Nb-231]
 gi|88790720|gb|EAR21834.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Nitrococcus mobilis
           Nb-231]
          Length = 299

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 101/289 (34%), Positives = 154/289 (53%), Gaps = 2/289 (0%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRD 77
           RG  +EN P+++ T +R GG A+  F+P D+ DL  F+  LP+  P+  +GLGSN+LVRD
Sbjct: 5   RGTLRENEPMRRHTSWRAGGYAKRFFEPADVEDLVAFVRQLPATEPVVWLGLGSNLLVRD 64

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G+RG V++   A  + +E      + +GA  +   +A + +R G+ G  F  GIPG++G
Sbjct: 65  GGVRGTVIQTRTALTA-LEQLPGGCVRIGAGVACAKVARACVRWGLAGAEFLIGIPGTVG 123

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRG 197
           GA  MNAGA   ET   VV +  +DR G +H     + +  YR+       +     LR 
Sbjct: 124 GALAMNAGAWGAETWSRVVALETLDRDGVRHRRSPGEYRVGYRTVSAPGPEVFLGATLRF 183

Query: 198 FPESQNIISAAIANVCHHRE-TVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
            P        A       R    QP+   + GS F+NP G  A +LIE++G +G  FG A
Sbjct: 184 EPGGDPQALHARVRALLARRGATQPLGRPSCGSVFRNPPGDFAARLIEQAGLKGRGFGEA 243

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            +S  H NF++N   AT  D+E L   VR ++ +  G+ L+ E+  +G+
Sbjct: 244 CVSTKHANFILNHGAATAADIERLIGYVRGRIRDLYGVELQTEVCIVGE 292


>gi|49479405|ref|YP_037971.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|81395061|sp|Q6HEQ5|MURB1_BACHK RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase 1;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase 1
 gi|49330961|gb|AAT61607.1| UDP-N-acetylenolpyruvoylglucosamine reductase (UDP-N-acetylmuramate
           dehydrogenase) [Bacillus thuringiensis serovar konkukian
           str. 97-27]
          Length = 301

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 88/302 (29%), Positives = 150/302 (49%), Gaps = 5/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           + +L+ E  +   G+   + PL + T  + GG A+++  P+ +  ++  L L+       
Sbjct: 1   MEQLVNELIEANVGRVLVDEPLARYTTMKIGGPADILIVPKHVAGIEKTLQLVKKYKTKW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T++G GSN+LV D GI GVV+RL          ++     VG       L+    R G+ 
Sbjct: 61  TVIGRGSNLLVSDLGIEGVVIRLGEGLDHLEVEKHRVR--VGGGYPLIKLSTLLSRQGLA 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA+  + S  + +   +   G    +   ++ + YR+S +
Sbjct: 119 GLEFASGIPGSVGGAVYMNAGAHKSDISNILSKALILFEDGTIDWLTHGEMGFSYRTSVL 178

Query: 185 TKDLI--ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
                  +     +     +  I + +     +R   QP      GS F+NPT + A  L
Sbjct: 179 QTKRPGIVLEAEFQLQIGERERIVSVMQKNKDYRRETQPWNHPCAGSVFRNPTPYFAGDL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IEK+G RG + GGA+ISE+H NF+IN   A+  D+  L   +++ + ++ G+ +  E++ 
Sbjct: 239 IEKAGLRGYQIGGAQISEMHGNFIINTGGASAQDVLSLIALIKQTIKDKFGVEMHTEVEI 298

Query: 303 LG 304
           +G
Sbjct: 299 IG 300


>gi|329115822|ref|ZP_08244539.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus parauberis NCFD
           2020]
 gi|326906227|gb|EGE53141.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus parauberis NCFD
           2020]
          Length = 295

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 90/296 (30%), Positives = 146/296 (49%), Gaps = 6/296 (2%)

Query: 13  RGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLG 70
              +L G   + + PLK  T+ + GG A+ +  P++ ++L   +      +IP  ++G  
Sbjct: 1   MINELEGIDIRLDEPLKNYTYTKVGGPADYLAFPRNRYELTRIVKYANHENIPWMVLGNA 60

Query: 71  SNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFY 130
           SN++VR+ GIRG V+  +      +   +   +   A  +       A RH + GF F  
Sbjct: 61  SNLIVREGGIRGFVIMFNKLNTVTL---DGYTIEAEAGANLIQTTKIARRHSLTGFEFAC 117

Query: 131 GIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLI 189
           GIPGS+GGA +MNAGA   E +        + + G    +    + + YR S I +   I
Sbjct: 118 GIPGSVGGAIFMNAGAYGGEIAHIFQSAKVLTKDGEIKTLTARDMAFGYRHSAIQESGDI 177

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
           +        P + + I+  +  + H R+  QP++  + GS FK P G+ A QLI  +  +
Sbjct: 178 VISAKFALNPGNYDQIAQEMDRLNHLRQLKQPLEYPSCGSVFKRPIGYFAGQLIMDANLK 237

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           G   GG ++S+ H  FMIN DN T  D E L   V K V + SG+ LE E++ +G+
Sbjct: 238 GHRIGGVEVSDKHAGFMINVDNGTAEDYEALIAHVIKTVKDNSGVTLEREVRIIGE 293


>gi|325568817|ref|ZP_08145110.1| UDP-N-acetylmuramate dehydrogenase [Enterococcus casseliflavus ATCC
           12755]
 gi|325157855|gb|EGC70011.1| UDP-N-acetylmuramate dehydrogenase [Enterococcus casseliflavus ATCC
           12755]
          Length = 308

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 90/287 (31%), Positives = 145/287 (50%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAG 79
             ++ PL   T+ +TGG A+++  P+   + K  L       IP  ++G  SN++VRD G
Sbjct: 24  LLKDEPLLNYTYTKTGGPADILAFPKTAEEAKQLLDYCREQAIPWIVLGNASNLIVRDGG 83

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRGVV+ LS      +   +   +IV A          AL   + GF F  GIPGS+GGA
Sbjct: 84  IRGVVIMLSEMNQIVV---DGTSLIVDAGAKLIDTTYVALHESLTGFEFACGIPGSVGGA 140

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            +MNAGA + E          +   G      +E++++ YR S++ +  +II        
Sbjct: 141 VFMNAGAYDGEIQDVFASCDVLLADGQIVTYTKEEMEFAYRHSKLQEQKMIILSSRFDLA 200

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
              Q  I   +  +   R+  QP++  + GS FK P GH   +LI+ +G +GL++GGA+I
Sbjct: 201 KGDQEQIKKRMDELTELRQLKQPLEYPSCGSVFKRPVGHFTGKLIQDAGLQGLKWGGAQI 260

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H  F++N D AT  D   L   +++ +     + LE E++ +G+
Sbjct: 261 SEKHAGFIVNVDQATATDYVELIAHIQQVIKETFDVTLETEVRIIGE 307


>gi|55821515|ref|YP_139957.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           thermophilus LMG 18311]
 gi|55823443|ref|YP_141884.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           thermophilus CNRZ1066]
 gi|55737500|gb|AAV61142.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           thermophilus LMG 18311]
 gi|55739428|gb|AAV63069.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           thermophilus CNRZ1066]
          Length = 325

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 95/301 (31%), Positives = 148/301 (49%), Gaps = 6/301 (1%)

Query: 8   RLLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPIT 65
            +L E  + L G   + + PLK+ T+ + GG A+ +  P++ ++L   +      +IP  
Sbjct: 25  NMLDELKEDLVGIDIRFDEPLKRYTYTKVGGPADYLAFPRNRYELFRIVKFANKHNIPWM 84

Query: 66  IVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGG 125
           ++G  SN++VRD GIRG V+         +   N  ++   A  +  +    A  H + G
Sbjct: 85  VLGNASNLIVRDGGIRGFVIMFDKLNGIAV---NGYQVEAEAGANLIATTKVACFHSLTG 141

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT 185
           F F  GIPGSIGGA +MNAGA   E +  +V    + + G+   I    +++ YR S + 
Sbjct: 142 FEFAAGIPGSIGGAVFMNAGAYGGEIAHILVSAQVLTKDGDIRTIDARDMRFGYRRSVLQ 201

Query: 186 K-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIE 244
           +   ++        P     I   +  + H RE  QP++  + GS FK P GH A QLI 
Sbjct: 202 ETGEVVISAKFNLKPGDYEQIKHEMNRLNHLRELKQPLEYPSCGSVFKRPPGHFAGQLIM 261

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           ++   G   GG ++S  H  FM+N D  T  D E L   V  KV   SG+ LE E++ +G
Sbjct: 262 EANLEGHRIGGVEVSTKHAGFMVNVDQGTAKDYEDLIADVIAKVKENSGVTLEPEVRIIG 321

Query: 305 D 305
           D
Sbjct: 322 D 322


>gi|312867325|ref|ZP_07727534.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus parasanguinis
           F0405]
 gi|311097026|gb|EFQ55261.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus parasanguinis
           F0405]
          Length = 298

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 97/299 (32%), Positives = 151/299 (50%), Gaps = 6/299 (2%)

Query: 9   LLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITI 66
           ++ E  + L G   +   PLK  T+ + GGNAE +  P++ ++LK  +     + IP  +
Sbjct: 1   MIEEMNQILEGIDIRFQEPLKHYTYTKVGGNAEFLAFPRNQYELKRIVQFANQEQIPWMV 60

Query: 67  VGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGF 126
           +G  SNI+VRD GI G V+        ++   +   +   A        + AL H + GF
Sbjct: 61  LGNASNIIVRDGGIPGFVIMFDRLRDISV---DGYVIEAEAGAKLIDTTHVALHHSLKGF 117

Query: 127 HFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK 186
            F  GIPGS+GGA +MNAGA   E +  +V    + + G    +   +L + YR S+I +
Sbjct: 118 EFASGIPGSVGGAVFMNAGAYGGEIAHVLVSCKVLTKDGEIETLSASELAFGYRHSKIQE 177

Query: 187 -DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEK 245
              ++        P +   I   +  + H R+  QP++  + GS FK P GH A QLI +
Sbjct: 178 TGAVVISAKFALSPGNHEAIKQEMDRLTHLRQLKQPLEYPSCGSVFKRPVGHFAGQLISE 237

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           +G +G   GG ++SE H  FM+N DN T  D E L   V + V   SG+ LE E++ +G
Sbjct: 238 AGLKGYRIGGVEVSEKHAGFMVNVDNGTAKDYEDLIAHVIEAVEAHSGVRLEPEVRIIG 296


>gi|289450751|ref|YP_003475539.1| UDP-N-acetylmuramate dehydrogenase [Clostridiales genomosp. BVAB3
           str. UPII9-5]
 gi|289185298|gb|ADC91723.1| UDP-N-acetylmuramate dehydrogenase [Clostridiales genomosp. BVAB3
           str. UPII9-5]
          Length = 337

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 90/335 (26%), Positives = 154/335 (45%), Gaps = 34/335 (10%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPI 64
           +++ + +  ++LR + + + PL ++T F+ GG A+  F+P+ + ++         + I +
Sbjct: 1   MNKFITQLPQELRERLKIDIPLAELTTFKVGGPADFYFEPESVDEIAMLYRFAYENSIDV 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFS------------------------------- 93
           T++G GSN++V DAGIRG+V+ L +                                   
Sbjct: 61  TVLGNGSNVVVADAGIRGLVIGLRHNFSELEFLGLKELPINHAQCRSLKRFAENFPNTPL 120

Query: 94  -NIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETS 152
                 +   +   A       + +A   G+ G  F  GIPGS+GGA YMNAGA      
Sbjct: 121 YCDFGADPVFLRAQAGAKLADTSRAACARGLTGLEFACGIPGSVGGAVYMNAGAYGNSIE 180

Query: 153 QYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGFPESQNIISAAIAN 211
             VV    +D  GN +     +  + YR S  +    I+              I    A+
Sbjct: 181 DVVVLTKSMDIAGNIYWKIGSEHDFAYRHSCFSAAGQIVLETFFALRSGIPGDIDERCAD 240

Query: 212 VCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADN 271
               R+  QP++  + GS FK P G+ A +LI  +G +G + GGA +SE H  F++N   
Sbjct: 241 YTSRRQASQPLELPSAGSMFKRPRGYFAGKLISDAGLKGHQVGGAAVSEKHAGFVVNLGM 300

Query: 272 ATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           A   D++ L ++++  VF Q G+ LE E++ +GD+
Sbjct: 301 AKATDIKILVKEIQMTVFRQFGVQLEPEVRFIGDW 335


>gi|257867355|ref|ZP_05647008.1| UDP-N-acetylmuramate dehydrogenase [Enterococcus casseliflavus
           EC30]
 gi|257873687|ref|ZP_05653340.1| UDP-N-acetylmuramate dehydrogenase [Enterococcus casseliflavus
           EC10]
 gi|257801411|gb|EEV30341.1| UDP-N-acetylmuramate dehydrogenase [Enterococcus casseliflavus
           EC30]
 gi|257807851|gb|EEV36673.1| UDP-N-acetylmuramate dehydrogenase [Enterococcus casseliflavus
           EC10]
          Length = 305

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 91/287 (31%), Positives = 145/287 (50%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAG 79
             ++ PL   T+ +TGG A+++  P+   + K  L       IP  ++G  SN++VRD G
Sbjct: 21  LLKDEPLLNYTYTKTGGPADILAFPKTADEAKQLLDYCREQAIPWIVLGNASNLIVRDGG 80

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRGVV+ LS      +   N   +IV A          AL   + GF F  GIPGS+GGA
Sbjct: 81  IRGVVIMLSEMNQIVV---NGTSLIVDAGAKLIDTTYVALHESLTGFEFACGIPGSVGGA 137

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            +MNAGA + E          +   G      +E++++ YR S++ +  +II        
Sbjct: 138 VFMNAGAYDGEIQDVFASCDVLLANGQIVTYTKEEMEFAYRHSKLQEQKMIILSSRFDLA 197

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
              Q  I   +  +   R+  QP++  + GS FK P GH   +LI+ +G +GL++GGA+I
Sbjct: 198 KGDQEQIKKRMDELTELRQLKQPLEYPSCGSVFKRPVGHFTGKLIQDAGLQGLKWGGAQI 257

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H  F++N D AT  D   L   +++ +     + LE E++ +G+
Sbjct: 258 SEKHAGFIVNVDQATATDYVELIAHIQQVIKETFDVTLETEVRIIGE 304


>gi|15901244|ref|NP_345848.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae TIGR4]
 gi|15903290|ref|NP_358840.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae R6]
 gi|116515736|ref|YP_816689.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae D39]
 gi|148985657|ref|ZP_01818811.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP3-BS71]
 gi|168487700|ref|ZP_02712208.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae CDC1087-00]
 gi|221232130|ref|YP_002511283.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae ATCC 700669]
 gi|225860830|ref|YP_002742339.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae Taiwan19F-14]
 gi|298229499|ref|ZP_06963180.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae str. Canada MDR_19F]
 gi|298254199|ref|ZP_06977785.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae str. Canada MDR_19A]
 gi|298502659|ref|YP_003724599.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae TCH8431/19A]
 gi|54037854|sp|P65467|MURB_STRR6 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|54041504|sp|P65466|MURB_STRPN RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|122278425|sp|Q04JV9|MURB_STRP2 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|254765601|sp|B8ZKN7|MURB_STRPJ RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|254765615|sp|C1CQW7|MURB_STRZT RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|14972877|gb|AAK75488.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae TIGR4]
 gi|15458885|gb|AAL00051.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae R6]
 gi|116076312|gb|ABJ54032.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae D39]
 gi|147922138|gb|EDK73260.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP3-BS71]
 gi|183569538|gb|EDT90066.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae CDC1087-00]
 gi|220674591|emb|CAR69154.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae ATCC 700669]
 gi|225727765|gb|ACO23616.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae Taiwan19F-14]
 gi|298238254|gb|ADI69385.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae TCH8431/19A]
 gi|301800257|emb|CBW32876.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae OXC141]
          Length = 316

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 96/298 (32%), Positives = 149/298 (50%), Gaps = 6/298 (2%)

Query: 11  RERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVG 68
            +  + L G   +   PL   ++ + GG A+ +  P++  +L   +      +IP  ++G
Sbjct: 5   EKMLEILEGIDIRFKEPLHSYSYTKVGGEADYLVFPRNRFELARVVKFANQENIPWMVLG 64

Query: 69  LGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHF 128
             SNI+VRD GIRG V+        ++   +   +   A  +       ALRH + GF F
Sbjct: 65  NASNIIVRDGGIRGFVILCDKLNNVSV---DGYTIEAEAGANLIETTRIALRHSLTGFEF 121

Query: 129 FYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-D 187
             GIPGS+GGA +MNAGA   E +  +     + + G    +  + L + YR S I +  
Sbjct: 122 ACGIPGSVGGAVFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAKDLAFGYRHSAIQESG 181

Query: 188 LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSG 247
            ++  V     P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G
Sbjct: 182 AVVLSVKFALAPGTHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAG 241

Query: 248 CRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            +G   GG ++SE H  FMIN  + T  D E L + V +KV   SGI LE E++ LG+
Sbjct: 242 LKGYRIGGVEVSEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGITLEREVRILGE 299


>gi|323099954|gb|ADX23554.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus mycoides]
          Length = 301

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 89/302 (29%), Positives = 151/302 (50%), Gaps = 5/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           + +L++E  +   G+   N PL + T  + GG A+++  P+ + D++  L L+       
Sbjct: 1   MEQLVKELLEANVGRVLVNEPLARYTTMKIGGPADILIVPKHVADIEKTLKLVKKYKAGW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T++G GSN+LV D GI GVV+RL          ++     VGA      L+    R G+ 
Sbjct: 61  TVIGRGSNLLVSDQGIEGVVIRLGEGLDHLEVEKHKVR--VGAGYPLIKLSTLLSRQGLA 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA+  + S  + +   +   G  + +   ++ + YR+S +
Sbjct: 119 GLEFASGIPGSVGGAVYMNAGAHKSDISSVLTKARILFENGTINWLTNTEMGFSYRTSVL 178

Query: 185 TKDLI--ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
                  +     +     +  I  ++     +R   QP      GS F+NP  + A  L
Sbjct: 179 QTKRPGIVLEAEFQLEVGERKEIVRSMQKNKDYRRETQPWNHPCAGSIFRNPVPYFAGDL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IEK G RG   GGA+ISE+H NF++N   A+  D+  L   +++ + ++ G+ +  E++ 
Sbjct: 239 IEKPGLRGYTIGGAQISEMHGNFIVNTGVASAQDVLDLIALIKRTIKDKFGVDMHTEVEI 298

Query: 303 LG 304
           +G
Sbjct: 299 IG 300


>gi|257064205|ref|YP_003143877.1| UDP-N-acetylmuramate dehydrogenase [Slackia heliotrinireducens DSM
           20476]
 gi|256791858|gb|ACV22528.1| UDP-N-acetylmuramate dehydrogenase [Slackia heliotrinireducens DSM
           20476]
          Length = 300

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 88/288 (30%), Positives = 147/288 (51%), Gaps = 4/288 (1%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVR 76
           +G    N P+ + T F  GG AEVM  P+   ++   +       +   ++G GS++LV 
Sbjct: 14  KGNVMLNEPMSKHTTFEIGGPAEVMVTPETADEVAEVVKACNEAGVAWRVLGNGSDLLVS 73

Query: 77  DAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSI 136
           D G+ GVV++L +         +   +   A  +   +A +A   G+ G+ F  GIPG+I
Sbjct: 74  DEGVGGVVIQLLDKFNGL--HVHGNVIAAMAGATNAQVAEAAQAAGLAGYEFACGIPGTI 131

Query: 137 GGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI-TKDLIITHVVL 195
           GGAA MNAGA + + +    EV     +G   ++ RE+  + YR S +  +  I+  V+ 
Sbjct: 132 GGAAIMNAGAYDGQFADAATEVLCCTPEGEFALVFREEADWTYRHSMMSDEGYIVLGVIF 191

Query: 196 RGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
               +  + I A + ++   R + QP++  + GSTFK P G+ A +LI+ +G RG   GG
Sbjct: 192 ELTEDDPDAIQARMDDLQERRSSKQPLEMPSAGSTFKRPEGYFAGKLIQDAGLRGYSVGG 251

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           A++S  H  F++N   AT  D+  L   V+  V  + G+ LE E++  
Sbjct: 252 AQVSTKHTGFVVNTGGATAADVRQLISDVQAAVEKEFGVKLEPEVRFW 299


>gi|148556845|ref|YP_001264427.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sphingomonas
           wittichii RW1]
 gi|172048241|sp|A5VDC3|MURB_SPHWW RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|148502035|gb|ABQ70289.1| UDP-N-acetylmuramate dehydrogenase [Sphingomonas wittichii RW1]
          Length = 306

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 117/291 (40%), Positives = 170/291 (58%), Gaps = 1/291 (0%)

Query: 14  GKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNI 73
              +RG+     PL  + WF++GG AE +F+P D+ DL  FL  L   +P+  +GLGSN+
Sbjct: 14  LPPVRGRLTAGAPLAPLVWFKSGGAAEWLFEPADVDDLSDFLAALDPAVPVMGLGLGSNL 73

Query: 74  LVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIP 133
           +VRD G+ GVV+RL         +            SG  ++++A   GIGG  F   IP
Sbjct: 74  IVRDGGVPGVVVRLGKPFARVERLDATTLRCG-GGASGILVSSTARDAGIGGVEFLRSIP 132

Query: 134 GSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHV 193
           G++GG   MN GA   E    +VE   + R G + V+   +L Y YR S + +  I+   
Sbjct: 133 GTVGGFVRMNGGAYGREVKDVLVEGEVVLRSGERRVLSLAELGYTYRHSALPEGAIVVAA 192

Query: 194 VLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEF 253
             RG  E+  ++ A +  +   RE  QP++ +TGGSTFKNP GH AWQL++ +GCRGL  
Sbjct: 193 TFRGHAEAPAVVQAEMDRIAAEREASQPLRSRTGGSTFKNPQGHKAWQLVDAAGCRGLTR 252

Query: 254 GGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           G A++SE HCNF++N   A+  D+E LGE+VR++V   SG+ LEWEI+R+G
Sbjct: 253 GDAQVSEKHCNFLLNLGTASSADIEGLGEEVRERVKANSGVTLEWEIQRVG 303


>gi|332522574|ref|ZP_08398826.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus porcinus str.
           Jelinkova 176]
 gi|332313838|gb|EGJ26823.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus porcinus str.
           Jelinkova 176]
          Length = 296

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 92/296 (31%), Positives = 142/296 (47%), Gaps = 6/296 (2%)

Query: 13  RGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLG 70
             ++L G   + N PLK+ T+ + GG A+ +  P++  +L   +       IP  ++G  
Sbjct: 1   MIEELAGIDIRINEPLKKYTYTKVGGPADYLVFPRNRIELTRVVKYANQHKIPWLVLGNA 60

Query: 71  SNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFY 130
           SN++VRD GIRG V+         +   +   +   A  +       A  H + GF F  
Sbjct: 61  SNLIVRDGGIRGFVIMFDKLNLITV---DGYTIEAEAGANLIETTKVAKYHSLTGFEFAC 117

Query: 131 GIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLI 189
           GIPGSIGGA +MNAGA   E +   +    +  +G    +   ++ + YR S +     I
Sbjct: 118 GIPGSIGGAIFMNAGAYGGEIANIFLSAKVLTPEGEIKTVTAREMAFGYRISAVQTSGDI 177

Query: 190 ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCR 249
           +        P +   IS  +  + + R   QP++  + GS FK P GH A QLI ++G +
Sbjct: 178 VISAKFALNPGNFEQISQEMDRLNYLRRLKQPLEYPSCGSVFKRPPGHFAGQLIMEAGLK 237

Query: 250 GLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           G   GG ++SE H  FMIN D  T  D E L   V   V   SG+ LE E++ +G+
Sbjct: 238 GYRIGGVEVSEKHAGFMINVDQGTARDYEQLIAHVIATVKTNSGVTLEREVRIIGE 293


>gi|257877430|ref|ZP_05657083.1| UDP-N-acetylmuramate dehydrogenase [Enterococcus casseliflavus
           EC20]
 gi|257811596|gb|EEV40416.1| UDP-N-acetylmuramate dehydrogenase [Enterococcus casseliflavus
           EC20]
          Length = 305

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 90/287 (31%), Positives = 145/287 (50%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDAG 79
             ++ PL   T+ +TGG A+++  P+   + K  L       IP  ++G  SN++VRD G
Sbjct: 21  LLKDEPLLNYTYTKTGGPADILAFPKTADEAKQLLDYCREQAIPWIVLGNASNLIVRDGG 80

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRGVV+ LS      +   +   +IV A          AL   + GF F  GIPGS+GGA
Sbjct: 81  IRGVVIMLSEMNQIVV---DGTSLIVDAGAKLIDTTYVALHESLTGFEFACGIPGSVGGA 137

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            +MNAGA + E          +   G      +E++++ YR S++ +  +II        
Sbjct: 138 VFMNAGAYDGEIQDVFASCDVLLANGQIVTYTKEEMEFAYRHSKLQEQKMIILSSRFDLA 197

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
              Q  I   +  +   R+  QP++  + GS FK P GH   +LI+ +G +GL++GGA+I
Sbjct: 198 KGDQEQIKKRMDELTELRQLKQPLEYPSCGSVFKRPVGHFTGKLIQDAGLQGLKWGGAQI 257

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H  F++N D AT  D   L   +++ +     + LE E++ +G+
Sbjct: 258 SEKHAGFIVNVDQATATDYVELIAHIQQVIKETFDVTLETEVRIIGE 304


>gi|212213337|ref|YP_002304273.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Coxiella burnetii
           CbuG_Q212]
 gi|254764174|sp|B6J2Q1|MURB_COXB2 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|212011747|gb|ACJ19128.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Coxiella burnetii
           CbuG_Q212]
          Length = 316

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 103/312 (33%), Positives = 151/312 (48%), Gaps = 18/312 (5%)

Query: 11  RERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLG 70
           +E   +LRG+   + PL + T +R GG AE  ++P D+ DL+ FLT LPSD P+T +GLG
Sbjct: 3   KENFTRLRGELFCDHPLARYTSWRVGGKAERFYRPADLFDLQDFLTQLPSDEPLTWLGLG 62

Query: 71  SNILVRDAGIRGVVLRLSNA------------------GFSNIEVRNHCEMIVGARCSGK 112
           SN+L+RD GI+G V+   N                               +   A  +  
Sbjct: 63  SNVLIRDGGIKGTVILTLNRLKELSVVNSQLVFREKSGTEDFFSGNGKTIIRAEAGVTCA 122

Query: 113 SLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPR 172
            LA   +  G+    FF GIPG++GGA  MNAGA   ET + V+ V  ++ +G       
Sbjct: 123 KLAKFCVSQGLEDGAFFAGIPGTVGGALAMNAGAFGGETWRTVIGVETMNHQGEILKRTP 182

Query: 173 EQLKYQYRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFK 232
           ++ K  YR  E  ++               +    AI  +   R   QPI + + GS F+
Sbjct: 183 DEFKIHYRQVEGLENQFFIAGYFCFNHGDPDKAKTAINALLKKRNLSQPIGKYSCGSVFR 242

Query: 233 NPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQS 292
           NP G  A +LIE +G +G   G A++SE H NF++N  NA+  D+E L   V + V    
Sbjct: 243 NPPGDYAARLIESAGLKGKSIGNAEVSEKHANFILNKGNASAADIEALIHYVAQHVSQIH 302

Query: 293 GILLEWEIKRLG 304
           GI L  E+  +G
Sbjct: 303 GIQLVKEVNIIG 314


>gi|255994073|ref|ZP_05427208.1| UDP-N-acetylmuramate dehydrogenase [Eubacterium saphenum ATCC
           49989]
 gi|255993741|gb|EEU03830.1| UDP-N-acetylmuramate dehydrogenase [Eubacterium saphenum ATCC
           49989]
          Length = 289

 Score =  211 bits (536), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 94/288 (32%), Positives = 148/288 (51%), Gaps = 4/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD-IPITIVGLGSNILVRDA 78
              EN  + +   ++ GG+A  +   ++I +L+  L +     +   I+G GSN+LVRD 
Sbjct: 2   NIIENADMSRYCTYKAGGSARYLISVENIEELREALKMAKEKKLDSFILGRGSNVLVRDG 61

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           G  G+++RLS      +       +  GA  +   ++  A   G+ G  F +GIPGSIGG
Sbjct: 62  GYDGIIIRLSGEFT--LIESTQNVITAGAAATNVEVSVLARDEGLSGIEFLHGIPGSIGG 119

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVL-RG 197
           A +MNAGA   E   YV EV  +D   N    P + + + YR +E      I   V  R 
Sbjct: 120 AVFMNAGAYGSEICDYVDEVTFMDEDYNVVAKPSKDIDFGYRHTEFMDGGGIIISVKLRL 179

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P S + +++ +  + + R + QP+   + GS FK P G  A +LIE +G +G   GGA+
Sbjct: 180 TPSSADAVASKMDTLLNKRTSKQPMNYPSCGSVFKRPLGGYAAKLIEDAGLKGASIGGAE 239

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S  H  F+IN   AT  D+  L + V+K+V   SGI L+ E++ +G 
Sbjct: 240 VSTKHSGFIINKGEATANDITDLIKLVQKRVKKNSGIDLKTEVRIIGK 287


>gi|331266111|ref|YP_004325741.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus oralis
           Uo5]
 gi|326682783|emb|CBZ00400.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus oralis
           Uo5]
          Length = 301

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 97/298 (32%), Positives = 150/298 (50%), Gaps = 6/298 (2%)

Query: 11  RERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVG 68
            +  + L G   +   PLK  T+ + GG A+ +  P++ +++   +      +IP  ++G
Sbjct: 5   EKMLEILEGIDIRFKEPLKTYTYTKVGGRADYLVLPRNRYEMARVVQFANQENIPWMVLG 64

Query: 69  LGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHF 128
             SNI+VR+ GIRG V+        ++   +   +   A  +       ALRH + GF F
Sbjct: 65  NASNIIVREGGIRGFVILCDKLNNVSV---DGYTIEAEAGANLIETTRIALRHSLTGFEF 121

Query: 129 FYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-D 187
             GIPGSIGGA +MNAGA   E +  +     + ++G    +  + L + YR S I    
Sbjct: 122 ACGIPGSIGGAVFMNAGAYGGEIAHILQSCQVLTKEGEIETLSVKDLAFGYRHSAIQDSG 181

Query: 188 LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSG 247
            I+        P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G
Sbjct: 182 AIVLSAKFALAPGNHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAG 241

Query: 248 CRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            +G   GG ++SE H  FMIN  + T  D E L E V +KV   SG+ LE E++ LG+
Sbjct: 242 LKGYRIGGVEVSEKHAGFMINVADGTARDYEDLIESVIEKVKEHSGVTLEREVRILGE 299


>gi|293365703|ref|ZP_06612412.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus oralis ATCC
           35037]
 gi|307703647|ref|ZP_07640589.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus oralis
           ATCC 35037]
 gi|322375492|ref|ZP_08050005.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sp. C300]
 gi|291316071|gb|EFE56515.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus oralis ATCC
           35037]
 gi|307623054|gb|EFO02049.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus oralis
           ATCC 35037]
 gi|321279755|gb|EFX56795.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sp. C300]
          Length = 301

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 95/298 (31%), Positives = 150/298 (50%), Gaps = 6/298 (2%)

Query: 11  RERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVG 68
            +  + L G   +   PLK  T+ + GG A+ +  P++ +++   +      +IP  ++G
Sbjct: 5   EKMLEILEGIDIRFKEPLKTYTYTKVGGRADYLVLPRNRYEMARVVQFANQENIPWMVLG 64

Query: 69  LGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHF 128
             SNI+VR+ GIRG V+        ++   +   +   A  +       ALRH + GF F
Sbjct: 65  NASNIIVREGGIRGFVILCDKLNNVSV---DGYTIEAEAGANLIETTRIALRHSLTGFEF 121

Query: 129 FYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-D 187
             GIPGSIGGA +MNAGA   E +  +     + ++G    +  + L + YR S I    
Sbjct: 122 ACGIPGSIGGAVFMNAGAYGGEIAHILQSCQILTKEGEIETLSAKDLAFGYRHSAIQDSG 181

Query: 188 LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSG 247
            ++        P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G
Sbjct: 182 AVVLSAKFALAPGNHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAG 241

Query: 248 CRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            +G   GG ++SE H  FMIN  + T  D E L + V +KV   SG+ LE E++ LG+
Sbjct: 242 LKGYRIGGVEVSEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGVTLEREVRILGE 299


>gi|307701928|ref|ZP_07638937.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus mitis
           NCTC 12261]
 gi|307616743|gb|EFN95931.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus mitis
           NCTC 12261]
          Length = 301

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 95/302 (31%), Positives = 149/302 (49%), Gaps = 7/302 (2%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPI 64
           +   + E  + +    +   PL   ++ + GG A+ +  P++  +L   +      +IP 
Sbjct: 3   VKENMLEILEGI--DIRFKEPLHSYSYTKVGGEADYLVFPRNRFELARVVKFANQENIPW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G  SNI+VRD GIRG V+        ++   +   +   A  +       ALRH + 
Sbjct: 61  MVLGNASNIIVRDGGIRGFVILCDKLNHVSV---DGYTIEAEAGANLIETTRIALRHSLT 117

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           GF F  GIPGS+GGA +MNAGA   E +  +     + + G    +  + L + YR S I
Sbjct: 118 GFEFACGIPGSVGGAVFMNAGAYGGEIAHILQSCKILTKDGEIETLSVKDLAFGYRHSAI 177

Query: 185 TK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            +   ++        P S  +I   +  + H RE  QP++  + GS FK P GH A QLI
Sbjct: 178 QESGAVVLSAKFALAPGSHPVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLI 237

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
            ++G +G   GG ++SE H  FMIN  + T  D E L E V +KV   SG+ LE E++ L
Sbjct: 238 SEAGLKGYRIGGVEVSEKHAGFMINVADGTAKDYEDLIESVIEKVKEHSGVTLEREVRIL 297

Query: 304 GD 305
           G+
Sbjct: 298 GE 299


>gi|262282613|ref|ZP_06060381.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus sp.
           2_1_36FAA]
 gi|262261904|gb|EEY80602.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus sp.
           2_1_36FAA]
          Length = 302

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 96/299 (32%), Positives = 149/299 (49%), Gaps = 6/299 (2%)

Query: 10  LRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIV 67
           +     +L G   + + PLK+ T+ + GG A+ +  P++ ++L   +       IP  ++
Sbjct: 4   IELLKSELAGIDIRFDEPLKKYTYTKVGGPADYLAFPRNRYELVRLVKFANREQIPWMVL 63

Query: 68  GLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFH 127
           G  SNI+VRD GIRG V+         +   N   +   A        + AL H + GF 
Sbjct: 64  GNASNIIVRDGGIRGFVIMFDQLHTIMV---NGYTIEAEAGAKLIDTTHVALHHSLTGFE 120

Query: 128 FFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK- 186
           F  GIPGS+GGA +MNAGA   E +  +V    +  +G    I  E++K+ YRSS I + 
Sbjct: 121 FACGIPGSVGGAVFMNAGAYGGEIAHVLVSCKVLTPEGEIKTISAEEMKFGYRSSVIQET 180

Query: 187 DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKS 246
             I+        P +   I   +  + H RE  QP++  + GS FK P GH A QLI ++
Sbjct: 181 GDIVISAKFALSPGNYTAIQQEMKRLTHLRELKQPLEYPSCGSVFKRPLGHFAGQLISEA 240

Query: 247 GCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           G +G   GG ++S  H  FM+N  +    + E L   V + V  +SGI LE E++ +G+
Sbjct: 241 GLKGHRIGGVEVSTKHAGFMVNIADGNAQNYEDLIAHVIQTVEKESGIKLEREVRIIGE 299


>gi|315613416|ref|ZP_07888325.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis ATCC
           49296]
 gi|315314651|gb|EFU62694.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus sanguinis ATCC
           49296]
          Length = 301

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 95/298 (31%), Positives = 150/298 (50%), Gaps = 6/298 (2%)

Query: 11  RERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVG 68
            +  + L G   +   PLK  T+ + GG A+ +  P++ +++   +      +IP  ++G
Sbjct: 5   EKMLEILEGIDIRFKEPLKTYTYTKVGGRADYLVLPRNRYEMARVVQFANQENIPWMVLG 64

Query: 69  LGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHF 128
             SNI+VR+ GIRG V+        ++   +   +   A  +       ALRH + GF F
Sbjct: 65  NASNIIVREGGIRGFVILCDKLNNVSV---DGYTIEAEAGANLIETTRIALRHSLTGFEF 121

Query: 129 FYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-D 187
             GIPGSIGGA +MNAGA   E +  +     + ++G    +  + L + YR S I    
Sbjct: 122 ACGIPGSIGGAVFMNAGAYGGEIAHILQSCQILTKEGEIETLSVKDLAFGYRHSAIQDSG 181

Query: 188 LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSG 247
            ++        P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G
Sbjct: 182 AVVLSAKFALAPGNHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAG 241

Query: 248 CRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            +G   GG ++SE H  FMIN  + T  D E L + V +KV   SG+ LE E++ LG+
Sbjct: 242 LKGYRIGGVEVSEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGVTLEREVRILGE 299


>gi|315221365|ref|ZP_07863286.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           anginosus F0211]
 gi|319939313|ref|ZP_08013674.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           anginosus 1_2_62CV]
 gi|315189484|gb|EFU23178.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           anginosus F0211]
 gi|319811567|gb|EFW07851.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           anginosus 1_2_62CV]
          Length = 300

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 96/302 (31%), Positives = 148/302 (49%), Gaps = 6/302 (1%)

Query: 7   SRLLRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPI 64
              L     +L G   + + PLKQ T+ + GG A+ +  P++ ++L   +       IP 
Sbjct: 1   MSTLEMLKSELNGIDIRFDEPLKQYTYTKVGGAADYLVFPRNRYELARVVKFANREQIPW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G  SNI+VRD GIRG V+         +   +   +   A  +     + AL H + 
Sbjct: 61  MVLGNASNIIVRDGGIRGFVIMFDKLNGVAV---DGYTIEAEAGANLIETTHIALHHSLT 117

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           GF F  GIPGSIGGA +MNAGA   E S  ++    + R G    I  + +K+ YR S +
Sbjct: 118 GFEFACGIPGSIGGAVFMNAGAYGGEISHILLSCKVLTRDGEIKNISAQDMKFGYRRSYV 177

Query: 185 TK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            +   ++        P    +I   +  + H R+  QP++  + GS FK P GH A QLI
Sbjct: 178 QQTGDVVISAKFALAPGMHRVIRQEMERLTHLRQLKQPLEYPSCGSVFKRPVGHFAGQLI 237

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
            ++  +G   GG ++S  H  FM+N DN T  D E L   V + V   SG+ LE E++ +
Sbjct: 238 SEANLKGHRIGGVEVSTKHAGFMVNVDNGTAADYENLIAHVIETVKAHSGVTLEREVRII 297

Query: 304 GD 305
           G+
Sbjct: 298 GE 299


>gi|172079610|ref|ZP_02709519.2| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae CDC1873-00]
 gi|183603503|ref|ZP_02717436.2| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae CDC3059-06]
 gi|183603515|ref|ZP_02715436.2| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae CDC0288-04]
 gi|225854837|ref|YP_002736349.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae JJA]
 gi|225857025|ref|YP_002738536.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae P1031]
 gi|303254546|ref|ZP_07340650.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae BS455]
 gi|303258986|ref|ZP_07344965.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP-BS293]
 gi|303261670|ref|ZP_07347617.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP14-BS292]
 gi|303264339|ref|ZP_07350259.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae BS397]
 gi|303265862|ref|ZP_07351759.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae BS457]
 gi|303268195|ref|ZP_07353994.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae BS458]
 gi|307127041|ref|YP_003879072.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae 670-6B]
 gi|254765613|sp|C1CEX8|MURB_STRZJ RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|254765614|sp|C1CL98|MURB_STRZP RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|172042222|gb|EDT50268.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae CDC1873-00]
 gi|183574363|gb|EDT94891.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae CDC0288-04]
 gi|183576750|gb|EDT97278.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae CDC3059-06]
 gi|225723565|gb|ACO19418.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae JJA]
 gi|225724321|gb|ACO20173.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae P1031]
 gi|301802131|emb|CBW34867.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae INV200]
 gi|302598514|gb|EFL65556.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae BS455]
 gi|302637250|gb|EFL67738.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP14-BS292]
 gi|302639929|gb|EFL70385.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP-BS293]
 gi|302642274|gb|EFL72622.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae BS458]
 gi|302644597|gb|EFL74847.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae BS457]
 gi|302646151|gb|EFL76378.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae BS397]
 gi|306484103|gb|ADM90972.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae 670-6B]
          Length = 301

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 96/298 (32%), Positives = 149/298 (50%), Gaps = 6/298 (2%)

Query: 11  RERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVG 68
            +  + L G   +   PL   ++ + GG A+ +  P++  +L   +      +IP  ++G
Sbjct: 5   EKMLEILEGIDIRFKEPLHSYSYTKVGGEADYLVFPRNRFELARLVKFANQENIPWMVLG 64

Query: 69  LGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHF 128
             SNI+VRD GIRG V+        ++   +   +   A  +       ALRH + GF F
Sbjct: 65  NASNIIVRDGGIRGFVILCDKLNNVSV---DGYTIEAEAGANLIETTRIALRHSLTGFEF 121

Query: 129 FYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-D 187
             GIPGS+GGA +MNAGA   E +  +     + + G    +  + L + YR S I +  
Sbjct: 122 ACGIPGSVGGAVFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAKDLAFGYRHSAIQESG 181

Query: 188 LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSG 247
            ++  V     P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G
Sbjct: 182 AVVLSVKFALAPGTHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAG 241

Query: 248 CRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            +G   GG ++SE H  FMIN  + T  D E L + V +KV   SGI LE E++ LG+
Sbjct: 242 LKGYRIGGVEVSEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGITLEREVRILGE 299


>gi|317055681|ref|YP_004104148.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Ruminococcus albus
           7]
 gi|315447950|gb|ADU21514.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Ruminococcus albus
           7]
          Length = 311

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 96/308 (31%), Positives = 144/308 (46%), Gaps = 6/308 (1%)

Query: 1   MIYGRI-SRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP 59
           M    + +R L    ++L  +   + PL +   FR GG    M        +        
Sbjct: 1   MKELDMNTRSLLNLAEELECRVLPDEPLDKHNTFRIGGQCTAMIDINSPDAISQLWEEAN 60

Query: 60  S-DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSA 118
              I    +G GSN+L  D G  G++  + ++    I +++   ++  A C    L   A
Sbjct: 61  RLGIRTMALGNGSNVLFDDRGFNGIIFLIGSSM-DKIYMKDDNTIVAQAGCPLLKLCRFA 119

Query: 119 LRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQ 178
           L H + G  F YGIPGS+GGA +MNAGA   E    +     +DR G Q     +Q+K+ 
Sbjct: 120 LEHSLSGLEFAYGIPGSVGGAIFMNAGAYGGEIKDVIKYGRAVDRDGRQFEYKADQMKFG 179

Query: 179 YRSSEIT-KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGH 237
           YR+S       +I          S + I   + ++   R   QP+   + GSTFK P G 
Sbjct: 180 YRTSRFIASGELIVEGEFELPSGSYDDIQDKMVDLMGRRRDKQPLNMPSAGSTFKRPEGE 239

Query: 238 --SAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGIL 295
              A +LI+ SG RG   GGA++SE HC F++N   AT  D+  L  QV+ KV+  SGI 
Sbjct: 240 GLFAGKLIQDSGLRGFSVGGAQVSEKHCGFVVNKGGATSADVLELIRQVKDKVYKDSGIE 299

Query: 296 LEWEIKRL 303
           LE E++ +
Sbjct: 300 LECEVRYI 307


>gi|289167588|ref|YP_003445857.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus mitis
           B6]
 gi|288907155|emb|CBJ21989.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus mitis
           B6]
          Length = 301

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 95/298 (31%), Positives = 148/298 (49%), Gaps = 6/298 (2%)

Query: 11  RERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVG 68
            +  + L G   +   PL   ++ + GG A+ +  P++  +L   +      +IP  ++G
Sbjct: 5   EKMLEILEGIDIRFKEPLHSYSYTKVGGEADYLVFPRNRFELARVVKFANQENIPWMVLG 64

Query: 69  LGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHF 128
             SNI+VRD GIRG V+        ++   +   +   A  +       ALRH + GF F
Sbjct: 65  NASNIIVRDGGIRGFVILCDKLNNVSV---DGYTIEAEAGANLIETTRIALRHSLTGFEF 121

Query: 129 FYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-D 187
             GIPGS+GGA +MNAGA   E +  +     + + G    +  + L + YR S I +  
Sbjct: 122 ACGIPGSVGGAVFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAKDLAFGYRHSAIQESG 181

Query: 188 LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSG 247
            ++        P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G
Sbjct: 182 AVVLSAKFALAPGTHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAG 241

Query: 248 CRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            +G   GG ++SE H  FMIN  + T  D E L E V +KV   SG+ LE E++ LG+
Sbjct: 242 LKGYRIGGVEVSEKHAGFMINVADGTAKDYEDLIESVIEKVKEHSGVTLEREVRILGE 299


>gi|169832740|ref|YP_001694824.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae Hungary19A-6]
 gi|183603272|ref|ZP_02713753.2| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP195]
 gi|237651179|ref|ZP_04525431.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae CCRI 1974]
 gi|237821261|ref|ZP_04597106.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae CCRI 1974M2]
 gi|254765585|sp|B1ICI9|MURB_STRPI RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|168995242|gb|ACA35854.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae Hungary19A-6]
 gi|183571950|gb|EDT92478.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP195]
          Length = 301

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 96/298 (32%), Positives = 149/298 (50%), Gaps = 6/298 (2%)

Query: 11  RERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVG 68
            +  + L G   +   PL   ++ + GG A+ +  P++  +L   +      +IP  ++G
Sbjct: 5   EKMLEILEGIDIRFKEPLHSYSYTKVGGEADYLVFPRNRFELARVVKFANQENIPWMVLG 64

Query: 69  LGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHF 128
             SNI+VRD GIRG V+        ++   +   +   A  +       ALRH + GF F
Sbjct: 65  NASNIIVRDGGIRGFVILCDKLNNVSV---DGYTIEAEAGANLIETTRIALRHSLTGFEF 121

Query: 129 FYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-D 187
             GIPGS+GGA +MNAGA   E +  +     + + G    +  + L + YR S I +  
Sbjct: 122 ACGIPGSVGGAVFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAKDLAFGYRHSAIQESG 181

Query: 188 LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSG 247
            ++  V     P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G
Sbjct: 182 AVVLSVKFALAPGTHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAG 241

Query: 248 CRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            +G   GG ++SE H  FMIN  + T  D E L + V +KV   SGI LE E++ LG+
Sbjct: 242 LKGYRIGGVEVSEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGITLEREVRILGE 299


>gi|139437195|ref|ZP_01771355.1| Hypothetical protein COLAER_00334 [Collinsella aerofaciens ATCC
           25986]
 gi|133776842|gb|EBA40662.1| Hypothetical protein COLAER_00334 [Collinsella aerofaciens ATCC
           25986]
          Length = 303

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 91/285 (31%), Positives = 133/285 (46%), Gaps = 1/285 (0%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAG 79
             E+  L + T +R GG A++       H L+  + +L    +P  I+G GSN+LV D G
Sbjct: 18  VIEDERLARHTSYRIGGKADLFVTCHSYHALRRAVAVLDREQVPWVIIGKGSNLLVADGG 77

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
            RG V+ L       +   + C + VGA      L N AL   + G  F  GIPGS+GGA
Sbjct: 78  YRGAVISLGREFQRTVVADDGCTLTVGAGVMFARLVNDALSRSLSGLEFAVGIPGSVGGA 137

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFP 199
             MNAG         V +V   D           ++ + YR   + ++ II   VL+  P
Sbjct: 138 ISMNAGTRTEWIGSLVEDVVTFDPASGIKHYAGSEITWGYRECSLPRNEIILECVLKLKP 197

Query: 200 ESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKIS 259
             +  I   +      R+  QP+   + GS F+NP   S  +LIE  G +G   GGA++S
Sbjct: 198 APKADIRERMERYLTRRKRTQPMGRASCGSVFRNPPDASVGKLIEDCGLKGFSIGGAEVS 257

Query: 260 ELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            +H NF++N   A+  D+  +   V  KV    GI L  E+K LG
Sbjct: 258 PVHANFIVNNGTASADDVAAVIRHVHGKVREAYGIELRPEVKFLG 302


>gi|306833619|ref|ZP_07466746.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus bovis ATCC
           700338]
 gi|304424389|gb|EFM27528.1| UDP-N-acetylmuramate dehydrogenase [Streptococcus bovis ATCC
           700338]
          Length = 300

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 95/302 (31%), Positives = 149/302 (49%), Gaps = 7/302 (2%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPI 64
           +   L E  K++    + + PLK+ T+ + GG A+ +  P++ ++L   +T    ++IP 
Sbjct: 1   MLEFLNEELKEI--DIRVDEPLKKYTYTKVGGPADYLAFPRNRYELARIVTFANKNNIPW 58

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G  SNI+VRD GIRG V+         +   N   +   A  +       A  H + 
Sbjct: 59  MVLGNASNIIVRDGGIRGFVIMFDKLNTVTV---NGYVIEAEAGANLIETTRIAKFHSLT 115

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           GF F  GIPGS+GGA +MNAGA   E S  +V    I ++G    I    +K+ YR S +
Sbjct: 116 GFEFACGIPGSVGGAVFMNAGAYGGEISHILVSAQVITKEGEIKTIEARDMKFGYRHSAV 175

Query: 185 TK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
                ++        P    +I   +A + H RE  QP++  + GS FK P GH A QLI
Sbjct: 176 QDSGDVVISAKFALKPGDYVLIEQEMARLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLI 235

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
            ++  +G   GG ++S+ H  FM+N  +    D E L   V   V   SG+ LE E++ +
Sbjct: 236 SEANLKGHRIGGVEVSKKHAGFMVNVADGNAQDYEDLIAHVIDTVEKNSGVRLEREVRII 295

Query: 304 GD 305
           G+
Sbjct: 296 GE 297


>gi|114799112|ref|YP_759127.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Hyphomonas neptunium
           ATCC 15444]
 gi|123028401|sp|Q0C566|MURB_HYPNA RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|114739286|gb|ABI77411.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Hyphomonas neptunium
           ATCC 15444]
          Length = 323

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 126/318 (39%), Positives = 171/318 (53%), Gaps = 14/318 (4%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M     S  L      +RGK      L   TWFR GG A+ +F P D  DL+ FL  L  
Sbjct: 1   MTPTSPSPDLLPTLPDVRGKLLRGAELAPYTWFRVGGPADALFLPADEEDLEAFLKALDP 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
            IP+T +G+GSN++VRD GI G+V+RL    +  IE  +   +   A     ++A +A  
Sbjct: 61  AIPVTPLGVGSNLIVRDGGIPGIVIRLMGKYWGEIEALDGITLTARAGALDLAVAKAAAA 120

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPR-------E 173
           +GI G  F  GIPGS+GGA   NAG    E    +V +HG  R G++             
Sbjct: 121 NGITGLEFLSGIPGSLGGATRTNAGCYGSELRDRLVALHGFRRDGSRVAYRGPGKPGALP 180

Query: 174 QLKYQYRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRET-VQPIKEKTGGSTFK 232
           +  + YR +++  DLI+T ++L G         +A       R    QPIKEKT GSTF 
Sbjct: 181 EAHFSYRHTDLPDDLIVTRLILEGTGAGDPEAISADIAALQARRAQTQPIKEKTSGSTFA 240

Query: 233 NPTG------HSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRK 286
           NP         SAW+LI+ +GCRGL+ GGA++S LHCNF+IN  +AT  DLE LGE VR 
Sbjct: 241 NPDPPGTPDQRSAWKLIDAAGCRGLKVGGAQVSPLHCNFLINTGDATAADLEALGELVRA 300

Query: 287 KVFNQSGILLEWEIKRLG 304
           +V   SG+ L WE++R+G
Sbjct: 301 RVLENSGVELRWEVRRMG 318


>gi|149011628|ref|ZP_01832824.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP19-BS75]
 gi|147764059|gb|EDK70991.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP19-BS75]
 gi|332074970|gb|EGI85442.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae GA41301]
          Length = 295

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 94/287 (32%), Positives = 145/287 (50%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAG 79
            +   PL   ++ + GG A+ +  P++  +L   +      +IP  ++G  SNI+VRD G
Sbjct: 10  IRFQEPLHSYSYTKVGGEADYLVFPRNRFELARLVKFANQENIPWMVLGNASNIIVRDGG 69

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRG V+        ++   +   +   A  +       ALRH + GF F  GIPGS+GGA
Sbjct: 70  IRGFVILCDKLNNVSV---DGYTIEAEAGANLIETTRIALRHSLTGFEFACGIPGSVGGA 126

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            +MNAGA   E +  +     + + G    +  + L + YR S I +   ++  V     
Sbjct: 127 VFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAKDLAFGYRHSAIQESGAVVLSVKFALA 186

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G   GG ++
Sbjct: 187 PGTHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGYRIGGVEV 246

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H  FMIN  + T  D E L + V +KV   SGI LE E++ LG+
Sbjct: 247 SEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGITLEREVRILGE 293


>gi|119492220|ref|ZP_01623630.1| UDP-N-acetylenolpyruvylglucosamine reductase [Lyngbya sp. PCC 8106]
 gi|119453277|gb|EAW34443.1| UDP-N-acetylenolpyruvylglucosamine reductase [Lyngbya sp. PCC 8106]
          Length = 327

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 86/289 (29%), Positives = 145/289 (50%), Gaps = 4/289 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAG 79
            Q    L   T +R GG AE    P+++ +++  L       +  T++G GSN+L+ D G
Sbjct: 37  IQSKVSLASHTSYRVGGPAEWYVAPKNLDEMQASLAWAAEQGLSATLLGGGSNLLISDQG 96

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           + G+V+       ++       ++ V A  S   LA  A R G  G  +  GIPG++GGA
Sbjct: 97  LSGLVIGTRGLRHTHF-DLATGQLHVAAGESLPRLAWKAARLGWQGLEWAVGIPGTVGGA 155

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFP 199
             MNAGA+   T++ +V+   + R G   V+  + L Y+YR+S +     +         
Sbjct: 156 VVMNAGAHGSSTAEILVQAEVLSRSGQLEVLTPQDLAYRYRTSNLQNSDRVVLQATFALQ 215

Query: 200 E--SQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
                 ++ A   +   HR + QP    + GS F+NP    A  LIE++G +G + GGA+
Sbjct: 216 PGADPALVLAETTDQLRHRRSSQPYHLPSCGSVFRNPGPKPAGWLIEQAGLKGYQIGGAQ 275

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           ++E H NF++N   AT  ++  L   V+++V  +   LLE E++ +G+F
Sbjct: 276 VAERHANFIVNCGGATATEIFQLIRHVQEQVEQRWSYLLEPEVRIIGEF 324


>gi|332200832|gb|EGJ14904.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae GA41317]
 gi|332203219|gb|EGJ17287.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae GA47901]
          Length = 295

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 94/287 (32%), Positives = 145/287 (50%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAG 79
            +   PL   ++ + GG A+ +  P++  +L   +      +IP  ++G  SNI+VRD G
Sbjct: 10  IRFQEPLHSYSYTKVGGEADYLVFPRNRFELARVVKFANQENIPWMVLGNASNIIVRDGG 69

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRG V+        ++   +   +   A  +       ALRH + GF F  GIPGS+GGA
Sbjct: 70  IRGFVILCDKLNNVSV---DGYTIEAEAGANLIETTRIALRHSLTGFEFACGIPGSVGGA 126

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            +MNAGA   E +  +     + + G    +  + L + YR S I +   ++  V     
Sbjct: 127 VFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAKDLAFGYRHSAIQESGAVVLSVKFALA 186

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G   GG ++
Sbjct: 187 PGTHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGYRIGGVEV 246

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H  FMIN  + T  D E L + V +KV   SGI LE E++ LG+
Sbjct: 247 SEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGITLEREVRILGE 293


>gi|310826756|ref|YP_003959113.1| hypothetical protein ELI_1162 [Eubacterium limosum KIST612]
 gi|308738490|gb|ADO36150.1| hypothetical protein ELI_1162 [Eubacterium limosum KIST612]
          Length = 302

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 88/307 (28%), Positives = 147/307 (47%), Gaps = 7/307 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-P 59
           M    I   L +     R     + P+K    F+ GG A+ +  P+   +    L     
Sbjct: 1   MNKEMIKNKLMDVIAAER--ILCDEPMKNHISFKVGGPADFLVVPESCEEFINVLACCRK 58

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
           +++P  ++G G+N+LVRD G RGV+++        +                K +A +AL
Sbjct: 59  NNLPFYVMGNGTNLLVRDNGYRGVMIKTRQLCRITVGDTGISAEP---GSLLKDVAQAAL 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
              + G  F  GIPGS+GGA  MNAGA + E    +  +  +   G    +P ++ +  Y
Sbjct: 116 EGCLTGMEFASGIPGSLGGAVVMNAGAYDGEMKDIIRSIEVVTESGEILELPIDECRMGY 175

Query: 180 RSSEITKDLIITH-VVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S + ++      V L       N I A + ++   R + QP++  + GSTF+ P G+ 
Sbjct: 176 RKSIVQENPWFVTGVNLLLRKGDYNTIKAKMDDLNERRRSKQPLEYPSAGSTFRRPEGYF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +L++  G +G   GGA++SE H  F+IN DNAT  D+  L + ++KKV    G+ +  
Sbjct: 236 AGKLVQDCGFKGYCVGGAQVSEKHSGFVINKDNATADDIITLIQTIQKKVKQDYGVDMRT 295

Query: 299 EIKRLGD 305
           E+  +G+
Sbjct: 296 EVIMIGE 302


>gi|319891740|ref|YP_004148615.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           pseudintermedius HKU10-03]
 gi|317161436|gb|ADV04979.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           pseudintermedius HKU10-03]
          Length = 309

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 101/312 (32%), Positives = 159/312 (50%), Gaps = 6/312 (1%)

Query: 1   MIYGRISRLLRERGKQLRGKFQE-NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL- 58
           M++   S +L++  K +     + + PLK+ T+  TGGNA+    P+   D++  +    
Sbjct: 1   MLFVNHSSILQDLEKLIPASIIKVDEPLKRYTYTETGGNADFYISPERYEDVQKVVKYAY 60

Query: 59  PSDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSA 118
             DIP+T +G GSNI++RD GIRG+VL L +       V +   +I G+  +   ++  A
Sbjct: 61  EHDIPVTYLGNGSNIIIRDGGIRGIVLSLLSLNHI---VTSDATIIAGSGAAIIDVSRKA 117

Query: 119 LRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQ 178
               + G  F  GIPGSIGGA YMNAGA   E    +     ID +G    +   +L+  
Sbjct: 118 RDVSLTGLEFACGIPGSIGGAVYMNAGAYGGEVKDVIDYALVIDERGELLKLTHNELELD 177

Query: 179 YRSSEITKDLII-THVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGH 237
           YR+S I +   +         P  Q  I   + ++   RE+ QP++  + GS F+ P GH
Sbjct: 178 YRNSIIQQQHYVVLEAAFTLTPGKQEDIQEKMDDLTERRESKQPLEYPSCGSVFRRPPGH 237

Query: 238 SAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLE 297
            A QLI+ +  +G   GG ++S  H  FM+N D+ T  D E L   V+  V  + GI LE
Sbjct: 238 FAGQLIQNADLQGHRIGGVEVSRKHAGFMVNVDHGTATDYENLIHHVQNVVKEKFGIELE 297

Query: 298 WEIKRLGDFFDH 309
            E++ +G+  + 
Sbjct: 298 REVRIIGEDLEK 309


>gi|94988574|ref|YP_596675.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pyogenes MGAS9429]
 gi|94992396|ref|YP_600495.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pyogenes MGAS2096]
 gi|166222852|sp|Q1JBV7|MURB_STRPB RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|166222853|sp|Q1JLT8|MURB_STRPC RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|94542082|gb|ABF32131.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pyogenes MGAS9429]
 gi|94545904|gb|ABF35951.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pyogenes MGAS2096]
          Length = 295

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 94/287 (32%), Positives = 143/287 (49%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAG 79
            +EN PLK  T+ + GG A+ +  P++ ++L   +      ++P  ++G  SN++VRD G
Sbjct: 10  IRENEPLKHYTYTKVGGPADFLAFPRNHYELSRIVAYANKENMPWLVLGNASNLIVRDGG 69

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRG V+        ++   N   +   A  +       A  H + GF F  GIPGSIGGA
Sbjct: 70  IRGFVIMFDKLNAVHL---NGYTLKAEAGANLIETTKIAKFHSLTGFEFACGIPGSIGGA 126

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            +MNAGA   E S   +    +   G    I    + + YR S I +   I+        
Sbjct: 127 VFMNAGAYGGEISHIFLSAKVLTPSGEIKTISARDMAFGYRHSAIQETGDIVISAKFALK 186

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P + + IS  +  + H R+  QP++  + GS FK P GH A QLI ++  +G   GG ++
Sbjct: 187 PGNYDTISQEMNRLNHLRQLKQPLEFPSCGSVFKRPPGHFAGQLIMEANLKGHRIGGVEV 246

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H  FMIN  + T  D E L   V + V N SG+ LE E++ +G+
Sbjct: 247 SEKHAGFMINVADGTAKDYEDLIAYVIETVENHSGVKLEPEVRIIGE 293


>gi|196247921|ref|ZP_03146623.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus sp.
           G11MC16]
 gi|187609780|sp|A4ILI2|MURB_GEOTN RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|196212705|gb|EDY07462.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus sp.
           G11MC16]
          Length = 304

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 99/288 (34%), Positives = 151/288 (52%), Gaps = 5/288 (1%)

Query: 20  KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDA 78
               + P+K  T  R GG A+ +  P+    +   L L    ++P T++G GSN+++RD 
Sbjct: 19  NVLRDEPMKHHTLVRIGGKADFLVWPETYEQVVDVLRLKEEYELPFTLLGNGSNVIIRDG 78

Query: 79  GIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGG 138
           G+RG+V++L +        R    +I  +    K+++  AL   + G  F  GIPGS+GG
Sbjct: 79  GLRGIVMQLKHLNRIW---REGNNIIAQSGADIKAVSRFALEQHLTGLEFACGIPGSVGG 135

Query: 139 AAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRG 197
           A  MNAGA   E    +  V      G    +  E+L+  YR+S I++   I+  VV   
Sbjct: 136 AIMMNAGAYGGEVKDVLDHVKVATLTGELKTLTNEELELGYRTSLISRTHDIVLEVVFAL 195

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
            P     I A + ++   RE+ QP++  + GS FK P G+ A +LI+ SG +G  FGGA+
Sbjct: 196 QPGDYGQIKAKMDDLTFQRESKQPLEYPSVGSVFKRPPGYFAGKLIQDSGLQGKGFGGAE 255

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +S  H  F+IN +NAT  D     E VRK V  + G+ LE E+K LG+
Sbjct: 256 VSTKHAGFIINKNNATAADYIATIEMVRKTVKEKFGVELELEVKILGE 303


>gi|19746052|ref|NP_607188.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pyogenes MGAS8232]
 gi|29336785|sp|Q8P150|MURB_STRP8 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|19748221|gb|AAL97687.1| putative UDP-N-acetylenolpyruvoylglucosamine reductase
           [Streptococcus pyogenes MGAS8232]
          Length = 295

 Score =  210 bits (534), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 94/287 (32%), Positives = 143/287 (49%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAG 79
            +EN PLK  T+ + GG A+ +  P++ ++L   +      ++P  ++G  SN++VRD G
Sbjct: 10  IRENEPLKHYTYTKVGGPADFLAFPRNHYELSRIVAYANKENMPWLVLGNASNLIVRDGG 69

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRG V+        ++   N   +   A  +       A  H + GF F  GIPGSIGGA
Sbjct: 70  IRGFVIMFDKLNAVHL---NGYTLEAEAGANLIETTKIAKFHSLTGFEFACGIPGSIGGA 126

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            +MNAGA   E S   +    +   G    I    + + YR S I +   I+        
Sbjct: 127 VFMNAGAYGGEISHIFLSAKVLTPSGEIKTISARDMAFGYRHSAIQETGDIVISAKFALK 186

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P + + IS  +  + H R+  QP++  + GS FK P GH A QLI ++  +G   GG ++
Sbjct: 187 PGNYDTISQEMNRLNHLRQLKQPLEFPSCGSVFKRPPGHFAGQLIMEANLKGHRIGGVEV 246

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H  FMIN  + T  D E L   V + V N SG+ LE E++ +G+
Sbjct: 247 SEKHAGFMINVADGTAKDYEDLIAYVIETVENHSGVRLEPEVRIIGE 293


>gi|56808703|ref|ZP_00366424.1| COG0812: UDP-N-acetylmuramate dehydrogenase [Streptococcus pyogenes
           M49 591]
 gi|209559387|ref|YP_002285859.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pyogenes NZ131]
 gi|254765611|sp|B5XLF2|MURB_STRPZ RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|209540588|gb|ACI61164.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pyogenes NZ131]
          Length = 295

 Score =  210 bits (534), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 94/287 (32%), Positives = 143/287 (49%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAG 79
            +EN PLK  T+ + GG A+ +  P++ ++L   +      ++P  ++G  SN++VRD G
Sbjct: 10  IRENEPLKHYTYTKVGGPADFLAFPRNRYELSRIVAYANKENMPWLVLGNASNLIVRDGG 69

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRG V+        ++   N   +   A  +       A  H + GF F  GIPGSIGGA
Sbjct: 70  IRGFVIMFDKLNAVHL---NGYTLEAEAGANLIETTKIAKFHSLTGFEFACGIPGSIGGA 126

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            +MNAGA   E S   +    +   G    I    + + YR S I +   I+        
Sbjct: 127 VFMNAGAYGGEISHIFLSAKVLTSSGEIKTISARDMAFGYRHSAIQETGDIVISAKFALK 186

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P + + IS  +  + H R+  QP++  + GS FK P GH A QLI ++  +G   GG ++
Sbjct: 187 PGNYDTISQEMNRLNHLRQLKQPLEFPSCGSVFKRPPGHFAGQLIMEANLKGHRIGGVEV 246

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H  FMIN  + T  D E L   V + V N SG+ LE E++ +G+
Sbjct: 247 SEKHAGFMINVADGTAKDYEDLIAYVIETVENHSGVRLEPEVRIIGE 293


>gi|29653495|ref|NP_819187.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Coxiella burnetii
           RSA 493]
 gi|161830959|ref|YP_001596105.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Coxiella burnetii
           RSA 331]
 gi|47605865|sp|Q83F16|MURB_COXBU RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|189028923|sp|A9NA46|MURB_COXBR RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|29540757|gb|AAO89701.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Coxiella burnetii
           RSA 493]
 gi|161762826|gb|ABX78468.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Coxiella burnetii
           RSA 331]
          Length = 316

 Score =  210 bits (534), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 103/312 (33%), Positives = 151/312 (48%), Gaps = 18/312 (5%)

Query: 11  RERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLG 70
           +E   +LRG+   + PL + T +R GG AE  ++P D+ DL+ FLT LPSD P+T +GLG
Sbjct: 3   KENFTRLRGELFCDHPLARYTSWRVGGKAERFYRPADLFDLQDFLTQLPSDEPLTWLGLG 62

Query: 71  SNILVRDAGIRGVVLRLSNA------------------GFSNIEVRNHCEMIVGARCSGK 112
           SN+L+RD GI+G V+   N                               +   A  +  
Sbjct: 63  SNVLIRDGGIKGTVILTLNRLKELSVVNSQLVFREKSGTEDFFSGNGKTIIRAEAGVTCA 122

Query: 113 SLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPR 172
            LA   +  G+    FF GIPG++GGA  MNAGA   ET + V+ V  ++ +G       
Sbjct: 123 KLAKFCVSQGLEDGAFFAGIPGTVGGALAMNAGAFGGETWRTVIGVETMNHQGEILKRTP 182

Query: 173 EQLKYQYRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFK 232
           ++ K  YR  E  ++               +    AI  +   R   QPI + + GS F+
Sbjct: 183 DEFKIHYRQVEGLENQFFIAGYFCFNHGDPDKAKTAINALLKKRNLSQPIGKYSCGSVFR 242

Query: 233 NPTGHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQS 292
           NP G  A +LIE +G +G   G A++SE H NF++N  NA+  D+E L   V + V    
Sbjct: 243 NPPGDYAARLIESAGLKGKSIGNAEVSEKHANFILNKGNASAADIEALIHYVAQHVSQIH 302

Query: 293 GILLEWEIKRLG 304
           GI L  E+  +G
Sbjct: 303 GIQLVKEVHIIG 314


>gi|261367005|ref|ZP_05979888.1| UDP-N-acetylmuramate dehydrogenase [Subdoligranulum variabile DSM
           15176]
 gi|282571123|gb|EFB76658.1| UDP-N-acetylmuramate dehydrogenase [Subdoligranulum variabile DSM
           15176]
          Length = 309

 Score =  210 bits (534), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 102/308 (33%), Positives = 149/308 (48%), Gaps = 5/308 (1%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M+  +I   LR   +     F E  PL   T F+ GG A     PQD   L++ L L  S
Sbjct: 1   MMQEQIQTKLRCALQGANLPFTEQEPLAAHTTFKIGGPAAFWCAPQDEEQLQHTLALCRS 60

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLS--NAGFSNIEVRNHCEMIVGARCSGKSLANS 117
             + + ++G GSN L  D G  G V+ L       +    +    +  GA  +   L   
Sbjct: 61  TGVRVYLLGNGSNTLFSDEGFDGAVVDLRGLTPAVTENPKKETVLLTAGAGMTLGRLCAE 120

Query: 118 ALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKY 177
           A + G+ G  F  GIPG++GGA YMNAGA   E    + +V  +D    Q  +P  +L+ 
Sbjct: 121 AQQRGLSGLEFACGIPGTVGGAVYMNAGAYGGELKDVIEQVTFLDDNLIQRTLPASELQM 180

Query: 178 QYRSSEITKD--LIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPT 235
            YR+S   K+    I    +R    +   I A +      R+  QP++  + GSTFK P 
Sbjct: 181 GYRTSVFEKNPSWCILSAAVRLQKGNAAEILARMQEYLERRKAKQPLEWPSAGSTFKRPQ 240

Query: 236 GHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGIL 295
           G  A +LIE  G RG   GGA+ISE H  F+IN   AT  D+  L ++V++ V  ++G +
Sbjct: 241 GAFAGRLIEDCGLRGFTVGGAQISEKHGGFVINKGGATCADVVALTDEVKRIVQEKTGFV 300

Query: 296 LEWEIKRL 303
           LE EI+ +
Sbjct: 301 LEREIRVV 308


>gi|258542972|ref|YP_003188405.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256634050|dbj|BAI00026.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256637110|dbj|BAI03079.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256640162|dbj|BAI06124.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256643219|dbj|BAI09174.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256646274|dbj|BAI12222.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256649327|dbj|BAI15268.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256652313|dbj|BAI18247.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256655371|dbj|BAI21298.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 314

 Score =  210 bits (534), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 122/306 (39%), Positives = 169/306 (55%), Gaps = 6/306 (1%)

Query: 4   GRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIP 63
             +  +++     +RG+     PL   TWFR GG AE +FQP D  DL   L  L  ++P
Sbjct: 5   ASMQDMVKHAFANMRGRLTPQAPLGPRTWFRVGGAAEWLFQPADAEDLAGVLQRLSPELP 64

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           IT +G  SN+++RD G+ GVV+R++      I V     +   A C   ++A  A + G+
Sbjct: 65  ITALGACSNVIIRDGGLEGVVVRMARGFAD-ITVEADGIIAGCA-CLDATVAEHAAQAGL 122

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            G  F  GIPGSIGGA  MNAGA   + +  +     I R G+   +    L++ YR S 
Sbjct: 123 SGLEFLAGIPGSIGGAVRMNAGAYGSDIANVLDWAEIITRDGSLIRLDNAALRFGYRRSG 182

Query: 184 ITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPT----GHSA 239
           + +   +    LR  P +   ++  IA V   RE  QP++ +TGGSTF+NP        A
Sbjct: 183 LPEGAFVIRARLRSIPANPQDVANRIAEVRAARELSQPVRARTGGSTFRNPDAETSSRKA 242

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
           W+LI+ +GCRGL  G A++SE HCNF+IN  NAT  DLE LGE VR +V   SG+ L WE
Sbjct: 243 WELIDAAGCRGLRCGDAQVSEKHCNFLINLGNATAADLEGLGEDVRTRVAQNSGVSLHWE 302

Query: 300 IKRLGD 305
           IKRLG 
Sbjct: 303 IKRLGK 308


>gi|157150747|ref|YP_001450103.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           gordonii str. Challis substr. CH1]
 gi|189028945|sp|A8AWE3|MURB_STRGC RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|157075541|gb|ABV10224.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           gordonii str. Challis substr. CH1]
          Length = 302

 Score =  210 bits (534), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 96/299 (32%), Positives = 149/299 (49%), Gaps = 6/299 (2%)

Query: 10  LRERGKQLRG-KFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIV 67
           +     +L G   + + PLK+ T+ + GG A+ +  P++ ++L   +       IP  ++
Sbjct: 4   IELLKSELAGIDIRFDEPLKRYTYTKVGGPADYLAFPRNRYELVRLVKFANREQIPWMVL 63

Query: 68  GLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFH 127
           G  SNI+VRD GIRG V+         +   N   +   A        + AL H + GF 
Sbjct: 64  GNASNIIVRDGGIRGFVIMFDQLHTIMV---NGYTIEAEAGAKLIDTTHVALHHSLTGFE 120

Query: 128 FFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK- 186
           F  GIPGS+GGA +MNAGA   E +  +V    +  +G    I  E++K+ YRSS I + 
Sbjct: 121 FACGIPGSVGGAVFMNAGAYGGEIAHVLVSCKVLTPEGEIKTISAEEMKFGYRSSVIQET 180

Query: 187 DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKS 246
             I+        P +   I   +  + H RE  QP++  + GS FK P GH A QLI ++
Sbjct: 181 GDIVISAKFALSPGNYTAIQQEMKRLTHLRELKQPLEYPSCGSVFKRPLGHFAGQLISEA 240

Query: 247 GCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           G +G   GG ++S  H  FM+N  +    + E L   V + V  +SGI LE E++ +G+
Sbjct: 241 GLKGHRIGGVEVSTKHAGFMVNIADGNAQNYEDLIAHVIQTVEKESGIKLEREVRIIGE 299


>gi|319758027|gb|ADV69969.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus suis
           JS14]
          Length = 302

 Score =  210 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 99/306 (32%), Positives = 154/306 (50%), Gaps = 7/306 (2%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPI 64
           +   +R   + +    + + PLK+ T+ + GG  + +  P++ +++   +       IP 
Sbjct: 1   MKDKIRLELEGI--DIRFDEPLKEYTYTKVGGAVDYLAFPRNRYEIVRIVEFAKREGIPW 58

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G  SNI+VRD GIRG V+R+       +   +   +   A  +       AL H + 
Sbjct: 59  QVLGNSSNIIVRDGGIRGFVIRMDKLNSVTV---SGYTIEAEAGANLIETTKVALFHSLS 115

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           GF F  GIPGSIGGA YMNAGA   E +  +V    +   G    +   +L++ YRSS +
Sbjct: 116 GFEFACGIPGSIGGAVYMNAGAYGGEVAHILVSAQILTPAGYVETLDNRELRFGYRSSIL 175

Query: 185 TKDL-IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            ++  I+        P +  +I   +A + H RE  QP++  + GS FK P GH A QLI
Sbjct: 176 QENGAIVLSAKFALRPGNHTVIQQEMARLTHLRELKQPLEYPSCGSVFKRPLGHFAGQLI 235

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
             +G +G   GG ++SE H  FM+N +N T  D E L   V + V   SGI LE E++ +
Sbjct: 236 MDTGLKGYRIGGVEVSEKHAGFMVNIENGTASDYENLIAHVIQVVEKSSGITLEREVRII 295

Query: 304 GDFFDH 309
           GD  D 
Sbjct: 296 GDPADT 301


>gi|229162845|ref|ZP_04290802.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           R309803]
 gi|228620727|gb|EEK77596.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           R309803]
          Length = 301

 Score =  210 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 89/302 (29%), Positives = 145/302 (48%), Gaps = 5/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           + +L+ E  K   G+   N PL + T  + GG A+++  P+ +  ++  L L+       
Sbjct: 1   MEQLVNELIKANVGRVLVNEPLARYTTMKIGGPADILIVPKHVTSIEKTLQLVKQYKTKW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T++G GSN+LV D GI GVV+RL           +     VG       L+    R G+ 
Sbjct: 61  TVIGRGSNLLVSDKGIEGVVIRLGEGLDHLEVENHRVR--VGGGYPLIKLSTLLSRQGLA 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA+  + S  + +   +   G    +   ++++ YR+S +
Sbjct: 119 GLEFASGIPGSVGGAVYMNAGAHKSDISNVLSKALILFENGTIEWLMNREMEFSYRTSVL 178

Query: 185 TKDLI--ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
                  I     +     +  I   +     +R   QP      GS F+NP    A  L
Sbjct: 179 QTKRPGIILEAEFQLQVGKREEIVRNMQKNKDYRRETQPWNHPCAGSVFRNPLPEFAGNL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           +EK+G RG + GGA+ISE+H NF++N   A+  D+  L   ++  +  + GI +  E++ 
Sbjct: 239 VEKAGLRGYQIGGAQISEMHGNFIVNTGGASAQDVLSLIALIKHTIKEKFGIDMHTEVEI 298

Query: 303 LG 304
           +G
Sbjct: 299 IG 300


>gi|292670911|ref|ZP_06604337.1| UDP-N-acetylmuramate dehydrogenase [Selenomonas noxia ATCC 43541]
 gi|292647532|gb|EFF65504.1| UDP-N-acetylmuramate dehydrogenase [Selenomonas noxia ATCC 43541]
          Length = 303

 Score =  210 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 103/307 (33%), Positives = 165/307 (53%), Gaps = 6/307 (1%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS- 60
           +     R+  E    +R    ++ P++  T FR GG A+++F P++  +++  + L    
Sbjct: 1   MNKDFVRVCYEEFDPIR--LFQDAPMRFHTTFRIGGPADLLFYPKNTEEVQKIIRLAKKY 58

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           D  +T +G GSNILVRD GIR   L +  +           ++IVGA    + +A+ A  
Sbjct: 59  DELVTWLGNGSNILVRDGGIR--GLVIRFSHKMEDISHEGEDLIVGAGALLRDVASFAQE 116

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
            G+ G  F  GIPGSIGGA +MNAGA + E    VV V  +   G+  V   E L + YR
Sbjct: 117 RGLSGLEFACGIPGSIGGAVFMNAGAYDDEMKSVVVSVKTVSLNGDIRVYLSEDLDFSYR 176

Query: 181 SSEIT-KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
            S     D  I  + L    + + +I A + ++   R++ QP+   + GSTFK P G+ A
Sbjct: 177 HSIFQTCDEAICEIRLHLREDDKTLILARMKDLNQRRKSKQPLAYPSAGSTFKRPPGYFA 236

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
             LI+++G +GL  GGA++S+ H  F+IN  NAT  D++ L   V+K+V+ +  + L  E
Sbjct: 237 GTLIDQTGLKGLTVGGAQVSQKHAGFVINIGNATANDVQQLISAVQKRVYAKHEVQLFPE 296

Query: 300 IKRLGDF 306
           ++ +G+F
Sbjct: 297 LRIIGEF 303


>gi|52141579|ref|YP_085250.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           E33L]
 gi|81686522|sp|Q636B7|MURB1_BACCZ RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase 1;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase 1
 gi|51975048|gb|AAU16598.1| UDP-N-acetylenolpyruvoylglucosamine reductase (UDP-N-acetylmuramate
           dehydrogenase) [Bacillus cereus E33L]
          Length = 301

 Score =  210 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 88/302 (29%), Positives = 151/302 (50%), Gaps = 5/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           + +L+ E  +   G+   + PL + T  + GG A+++  P+ +  ++  L L+       
Sbjct: 1   MEQLVNELIEANVGRVLVDEPLARYTTMKIGGPADILIVPKHVAGIEKTLQLVKKYKTKW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T++G GSN+LV D GI GVV+RL          ++     VG       L+    R G+ 
Sbjct: 61  TVIGRGSNLLVSDLGIEGVVIRLGEGLEHLEVEKHRVR--VGGGYPLIKLSTLLSRQGLA 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA+  + S  + +   +   G    +   ++++ YR+S +
Sbjct: 119 GLEFASGIPGSVGGAVYMNAGAHKSDISNILSKALILFEDGTIDWLTHGEMEFSYRTSVL 178

Query: 185 TKDLI--ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
                  +     +     +  I + +     +R   QP      GS F+NPT + A  L
Sbjct: 179 QTKRPGIVLEAEFQLQIGERERIVSVMQKNKDYRRETQPWNHPCAGSVFRNPTPYFAGDL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IEK+G RG + GGA+ISE+H NF+IN   A+  D+  L   +++ + ++ G+ +  E++ 
Sbjct: 239 IEKAGLRGYQIGGAQISEMHGNFIINTGGASAQDVLSLIALIKQTIKDKFGVAMHTEVEI 298

Query: 303 LG 304
           +G
Sbjct: 299 IG 300


>gi|28377664|ref|NP_784556.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           plantarum WCFS1]
 gi|38258052|sp|Q88YF4|MURB_LACPL RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|28270497|emb|CAD63399.1| UDP-N-acetylmuramate dehydrogenase [Lactobacillus plantarum WCFS1]
          Length = 302

 Score =  210 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 91/302 (30%), Positives = 157/302 (51%), Gaps = 7/302 (2%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           +++ +      +  + ++N  L   T  +TGG A+ +  P+ I + K  +T     ++P+
Sbjct: 1   MTKDVLATFPAI--EIKKNESLSHYTNTKTGGPADYVRFPKSISETKALITFANEQNLPL 58

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T++G  SN++V+D GIRG+ + L+     +    +  +++  A  +  +    A    + 
Sbjct: 59  TVIGNASNLIVKDGGIRGLTIILTRMKQIH---ASGTKVVAEAGAAIIATTKVACGASLT 115

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA +MNAGA   E S+ V  V  +   G    +  ++L + YR S I
Sbjct: 116 GLEFAAGIPGSVGGAIFMNAGAYGGEMSEVVETVTVLTPAGQLKTLDHDELDFGYRHSTI 175

Query: 185 TK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
              D I+  V     P +Q  I A +  +   R   QP++  + GS FK PTG+   +LI
Sbjct: 176 QDYDDIVVSVTFGLKPGNQTKIQARMDELNTLRAAKQPLEWPSCGSVFKRPTGYFTGKLI 235

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
             +G +G   GGA++S+ H  F+IN D+AT  D   +   V+K VF + G+ L+ E++ +
Sbjct: 236 HDAGLQGHRIGGAEVSKKHAGFIINVDHATATDYMDMIHYVQKVVFERFGVHLQTEVRII 295

Query: 304 GD 305
           G+
Sbjct: 296 GE 297


>gi|222053883|ref|YP_002536245.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacter sp.
           FRC-32]
 gi|254764191|sp|B9M174|MURB_GEOSF RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|221563172|gb|ACM19144.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacter sp.
           FRC-32]
          Length = 303

 Score =  210 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 95/301 (31%), Positives = 145/301 (48%), Gaps = 4/301 (1%)

Query: 10  LRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVG 68
           L      +RGK   N PL   T  + GG A+    P D+ DL+  + ++ S  +P  I+G
Sbjct: 6   LARLCTAVRGKVLVNEPLAGHTSLKVGGPADYFAIPADLADLEELIKVVRSLSLPYFIIG 65

Query: 69  LGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHF 128
            G N+LV D G R   + +S    + +E  +   +   A  + + L N A    + G  F
Sbjct: 66  GGFNVLVGDGGFR--GVAISLKELNGMESPSRGRIRAEAGATNQQLVNYATGKELTGLEF 123

Query: 129 FYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL 188
              IPG+IGGA  +NAGA+   T + V E     R G        +  + YR  E+    
Sbjct: 124 LSCIPGTIGGALSVNAGAHGQSTMEQV-ETLITMRDGRIFENEGRKRNFGYRYLELEPGE 182

Query: 189 IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGC 248
           I+   V          I   + +   HR   Q I     GS FKNP G  AW+LI+++G 
Sbjct: 183 IVVAAVFSLSEGKAEAIGEKLESYRRHRLESQKIGYPNAGSFFKNPEGQQAWRLIDEAGF 242

Query: 249 RGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFD 308
           RG + GGA++SE+H NF++N   A+  D   L   +++KV  +SGILL+ E++ L ++  
Sbjct: 243 RGFQVGGAQVSEIHTNFLVNRGGASAADFITLAGMIKQKVLERSGILLQEEVRILDEYEQ 302

Query: 309 H 309
            
Sbjct: 303 K 303


>gi|196230906|ref|ZP_03129767.1| UDP-N-acetylmuramate/alanine ligase [Chthoniobacter flavus
           Ellin428]
 gi|196225247|gb|EDY19756.1| UDP-N-acetylmuramate/alanine ligase [Chthoniobacter flavus
           Ellin428]
          Length = 766

 Score =  210 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 104/306 (33%), Positives = 158/306 (51%), Gaps = 4/306 (1%)

Query: 2   IYGRISRLLRERGKQLR-GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP- 59
           I  R  + L E    +  G  +   PL + T  R GG A+   +P+        +     
Sbjct: 457 ILARDIKQLDELQTVMGHGTIKLYEPLSKHTTMRVGGPAQFWAEPETEEAFARLVRFCTL 516

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
           ++IP+ ++G GSN+LVRD GIRGVV+ L+   F  IEV++  ++  G     K LA +A 
Sbjct: 517 NEIPLFVMGRGSNLLVRDGGIRGVVVHLARGEFKTIEVKD-GKIQAGVGVKQKELAYAAR 575

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
              IGGF +  GIPG+IGGA  MNAGA   ET + VV V  +D  GN H+    ++  +Y
Sbjct: 576 DAEIGGFEWLEGIPGNIGGALRMNAGAMGGETFRQVVSVRFVDPHGNFHMKTPAEMDVRY 635

Query: 180 RSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
           R     +          G P +   I   +    H R T QP +  + G  FKNP    A
Sbjct: 636 RHCGTLEKNFAVSATFVGHPGNAEEIEKLLEASTHKRRTSQPRES-SAGCIFKNPEQCPA 694

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +L+++ G +G   GGAK+SE+H NF++N   AT  D+  + ++V++    + GI LE E
Sbjct: 695 GKLVDELGLKGTRVGGAKVSEVHGNFIVNDGGATAADVLAVIDKVKEVALRERGIQLETE 754

Query: 300 IKRLGD 305
           ++ +G+
Sbjct: 755 VQIVGE 760


>gi|23098011|ref|NP_691477.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Oceanobacillus
           iheyensis HTE831]
 gi|30316036|sp|Q8ESR4|MURB_OCEIH RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|22776235|dbj|BAC12512.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Oceanobacillus
           iheyensis HTE831]
          Length = 307

 Score =  210 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 85/284 (29%), Positives = 150/284 (52%), Gaps = 5/284 (1%)

Query: 24  NFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAGIRG 82
           +  ++  T+ + GG A+V   P+   +++  + L    D+P T++G GSN++V+D GIRG
Sbjct: 23  DELIRNHTYTKLGGKADVYITPESYSEVQDIIKLANKEDVPFTMLGNGSNLIVKDGGIRG 82

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
           +V+ L          R   ++I  +       + +AL   + G  F  GIPGS+GGA YM
Sbjct: 83  IVMNLQKLASIW---REEDKIIAQSGARIIDASRTALAESLAGLEFACGIPGSVGGALYM 139

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLRGFPES 201
           NAGA   E    +     + ++G+   +   +L   YR+S I  K  I+          +
Sbjct: 140 NAGAYGGEIKDVLESTIVVTKEGDIRTLTAVELDLDYRTSNIPDKGYIVLEATFALKKAN 199

Query: 202 QNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISEL 261
            + I   + ++ + RE+ QP++  + GS FK P G+ A +LI+ S  +G + GGA++S+ 
Sbjct: 200 SSDIKEVMDDLTYKRESKQPLEYPSCGSVFKRPPGYFAGKLIQDSELQGTQIGGAEVSKK 259

Query: 262 HCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           H  F++N +NA+  +   L   V+K V  + G+ LE E++ +G+
Sbjct: 260 HAGFIVNKNNASATEYINLIRHVQKTVSEKFGVQLEREVRIIGE 303


>gi|83592284|ref|YP_426036.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodospirillum
           rubrum ATCC 11170]
 gi|123527092|sp|Q2RVU6|MURB_RHORT RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|83575198|gb|ABC21749.1| UDP-N-acetylmuramate dehydrogenase [Rhodospirillum rubrum ATCC
           11170]
          Length = 319

 Score =  210 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 132/314 (42%), Positives = 181/314 (57%), Gaps = 7/314 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           MI  R    L +R   +RG+   +  L  +TWFR GG AE MF+P D  DL  FL   P 
Sbjct: 1   MIALRAPTPLIDRLPAVRGRLSADVALAPVTWFRVGGPAEAMFKPADAQDLADFLAGRPR 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           D+ + ++G+ SN+LVRD G+ GVV+RL  A      V     ++ GA     ++A  A  
Sbjct: 61  DVAVRVIGVASNLLVRDGGVPGVVIRLGRAFTGVEVVGET--LVCGASALDATVAKVAEA 118

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
            G+ G  F  GIPG++GGA  MNAGA+  E +  VV    +D  G  H +   Q+ + YR
Sbjct: 119 AGLAGLEFLSGIPGTLGGALRMNAGAHLREMADIVVLATAVDGLGQSHTLTPAQMGFSYR 178

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPT----- 235
           +  + +D I T  VL G P+ +  I+A +  +   RE  QP++ +TGGSTF NP      
Sbjct: 179 ACALPEDWIFTGCVLAGRPDERGAIAARMEALRQAREASQPLRARTGGSTFANPDPDLSG 238

Query: 236 GHSAWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGIL 295
           G  AW+LI+ +GCRGL  GGA++SE HCNF+IN   AT  DLE LGE VR++V + SG+ 
Sbjct: 239 GRRAWELIDAAGCRGLRLGGAQVSEKHCNFLINTGEATAADLEALGETVRRRVMDTSGVA 298

Query: 296 LEWEIKRLGDFFDH 309
           L WEIKR+G   D 
Sbjct: 299 LRWEIKRIGIGLDG 312


>gi|329667639|gb|AEB93587.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           johnsonii DPC 6026]
          Length = 301

 Score =  210 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 88/290 (30%), Positives = 148/290 (51%), Gaps = 3/290 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAG 79
            QEN PL + T+ +TGG A+ +  P+++++L+  +  +  ++IP+T++G  SN+++RD G
Sbjct: 13  IQENIPLSRFTFTKTGGPAQYLAFPKNLNELELLVDTVKENNIPLTVIGNASNLIIRDGG 72

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           I G+VL L+      +  ++   +   A       + +A   G+ G  F  GIPGS+GGA
Sbjct: 73  ISGLVLILTKMDTI-VANKDEATVTADAGARIIDTSEAACEAGLSGLEFAAGIPGSVGGA 131

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            +MNAGA   ET   +  V  + R G       +++++ YR S + +   I+        
Sbjct: 132 VFMNAGAYGGETEFVIKSVRVLTRAGEFKTYTHDEMEFGYRHSVVQETGDIVVSATFGLE 191

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P  +  I A +      R   QP++  + GS FK P GH    +I K+G +G   GGA+ 
Sbjct: 192 PGDKWAIKAKMEYFNGLRRAKQPLEYPSCGSVFKRPAGHFVGPMIIKAGLQGKRIGGAED 251

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFD 308
           S  H  F++N   AT  D   L   ++K +    GI L+ E++ +G   D
Sbjct: 252 SMKHAGFIVNVGGATATDYLDLIHLIQKTIKKDFGIDLQTEVRIIGKEKD 301


>gi|307243305|ref|ZP_07525472.1| UDP-N-acetylmuramate dehydrogenase [Peptostreptococcus stomatis DSM
           17678]
 gi|306493323|gb|EFM65309.1| UDP-N-acetylmuramate dehydrogenase [Peptostreptococcus stomatis DSM
           17678]
          Length = 306

 Score =  210 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 91/309 (29%), Positives = 159/309 (51%), Gaps = 10/309 (3%)

Query: 2   IYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS- 60
           IY  +S+++ E+          + P+ + T F+ GG A+++ +P+   ++     L+   
Sbjct: 6   IYNLLSQIIDEKS------IYIDEPMNRHTSFKVGGPADILVRPRTEEEISNIFKLVNKL 59

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           + P  + G GSNIL++D G RG+V+ +S+   +        E+ + +      +  + + 
Sbjct: 60  ETPFLVKGNGSNILIKDGGFRGLVIEISDNFSNF--EIRGTEVEIQSGALLSVIGRAVMN 117

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
             + GF F  GIPG++GGA  MNAGA   E    V  V  +D +G       E++ + YR
Sbjct: 118 ESLTGFEFASGIPGTLGGALAMNAGAYGGEMKNIVKTVRLMDEEGQVVEFSNEEMNFGYR 177

Query: 181 SSEITKDLIITHVVLR-GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSA 239
            S ++ +  I    +       +  I A + ++   R T QP++  + GSTFK PTG+ A
Sbjct: 178 HSRLSDERWIAISAVISLEKGDKAEIKAKMEDLALQRRTKQPLEYPSAGSTFKRPTGYFA 237

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
            +LI+ S  +G+  GGA++S  H  F+IN + A+  D+  L E V+  V+   G+ LE E
Sbjct: 238 GKLIQDSDLKGVSVGGAQVSSKHSGFVINYNKASAKDIVDLIEHVKITVYECQGVHLEEE 297

Query: 300 IKRLGDFFD 308
           +K LG+  +
Sbjct: 298 VKILGEDEE 306


>gi|322411643|gb|EFY02551.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           dysgalactiae subsp. dysgalactiae ATCC 27957]
          Length = 295

 Score =  210 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 93/287 (32%), Positives = 145/287 (50%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAG 79
            +EN PLK  T+ + GG A+ +  P++ ++L   +T    ++IP  ++G  SN++VRD G
Sbjct: 10  IRENEPLKNYTYTKVGGPADFLAFPRNHYELSRIVTYANKANIPWMVLGNASNLIVRDGG 69

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRG V+         I   N   +   A  +       A  + + GF F  GIPGSIGGA
Sbjct: 70  IRGFVIMFDKLNAVRI---NGYTLEAEAGANLIETTKIAKFYSLTGFEFACGIPGSIGGA 126

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            +MNAGA   E +   +    +   G    +   ++ + YR S I +   I+        
Sbjct: 127 VFMNAGAYGGEIAHIFLSAKVLTPSGEVKNLSAREMAFGYRHSVIQETGDIVISAKFALN 186

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P + + IS  +  + H R+  QP++  + GS FK P GH A QLI ++  +G   GG ++
Sbjct: 187 PGNYDHISQEMNRLNHLRQLKQPLEFPSCGSVFKRPPGHFAGQLIMEANLKGHRVGGVEV 246

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H  FMIN  + T  D E L   V + V + SG+ LE E++ +G+
Sbjct: 247 SEKHAGFMINVADGTAKDYEDLITHVIETVESHSGVRLEPEVRIIGE 293


>gi|313114108|ref|ZP_07799660.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Faecalibacterium cf.
           prausnitzii KLE1255]
 gi|310623517|gb|EFQ06920.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Faecalibacterium cf.
           prausnitzii KLE1255]
          Length = 298

 Score =  210 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 97/303 (32%), Positives = 144/303 (47%), Gaps = 8/303 (2%)

Query: 3   YGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSD- 61
             R  + L+      R    EN PL     F+ GG A++   P++   L   + L     
Sbjct: 1   MERFKQKLQAAAILFR----ENEPLAAHCTFKIGGPAQLFVMPENEQQLCSAVALCKEQA 56

Query: 62  IPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRH 121
           +   ++G GSNIL  D G  GVV+ +S              +  GA     +L  +AL+H
Sbjct: 57  VRYYLLGNGSNILFADEGFSGVVIDVSALDAEIAVED--TVLTAGAGVRLAALCKAALKH 114

Query: 122 GIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRS 181
           G+ G  F YGIPG++GGA YMNAGA   E    +  V  +  +G    +P  +L  +YR 
Sbjct: 115 GLSGLEFAYGIPGTVGGAVYMNAGAYGGEMKDVLTTVRYLAAEGEVREVPAAELDLRYRH 174

Query: 182 SEITKDL-IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
           S   ++   I        P +   I A +  +   R   QP+ + + GSTFK P G  A 
Sbjct: 175 SIFEENSGCILSAQFHLQPGNAADIRAKMDELMAKRVEKQPLDKPSAGSTFKRPAGAFAA 234

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
            LI++ G RG   GGA +S+ HC F++N   AT  D+  L ++VR  V  ++G  LE EI
Sbjct: 235 ALIDQCGLRGYRHGGAAVSDKHCGFVVNLGGATCADVLALCDEVRAIVKEKTGYDLEKEI 294

Query: 301 KRL 303
           + +
Sbjct: 295 RVV 297


>gi|16332095|ref|NP_442823.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Synechocystis sp.
           PCC 6803]
 gi|6225733|sp|P74529|MURB_SYNY3 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|1653724|dbj|BAA18635.1| slr1424 [Synechocystis sp. PCC 6803]
          Length = 317

 Score =  210 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 101/292 (34%), Positives = 146/292 (50%), Gaps = 6/292 (2%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAG 79
            Q    L + T +R GG AE    P+ + DL   L      D+P+T +G GSN+L+ D G
Sbjct: 26  IQPETSLAEFTTYRVGGKAEWYAAPRCLEDLVAVLDWFQGQDLPLTFLGAGSNLLISDQG 85

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           + G+VL       S         + V A      +   A + G  G  +  GIPG++GGA
Sbjct: 86  LAGLVLSTRYLRQSKF-DEEQGLITVAAGEPIAKVGWQAAKRGWQGLEWAVGIPGTVGGA 144

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFP 199
             MNAGA+N  T++ +VE   +   G   V+  EQL + YR+S + K L    VV   F 
Sbjct: 145 VVMNAGAHNQCTAETLVEATVMRPDGGLEVLTNEQLGFSYRTSNLQKHLGDRLVVDATFK 204

Query: 200 ESQNIISAAIANVC----HHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGG 255
            +       I        H R++ QP  +   GS F+NPT   + +LIE+ G +G   GG
Sbjct: 205 LTPGFTREEIMGCTTRNLHQRKSTQPYDKPNCGSVFRNPTPLYSARLIEELGLKGYRIGG 264

Query: 256 AKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFF 307
           A++S+ H NF++N DNA   D+  L   V+ +V    GILLE E+K LG+F 
Sbjct: 265 AEVSQRHANFIVNIDNAKAQDVFNLIFHVQGEVEKHYGILLEPEVKMLGEFA 316


>gi|24379414|ref|NP_721369.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus mutans
           UA159]
 gi|290580575|ref|YP_003484967.1| putative UDP-N-acetylenolpyruvoylglucosamine reductase
           [Streptococcus mutans NN2025]
 gi|30316023|sp|Q8DUF8|MURB_STRMU RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|24377346|gb|AAN58675.1|AE014937_1 putative UDP-N-acetylenolpyruvoylglucosamine reductase
           [Streptococcus mutans UA159]
 gi|254997474|dbj|BAH88075.1| putative UDP-N-acetylenolpyruvoylglucosamine reductase
           [Streptococcus mutans NN2025]
          Length = 306

 Score =  210 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 90/307 (29%), Positives = 146/307 (47%), Gaps = 11/307 (3%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP- 59
           M+   +++ L           + N PLK+ T+ + GG A+ +  P++ ++L   +     
Sbjct: 1   MMLNEMNKSLE------GVDIRINEPLKKYTYTKVGGPADFLAFPRNRYELARIVKFANQ 54

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
           +++P  ++G  SN++VRD GIRG V+         +   +   +   A  +       A 
Sbjct: 55  NNLPWMVLGNASNLIVRDGGIRGFVIMFDKLNAVTV---DGYVIEAEAGSNLIETTKVAQ 111

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            H + GF F  GIPGSIGGA +MNAGA   E S  ++    + R G    I    +++ Y
Sbjct: 112 YHSLTGFEFACGIPGSIGGAVFMNAGAYGGEISHILISAQVLTRDGEIKTIEARDMRFGY 171

Query: 180 RSSEITKDLIITHVVLR-GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R S +  +  +         P    IIS  +  + H R   QP++  + GS FK P GH 
Sbjct: 172 RHSVLQDNQEVVVSAKFSLKPGDYTIISQEMQRLNHLRALKQPLEHPSCGSVFKRPLGHF 231

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A QLI ++   G   GG ++S  H  FM+N  N +  + E L   V  +V   SG+ LE 
Sbjct: 232 AGQLIMEAQLMGHRIGGVEVSTKHAGFMVNVANGSAKNYEDLIADVIHRVKENSGVTLEP 291

Query: 299 EIKRLGD 305
           E++ +G+
Sbjct: 292 EVRIIGE 298


>gi|307709080|ref|ZP_07645539.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus mitis
           SK564]
 gi|307620026|gb|EFN99143.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus mitis
           SK564]
          Length = 295

 Score =  210 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 94/287 (32%), Positives = 144/287 (50%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAG 79
            +   PL   ++ + GG A+ +  P++  +L   +      +IP  ++G  SNI+VRD G
Sbjct: 10  IRFKEPLHSYSYTKVGGEADYLVFPRNRFELARVVKFANQENIPWMVLGNASNIIVRDGG 69

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRG V+        ++   +   +   A  +       ALRH + GF F  GIPGS+GGA
Sbjct: 70  IRGFVILCDKLNNVSV---DGYTIEAEAGANLIETTRIALRHSLTGFEFACGIPGSVGGA 126

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            +MNAGA   E +  +     + + G    +  + L + YR S I +   ++        
Sbjct: 127 VFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAKDLAFGYRHSAIQESGAVVLSAKFALA 186

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G   GG ++
Sbjct: 187 PGTHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGYRIGGVEV 246

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H  FMIN  + T  D E L E V +KV   SGI LE E++ LG+
Sbjct: 247 SEKHAGFMINVADGTAKDYEDLIESVIEKVKEHSGITLEREVRILGE 293


>gi|30263911|ref|NP_846288.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. Ames]
 gi|47529341|ref|YP_020690.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. 'Ames Ancestor']
 gi|49186759|ref|YP_030011.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. Sterne]
 gi|65321236|ref|ZP_00394195.1| COG0812: UDP-N-acetylmuramate dehydrogenase [Bacillus anthracis
           str. A2012]
 gi|165872310|ref|ZP_02216947.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. A0488]
 gi|167636586|ref|ZP_02394880.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. A0442]
 gi|167641110|ref|ZP_02399365.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. A0193]
 gi|170688831|ref|ZP_02880034.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. A0465]
 gi|170709239|ref|ZP_02899660.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. A0389]
 gi|177655550|ref|ZP_02936960.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. A0174]
 gi|190566038|ref|ZP_03018957.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           Tsiankovskii-I]
 gi|218905040|ref|YP_002452874.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           AH820]
 gi|227813181|ref|YP_002813190.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. CDC 684]
 gi|229601217|ref|YP_002868145.1| UDP-N-acetylmuramate dehydrogenase [Bacillus anthracis str. A0248]
 gi|254683380|ref|ZP_05147240.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. CNEVA-9066]
 gi|254721444|ref|ZP_05183233.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. A1055]
 gi|254735950|ref|ZP_05193656.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. Western North America USA6153]
 gi|254743845|ref|ZP_05201528.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. Kruger B]
 gi|254754380|ref|ZP_05206415.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. Vollum]
 gi|254756747|ref|ZP_05208776.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. Australia 94]
 gi|47605856|sp|Q81WD1|MURB1_BACAN RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase 1;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase 1
 gi|30258555|gb|AAP27774.1| UDP-N-acetylmuramate dehydrogenase [Bacillus anthracis str. Ames]
 gi|47504489|gb|AAT33165.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. 'Ames Ancestor']
 gi|49180686|gb|AAT56062.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. Sterne]
 gi|164711986|gb|EDR17526.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. A0488]
 gi|167510890|gb|EDR86281.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. A0193]
 gi|167528009|gb|EDR90815.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. A0442]
 gi|170125846|gb|EDS94752.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. A0389]
 gi|170667186|gb|EDT17946.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. A0465]
 gi|172080079|gb|EDT65176.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           str. A0174]
 gi|190562957|gb|EDV16923.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus anthracis
           Tsiankovskii-I]
 gi|218535796|gb|ACK88194.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           AH820]
 gi|227003873|gb|ACP13616.1| UDP-N-acetylmuramate dehydrogenase [Bacillus anthracis str. CDC
           684]
 gi|229265625|gb|ACQ47262.1| UDP-N-acetylmuramate dehydrogenase [Bacillus anthracis str. A0248]
          Length = 301

 Score =  210 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 88/302 (29%), Positives = 151/302 (50%), Gaps = 5/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           + +L+ E  +   G+   + PL + T  + GG A+++  P+ +  ++  L L+       
Sbjct: 1   MEQLVNELIQANVGRVLVDEPLARYTTMKIGGPADILIVPKRVAGIEKTLQLVKKYKTKW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T++G GSN+LV D GI GVV+RL          ++     VG       L+    R G+ 
Sbjct: 61  TVIGRGSNLLVSDLGIEGVVIRLGEGLDHLEVEKHRVR--VGGGYPLIKLSTLLSRQGLA 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA+  + S  + +   +   G    +   ++++ YR+S +
Sbjct: 119 GLEFASGIPGSVGGAVYMNAGAHKSDISNILSKALILFEDGTIDWLTHGEMEFSYRTSVL 178

Query: 185 TKDLI--ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
                  +     +     +  I + +     +R   QP      GS F+NPT + A  L
Sbjct: 179 QTKRPGIVLEAEFQLQIGERERIVSVMQKNKDYRRETQPWNHPCAGSVFRNPTPYFAGDL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IEK+G RG + GGA+ISE+H NF+IN   A+  D+  L   +++ + ++ G+ +  E++ 
Sbjct: 239 IEKAGLRGYQIGGAQISEMHGNFIINTGGASAQDVLSLIALIKQTIKDKFGVEMHTEVEI 298

Query: 303 LG 304
           +G
Sbjct: 299 IG 300


>gi|220929699|ref|YP_002506608.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           cellulolyticum H10]
 gi|220000027|gb|ACL76628.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           cellulolyticum H10]
          Length = 319

 Score =  210 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 92/303 (30%), Positives = 147/303 (48%), Gaps = 9/303 (2%)

Query: 11  RERGKQL-----RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPI 64
            E  ++L     +     N P+   T F+ GG A++M  P++   L   +     S++P 
Sbjct: 18  EEFVQKLVSVTGKDGVSVNEPMSAHTSFKIGGPADIMTYPENSTQLGNIIRECIKSNMPF 77

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
            ++G G+N+LV D GIR   + +      +     +  + + A       +  AL + + 
Sbjct: 78  MVMGNGTNLLVSDKGIR--GVVIKIYDNMSAFNVENETIELDAGILVSKASKLALEYSLT 135

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPG++GGA  MNAGA   E    V +   +DR+GN   I  ++  + YR+S I
Sbjct: 136 GLEFAEGIPGTVGGAVTMNAGAYTGEMCMVVYQTEYMDREGNIKTITGDEHCFSYRNSVI 195

Query: 185 TK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLI 243
            K   I+    L+        I   +      R   QP++  + GS FK P G+   +LI
Sbjct: 196 QKSKGIVLRTKLKLHKGDSQKIKEQMDEFNFKRRDKQPLEWPSAGSVFKRPQGYFVGKLI 255

Query: 244 EKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           + SG RG   GGAKIS+ H  F+IN+  AT  D+  L + ++K V  +  + LE E++ +
Sbjct: 256 DDSGLRGFGIGGAKISDKHSGFIINSGGATCKDVLDLIKHIQKTVDEKFRVQLEPELRII 315

Query: 304 GDF 306
           GDF
Sbjct: 316 GDF 318


>gi|166365247|ref|YP_001657520.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Microcystis
           aeruginosa NIES-843]
 gi|166087620|dbj|BAG02328.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Microcystis
           aeruginosa NIES-843]
          Length = 292

 Score =  210 bits (533), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 88/289 (30%), Positives = 145/289 (50%), Gaps = 4/289 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAG 79
            + +  L + T +R GG A+   +P ++ +L+     +    +P+T++G GSN+L+ D G
Sbjct: 2   IKSSVSLAEFTSYRVGGRAQWYAEPVNLEELRELFAWVRSQGLPLTVLGAGSNLLISDRG 61

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           + G+VL   +   S         +   A      +A  A + G  G  +  GIPG++GGA
Sbjct: 62  LPGLVLNTRHLRSSCF-DAETATITAAAGEPLPKIAWRAAKRGWRGLEWAVGIPGTVGGA 120

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRG-- 197
             MNAGA+    +  +V    ++  G    + +E L Y YRSS +  D  +         
Sbjct: 121 VVMNAGAHTSCVADRLVRALVLNPDGQLETLSKEDLNYSYRSSSLQGDQRLVVEATFQLE 180

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAK 257
             ++   I A   +   HR+  QP    + GS F+NP    A  LIE  G +G + GGA+
Sbjct: 181 ATDNHEEIMAITTHNLRHRKNTQPYDRPSCGSVFRNPKPQFAGALIEGMGLKGYQIGGAQ 240

Query: 258 ISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           +SELH NF++N  +A   D+  L   V+++VF++  + LE E+K LG+F
Sbjct: 241 VSELHANFILNIGSAKASDILRLIRHVQEQVFDRWSLWLEPEVKVLGEF 289


>gi|182418200|ref|ZP_02949500.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           butyricum 5521]
 gi|237666150|ref|ZP_04526137.1| UDP-N-acetylmuramate dehydrogenase [Clostridium butyricum E4 str.
           BoNT E BL5262]
 gi|182378018|gb|EDT75558.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Clostridium
           butyricum 5521]
 gi|237658240|gb|EEP55793.1| UDP-N-acetylmuramate dehydrogenase [Clostridium butyricum E4 str.
           BoNT E BL5262]
          Length = 304

 Score =  209 bits (532), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 95/301 (31%), Positives = 158/301 (52%), Gaps = 7/301 (2%)

Query: 9   LLRERGKQL--RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPIT 65
             ++   ++    + Q +  + +  +F+ GG  +++  P +I  LK  +T+   ++IP  
Sbjct: 6   KYKDLFSKIYNESQIQLDAKMSEHIYFKVGGPVDILLTPNNIDQLKETITVCKDNNIPFY 65

Query: 66  IVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGG 125
           ++G GSN+LV+D GIRGVV+++ +        R   ++  G     K ++  A    + G
Sbjct: 66  VIGNGSNLLVKDGGIRGVVIKVCDLNKI---ERMGNKIKAGTGALLKDVSKEATEAALAG 122

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT 185
           F F  GIPGS+GGA YMNAGA + E S  +     +D      V+ +E+L   YR S + 
Sbjct: 123 FQFACGIPGSVGGAVYMNAGAYDGEISFVIESAEVLDDNQEIRVLSKEELNLGYRQSVVM 182

Query: 186 -KDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIE 244
            K  ++        P+  + I + +  +   RE  QP++  + GSTFK P GH A +LIE
Sbjct: 183 QKGYVVLSATFELTPDDHDKIESRVNELTTRREDRQPLEYPSAGSTFKRPEGHFAGKLIE 242

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            +G +G   GGA +SE H  F+IN  N T  D+  +   V+++V  Q G+ L  E++ LG
Sbjct: 243 DAGLKGYTVGGACVSEKHAGFVINKANGTAKDVLDVIHHVQEEVKRQFGVELHPEVRILG 302

Query: 305 D 305
           +
Sbjct: 303 E 303


>gi|148989511|ref|ZP_01820870.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP6-BS73]
 gi|147925054|gb|EDK76135.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP6-BS73]
          Length = 295

 Score =  209 bits (532), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 93/287 (32%), Positives = 145/287 (50%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAG 79
            +   PL   ++ + GG A+ +  P++  +L   +      +IP  ++G  SNI+VRD G
Sbjct: 10  IRFKEPLHSYSYTKVGGEADYLVFPRNRFELARLVKFANQENIPWMVLGNASNIIVRDGG 69

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRG V+        ++   +   +   A  +       ALRH + GF F  GIPGS+GGA
Sbjct: 70  IRGFVILCDKLNNVSV---DGYTIEAEAGANLIETTRIALRHSLTGFEFACGIPGSVGGA 126

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            +MNAGA   E +  +     + + G    +  + L + YR S I +   ++  V     
Sbjct: 127 VFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAKDLAFGYRHSAIQESGAVVLSVKFALA 186

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P +  +I   +  + H RE  QP++  + GS FK P G+ A QLI ++G +G   GG ++
Sbjct: 187 PGTHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGYFAGQLISEAGLKGYRIGGVEV 246

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H  FMIN  + T  D E L + V +KV   SGI LE E++ LG+
Sbjct: 247 SEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGITLEREVRILGE 293


>gi|111658584|ref|ZP_01409241.1| hypothetical protein SpneT_02000259 [Streptococcus pneumoniae
           TIGR4]
 gi|327389576|gb|EGE87921.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae GA04375]
          Length = 310

 Score =  209 bits (532), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 94/287 (32%), Positives = 145/287 (50%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAG 79
            +   PL   ++ + GG A+ +  P++  +L   +      +IP  ++G  SNI+VRD G
Sbjct: 10  IRFKEPLHSYSYTKVGGEADYLVFPRNRFELARVVKFANQENIPWMVLGNASNIIVRDGG 69

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRG V+        ++   +   +   A  +       ALRH + GF F  GIPGS+GGA
Sbjct: 70  IRGFVILCDKLNNVSV---DGYTIEAEAGANLIETTRIALRHSLTGFEFACGIPGSVGGA 126

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            +MNAGA   E +  +     + + G    +  + L + YR S I +   ++  V     
Sbjct: 127 VFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAKDLAFGYRHSAIQESGAVVLSVKFALA 186

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G   GG ++
Sbjct: 187 PGTHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGYRIGGVEV 246

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H  FMIN  + T  D E L + V +KV   SGI LE E++ LG+
Sbjct: 247 SEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGITLEREVRILGE 293


>gi|291278890|ref|YP_003495725.1| UDP-N-acetylmuramate dehydrogenase [Deferribacter desulfuricans
           SSM1]
 gi|290753592|dbj|BAI79969.1| UDP-N-acetylmuramate dehydrogenase [Deferribacter desulfuricans
           SSM1]
          Length = 287

 Score =  209 bits (532), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 80/285 (28%), Positives = 133/285 (46%), Gaps = 4/285 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAG 79
             ++  L   T +R GG A+   +  +  D+   +       +   ++G GSN+L  D G
Sbjct: 3   ILKDEILANYTSYRVGGKAKYFIKVINNDDVGVAINFAERLSMNYVLLGAGSNVLFMDEG 62

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
                + +     +   +     ++VGA      L   ++  G+ GF    GIPGS+GGA
Sbjct: 63  FN--GVVIYTGLLNRWMIEKDDYILVGAGVKLSELVEFSVERGVSGFEELAGIPGSVGGA 120

Query: 140 AYMNAGANNCETSQYVVEVHGI-DRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGF 198
             MNAGA N E    + E       +     +     K+ YR +E  K+ I+     +  
Sbjct: 121 VNMNAGAFNTEIKDVLTECVAYDMPRKKIINLSNADCKFGYRIAEGLKNRIVLFAKFKKM 180

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
              +  + + +  +   R++ QP++  + GS FK P G  A +LIE+ G +G   GGA +
Sbjct: 181 YGDKKYLKSKVDEILKKRDSKQPLEYPSCGSVFKRPKGDYAGRLIEECGLKGYRIGGAMV 240

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           SE H NF++N  NA   D+  L E V+ +V+ +  ILLE E+K +
Sbjct: 241 SEKHANFIVNLGNAKAKDILDLIEFVQNEVYKKFNILLEPEVKII 285


>gi|254511412|ref|ZP_05123479.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodobacteraceae
           bacterium KLH11]
 gi|221535123|gb|EEE38111.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Rhodobacteraceae
           bacterium KLH11]
          Length = 308

 Score =  209 bits (532), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 109/300 (36%), Positives = 159/300 (53%), Gaps = 15/300 (5%)

Query: 18  RGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRD 77
           RG+  EN PL  +TW R GG A+ +FQP D  DL+ FL  LP+D P+  +G+GSN++VRD
Sbjct: 8   RGRLTENRPLNDLTWLRVGGPADYLFQPADTEDLQAFLRDLPADTPVFPMGVGSNLIVRD 67

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            G+R VV+RL         +      +     +  +              F   IPGS+G
Sbjct: 68  GGLRAVVIRLGRGFN---GIAIDGNTVTAGAAALDAHVARKAADAGVDLTFLRTIPGSVG 124

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRG 197
           GA  MNAG     T+  + +   + R+G    +  E L ++YR +++ +  ++      G
Sbjct: 125 GAVRMNAGCYGSYTADVLQKASIVTRQGEIKDLTPEDLNFRYRQTDLPEGAVLISATFEG 184

Query: 198 FPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGH------------SAWQLIEK 245
                  + A +A     R+  QP K+++ GSTF+NP G              AW++I+ 
Sbjct: 185 PKGDPAELHARMAAQLKKRDETQPTKDRSAGSTFRNPAGFSSTGKADDVHDLKAWKVIDD 244

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           +G RG   GGA++S  H NF+IN  +AT  DLE LGE+VRKKV+  SGI LEWEI R+GD
Sbjct: 245 AGMRGATKGGAQMSPKHSNFLINTGDATAADLEGLGEEVRKKVYETSGITLEWEIMRVGD 304


>gi|229815106|ref|ZP_04445443.1| hypothetical protein COLINT_02148 [Collinsella intestinalis DSM
           13280]
 gi|229809336|gb|EEP45101.1| hypothetical protein COLINT_02148 [Collinsella intestinalis DSM
           13280]
          Length = 303

 Score =  209 bits (532), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 92/285 (32%), Positives = 135/285 (47%), Gaps = 1/285 (0%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLT-LLPSDIPITIVGLGSNILVRDAG 79
             EN  L + T +R GG A++       H L+  +  L    +P  I+G GSN+LV DAG
Sbjct: 18  VIENEKLARHTSYRIGGKADLFVTCHSYHSLRRTIEVLARERVPWVIIGKGSNLLVADAG 77

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
            RG V+ L +     +   + C + VGA      L N AL   + G  F  GIPG++GGA
Sbjct: 78  YRGAVITLGSEFSRFVVGEDGCTITVGAGAILARLVNEALSRELTGLEFAVGIPGTVGGA 137

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFP 199
             MNAG+        V +V              EQ+ + YR   +  D I+    L    
Sbjct: 138 ISMNAGSRTEWIGSLVRDVVTYKPGEGIRHYSGEQIAWGYRLCGLPHDEIVLEATLELEQ 197

Query: 200 ESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKIS 259
            +++ I A +      R   QP+   + GS FKNP   +   +IE+ G +G   GGA++S
Sbjct: 198 ATKDDIRARMERALTRRRRTQPLGVPSCGSVFKNPPDRAVGAMIEECGLKGFCQGGAEVS 257

Query: 260 ELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            +H NF++N   AT  D+E +   V  KV    G+ L+ E+K LG
Sbjct: 258 SVHANFIVNKGAATAADVEAVIRHVHAKVRETYGVELQPEVKFLG 302


>gi|42518812|ref|NP_964742.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           johnsonii NCC 533]
 gi|81668028|sp|Q74K66|MURB_LACJO RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|41583098|gb|AAS08708.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           johnsonii NCC 533]
          Length = 301

 Score =  209 bits (532), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 88/290 (30%), Positives = 148/290 (51%), Gaps = 3/290 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAG 79
            QEN PL + T+ +TGG A+ +  P+++++L+  +  +  ++IP+T++G  SN+++RD G
Sbjct: 13  IQENIPLSRFTFTKTGGPAQYLAFPKNLNELELLVDTVKENNIPLTVIGNASNLIIRDGG 72

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           I G+VL L+      +  ++   +   A       + +A   G+ G  F  GIPGS+GGA
Sbjct: 73  ISGLVLILTKMDTI-VANKDEATVTADAGARIIDTSEAACEAGLSGLEFAAGIPGSVGGA 131

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            +MNAGA   ET   +  V  + R G       +++++ YR S + +   I+        
Sbjct: 132 VFMNAGAYGGETEFVIKSVRVLTRAGEFKTYTHDEMEFGYRHSLVQETGDIVVSATFGLE 191

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P  +  I A +      R   QP++  + GS FK P GH    +I K+G +G   GGA+ 
Sbjct: 192 PGDKWAIKAKMEYFNGLRRAKQPLEYPSCGSVFKRPAGHFVGPMIIKAGLQGKRIGGAED 251

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFD 308
           S  H  F++N   AT  D   L   ++K +    GI L+ E++ +G   D
Sbjct: 252 SMKHAGFIVNVGGATATDYLDLIHLIQKTIKKDFGIDLQTEVRIIGKEKD 301


>gi|307706854|ref|ZP_07643656.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus mitis
           SK321]
 gi|307617727|gb|EFN96892.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus mitis
           SK321]
          Length = 295

 Score =  209 bits (532), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 95/287 (33%), Positives = 145/287 (50%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAG 79
            +   PL   ++ + GG A+ +  P++  +L   +      DIP  ++G  SNI+VRD G
Sbjct: 10  IRFKEPLHSYSYTKVGGEADYLVFPRNRFELARVVKFANQADIPWMVLGNASNIIVRDGG 69

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRG V+        ++   +   +   A  +       ALRH + GF F  GIPGS+GGA
Sbjct: 70  IRGFVILCDKLNNVSV---DGYTIEAEAGANLIETTRIALRHSLTGFEFACGIPGSVGGA 126

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            +MNAGA   E +  +     + + G    +  ++L + YR S I +   ++        
Sbjct: 127 VFMNAGAYGGEIAHILQSCKVLTKDGEIETLSVKELAFGYRHSVIQESGAVVLSAKFALA 186

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P S  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G   GG ++
Sbjct: 187 PGSHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGYRIGGVEV 246

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H  FMIN  + T  D E L E V +KV   SG+ LE E++ LG+
Sbjct: 247 SEKHAGFMINVADGTAKDYEDLIESVIEKVKEHSGVTLEREVRILGE 293


>gi|83953977|ref|ZP_00962698.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sulfitobacter sp.
           NAS-14.1]
 gi|83841922|gb|EAP81091.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Sulfitobacter sp.
           NAS-14.1]
          Length = 309

 Score =  209 bits (532), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 109/303 (35%), Positives = 159/303 (52%), Gaps = 15/303 (4%)

Query: 15  KQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNIL 74
             +RGK  +N PL  +TW R GG A+  +QP D  DL  F+  LP+D+ I  +G+GSN++
Sbjct: 9   PDMRGKLTQNRPLADLTWLRVGGPADYFYQPADADDLAAFMQALPADVVIMPMGVGSNVI 68

Query: 75  VRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPG 134
           VRD G+R VV+RL     +   +     ++     +  +              F   IPG
Sbjct: 69  VRDGGLRAVVIRLGRGFNT---ISCEDGIVTAGAAALDAHVARKAADAGLDLTFLRTIPG 125

Query: 135 SIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVV 194
           SIGGA  MNAG     T+ Y +    I R G +  +  + L++ YR S +    +IT   
Sbjct: 126 SIGGAVRMNAGCYGAYTADYFISADAITRTGEKVTLGPDDLQFAYRQSALPDGYVITAAR 185

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGH------------SAWQL 242
                 +   + A + +    R+  QP K+++ GSTF+NP G              AW++
Sbjct: 186 FAPPKGAAQALHARMEDQLRKRDETQPTKDRSAGSTFRNPAGFSSTGQADDRHDLKAWKI 245

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           I+ +G RG   GGA++S  H NF+IN  +AT  DLE LGE VRKKV++ SGI LEWEI R
Sbjct: 246 IDDAGLRGATLGGAQMSPKHPNFLINTGSATAADLEALGEMVRKKVYDSSGITLEWEIMR 305

Query: 303 LGD 305
           +G+
Sbjct: 306 IGE 308


>gi|225865891|ref|YP_002751269.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           03BB102]
 gi|229186150|ref|ZP_04313319.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus BGSC
           6E1]
 gi|225788298|gb|ACO28515.1| UDP-N-acetylmuramate dehydrogenase [Bacillus cereus 03BB102]
 gi|228597326|gb|EEK54977.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus BGSC
           6E1]
          Length = 301

 Score =  209 bits (532), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 89/302 (29%), Positives = 152/302 (50%), Gaps = 5/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           + +L+ E  +   G+   + PL + T  + GG A+++  P+ +  ++  L L+       
Sbjct: 1   MEQLVNELIEANVGRVLVDEPLARYTTMKIGGPADILIVPKRVAGIEKTLQLVKKYKTKC 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T++G GSN+LV D GI GVV+RL          ++     VG   S   L+    R G+ 
Sbjct: 61  TVIGRGSNLLVSDQGIEGVVIRLGEGLDHLEVEKHRVR--VGGGYSLIKLSTLLSRQGLA 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA+  + S  + +   +   G    +   ++++ YR+S +
Sbjct: 119 GLEFASGIPGSVGGAVYMNAGAHKSDISNILSKALILFEDGTIDWLTHGEMEFSYRTSVL 178

Query: 185 TKDLI--ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
                  +     +     +  I + +     +R   QP      GS F+NPT + A  L
Sbjct: 179 QTKRPGIVLEAEFQLQIGERERIVSVMQKNKDYRRETQPWNHPCAGSVFRNPTPYFAGDL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IEK+G RG + GGA+ISE+H NF+IN   A+  D+  L   +++ + ++ G+ +  E++ 
Sbjct: 239 IEKAGLRGYQIGGAQISEMHGNFIINTGGASAQDVLSLIALIKQTIKDKFGVEMHTEVEI 298

Query: 303 LG 304
           +G
Sbjct: 299 IG 300


>gi|118479129|ref|YP_896280.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           thuringiensis str. Al Hakam]
 gi|118418354|gb|ABK86773.1| UDP-N-acetylmuramate dehydrogenase [Bacillus thuringiensis str. Al
           Hakam]
          Length = 303

 Score =  209 bits (532), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 89/302 (29%), Positives = 152/302 (50%), Gaps = 5/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           + +L+ E  +   G+   + PL + T  + GG A+++  P+ +  ++  L L+       
Sbjct: 3   MEQLVNELIEANVGRVLVDEPLARYTTMKIGGPADILIVPKRVAGIEKTLQLVKKYKTKC 62

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T++G GSN+LV D GI GVV+RL          ++     VG   S   L+    R G+ 
Sbjct: 63  TVIGRGSNLLVSDQGIEGVVIRLGEGLDHLEVEKHRVR--VGGGYSLIKLSTLLSRQGLA 120

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA+  + S  + +   +   G    +   ++++ YR+S +
Sbjct: 121 GLEFASGIPGSVGGAVYMNAGAHKSDISNILSKALILFEDGTIDWLTHGEMEFSYRTSVL 180

Query: 185 TKDLI--ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
                  +     +     +  I + +     +R   QP      GS F+NPT + A  L
Sbjct: 181 QTKRPGIVLEAEFQLQIGERERIVSVMQKNKDYRRETQPWNHPCAGSVFRNPTPYFAGDL 240

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IEK+G RG + GGA+ISE+H NF+IN   A+  D+  L   +++ + ++ G+ +  E++ 
Sbjct: 241 IEKAGLRGYQIGGAQISEMHGNFIINTGGASAQDVLSLIALIKQTIKDKFGVEMHTEVEI 300

Query: 303 LG 304
           +G
Sbjct: 301 IG 302


>gi|78221635|ref|YP_383382.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacter
           metallireducens GS-15]
 gi|123572779|sp|Q39YL7|MURB_GEOMG RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|78192890|gb|ABB30657.1| UDP-N-acetylmuramate dehydrogenase [Geobacter metallireducens
           GS-15]
          Length = 300

 Score =  209 bits (532), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 106/299 (35%), Positives = 149/299 (49%), Gaps = 4/299 (1%)

Query: 8   RLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITI 66
            L      +LRG+   + P+ + T  + GG A+    P D  DL   L LL     P  +
Sbjct: 4   ELYARLRAELRGEILRDEPMARHTSLKVGGAADFFVTPADRDDLTALLALLAETGTPYLV 63

Query: 67  VGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGF 126
           VG G N+LVRD GIRGVV+ L+      + +     ++ GA  + +         G+GG 
Sbjct: 64  VGGGYNLLVRDGGIRGVVISLARL--DEMTLLAGERVMAGAGVTNRQFVQLLRDRGLGGL 121

Query: 127 HFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK 186
            F  GIPG++GGA  MNAGA+       V E+  I R G      R+ L Y YR   +  
Sbjct: 122 EFLCGIPGTVGGALAMNAGAHGGAVVDRVEELLTI-RDGEMLQTGRDGLDYGYRFLRLAP 180

Query: 187 DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKS 246
             II     R  P   + I A IA    HR   Q +     GS FKNP G +AW+LI+++
Sbjct: 181 GEIIVGATFRLDPADPDQIGARIAGYLEHRAASQKVGFPNAGSFFKNPEGTAAWRLIDET 240

Query: 247 GCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           G RG   GGA++SE H NF+IN   AT  D   L  ++ + V  ++GI LE E++ +G+
Sbjct: 241 GLRGERVGGAQVSEAHANFLINRGGATAADFLALATRINEAVKQRTGITLEEEVRIVGE 299


>gi|148259086|ref|YP_001233213.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acidiphilium cryptum
           JF-5]
 gi|326402237|ref|YP_004282318.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acidiphilium
           multivorum AIU301]
 gi|166222821|sp|A5FUL2|MURB_ACICJ RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|146400767|gb|ABQ29294.1| UDP-N-acetylmuramate dehydrogenase [Acidiphilium cryptum JF-5]
 gi|325049098|dbj|BAJ79436.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Acidiphilium
           multivorum AIU301]
          Length = 309

 Score =  209 bits (532), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 121/304 (39%), Positives = 171/304 (56%), Gaps = 2/304 (0%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M+   +    R    ++RG+   + PL  +TWFR GG AEVMF+P DI DL  FL  L  
Sbjct: 1   MMAAPVMADWRAALPEVRGRIGFDVPLGPVTWFRVGGPAEVMFRPADIEDLSRFLAALAP 60

Query: 61  DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALR 120
           ++P+  +G  SN++VRD GI GVV+RL               ++ GA     ++A  A  
Sbjct: 61  EVPVLPIGAASNLIVRDGGIAGVVVRLVRGFADIEV--QPDGIVAGAAALDATIAEHAAA 118

Query: 121 HGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYR 180
            G+ G  F  GIPGS+GGA  MNAGA   E    +     + R G         L   YR
Sbjct: 119 AGLTGLEFLSGIPGSLGGAVAMNAGAYGAEIRDVLDWAEIVGRDGTVARYAAGDLALTYR 178

Query: 181 SSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAW 240
            + + +  I+    L   P     I+A +A++   RE  QP++ +TGGSTF+NP G  AW
Sbjct: 179 HARLPEGGIVVRARLHARPGEAAAIAARMADIRASREATQPVRARTGGSTFRNPEGDKAW 238

Query: 241 QLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
           +LI+++GCRGL  GGA++SE HCNF+IN   AT  D+E LGE VR++V  ++G+ L WEI
Sbjct: 239 RLIDEAGCRGLIHGGAQVSEKHCNFLINLGEATAADIEGLGETVRRRVRERTGVELIWEI 298

Query: 301 KRLG 304
           +R+G
Sbjct: 299 RRVG 302


>gi|116492276|ref|YP_804011.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Pediococcus
           pentosaceus ATCC 25745]
 gi|122266260|sp|Q03GV3|MURB_PEDPA RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|116102426|gb|ABJ67569.1| UDP-N-acetylmuramate dehydrogenase [Pediococcus pentosaceus ATCC
           25745]
          Length = 300

 Score =  209 bits (532), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 92/303 (30%), Positives = 153/303 (50%), Gaps = 7/303 (2%)

Query: 5   RISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIP 63
            + + + +   ++  +  E+ PL + T  +TGG A+++  P+ + + K  +      D P
Sbjct: 1   MMDQSIADAFPEV--QVLEHEPLSKYTNTQTGGPADLLVFPESVTETKRLVLWAKETDTP 58

Query: 64  ITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGI 123
           +TI+G  SN++VRD GIRG+ L L+      +   N  E++  A  +       A + G+
Sbjct: 59  LTIIGNASNLIVRDGGIRGLTLILTKMDDIQV---NGNEVVAEAGAALIQTTEVAYQAGL 115

Query: 124 GGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSE 183
            G  F  GIPGSIGGA +MNAGA + E S+ V     + R G    +   +L + YR S 
Sbjct: 116 TGLEFAAGIPGSIGGAVFMNAGAYDGEISEVVTSAEILTRDGEIKNLNNHELDFGYRHSS 175

Query: 184 ITK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
           +     ++     +      N I A +  +   R + QP++  + GS FK PTG+   +L
Sbjct: 176 VQDYQDVVLSATFKLRSGDANKIRARMDELNRLRASKQPLEYPSCGSVFKRPTGYFTGKL 235

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           I ++G +G   GGA++S  H  F+IN   AT  D   +   V+  V  Q G+ LE E++ 
Sbjct: 236 IHEAGLQGFTVGGAQVSMKHAGFIINVGGATATDYMDVIHHVQATVLKQFGVTLETEVRI 295

Query: 303 LGD 305
           +G+
Sbjct: 296 IGE 298


>gi|150391784|ref|YP_001321833.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Alkaliphilus
           metalliredigens QYMF]
 gi|167017277|sp|A6TVF6|MURB_ALKMQ RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|149951646|gb|ABR50174.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Alkaliphilus
           metalliredigens QYMF]
          Length = 304

 Score =  209 bits (532), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 90/283 (31%), Positives = 148/283 (52%), Gaps = 4/283 (1%)

Query: 25  FPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIRGV 83
            P+K+ T F+ GG A+++  P+ + +++  + +      P  ++G GSN+LVRD G+R V
Sbjct: 23  EPMKKHTSFKIGGPADLLVMPRTVEEIRQSVEICKKSKTPYFVMGNGSNLLVRDKGMRCV 82

Query: 84  VLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMN 143
           V++++              +IV       +L+N   R  + GF F  GIPG++GGA  MN
Sbjct: 83  VIKIAENFNEV--RFEGNHVIVQTGILLSTLSNQIARACLKGFEFANGIPGTVGGAITMN 140

Query: 144 AGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT-KDLIITHVVLRGFPESQ 202
           AGA   E    V     ++ +G    +  E+L+  YR+S I  K  I   VVL       
Sbjct: 141 AGAYGGEMKDVVKSCKVLNHQGEIIDLSLEELELDYRTSIIQEKGYIALEVVLALQEGKY 200

Query: 203 NIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELH 262
             I + I ++   R T QP+     GS FK P G+ A +LI+    +G + GGA++SELH
Sbjct: 201 EEIRSIIDDLTVKRTTKQPLHLPCAGSVFKRPPGYFAGKLIQDCNLKGFKIGGAQVSELH 260

Query: 263 CNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
             F++N DNA+  D+  L   ++K+V  +  + L  E++ +G+
Sbjct: 261 SGFIVNIDNASAADVLNLIAHIQKQVKEKFDVGLHNEVRVVGE 303


>gi|229551813|ref|ZP_04440538.1| UDP-N-acetylmuramate dehydrogenase [Lactobacillus rhamnosus LMS2-1]
 gi|229314757|gb|EEN80730.1| UDP-N-acetylmuramate dehydrogenase [Lactobacillus rhamnosus LMS2-1]
          Length = 305

 Score =  209 bits (532), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 89/287 (31%), Positives = 148/287 (51%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAG 79
              + PL   T+ +TGG A+++  P+D+ +++  + +    D+P+T++G  SN++VRD G
Sbjct: 19  MLHDEPLSHYTFTKTGGPADLLAFPKDVAEVQALVEMARERDMPLTVIGNASNLIVRDGG 78

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRG+VL L+      +   N  ++   A         +A R G+ G  F  GIPGS+GGA
Sbjct: 79  IRGLVLILTAMKKITV---NGNDVTAQAGAQLIDTTEAAYRAGLTGLEFAAGIPGSVGGA 135

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            +MNAGA N E    + + H + R G        +L ++YR S +     I+  V     
Sbjct: 136 LFMNAGAYNGEVCSVISQAHVLTRAGELKTYNHRELNFRYRHSVVQDTGDIVLSVTFSMK 195

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
              +  I A +  +   R   QP++  + GS FK P  H    +I+K+G +G   GGA++
Sbjct: 196 FGDKPTIRAKMDELNARRAAKQPLEYPSCGSVFKRPPDHFVGPMIQKAGLQGHIIGGAQV 255

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           S+ H  F+IN  NAT  D   +   ++K V  +  + LE E++ +G+
Sbjct: 256 SKKHAGFIINLGNATATDYLDMIHLIQKTVKAKFDVDLEPEVRIIGE 302


>gi|257066175|ref|YP_003152431.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Anaerococcus
           prevotii DSM 20548]
 gi|256798055|gb|ACV28710.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Anaerococcus
           prevotii DSM 20548]
          Length = 300

 Score =  209 bits (532), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 102/290 (35%), Positives = 150/290 (51%), Gaps = 4/290 (1%)

Query: 19  GKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTL-LPSDIPITIVGLGSNILVRD 77
           G+   +  L+  T F  GG A+VM +P     L+  L +    +I  T++G GSN+L+ D
Sbjct: 13  GEVLLDQSLRDYTTFGIGGKADVMIKPNTEEQLQNILKINHRENIKTTVIGRGSNLLISD 72

Query: 78  AGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIG 137
            GIRG ++ L++        R+   +   A  S   LA  A+  G+ G     GIPGS+G
Sbjct: 73  KGIRGCIIVLADNFDKI--ERDGDILTALAGTSLNELALFAIERGLAGMEEISGIPGSVG 130

Query: 138 GAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHV-VLR 196
           GA  MNAGA   E     V V   D  G ++     Q+ + YR S+I +D +I      +
Sbjct: 131 GAVAMNAGAYGGEIKDICVNVKAFDFAGKEYNFTNSQMNFSYRHSKIFEDELIVSSASFK 190

Query: 197 GFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
               ++  I     +    R T QP+  K+ GSTFK PTG  A +LI++ G RG   G  
Sbjct: 191 LEAGNKEEIEERYQDFTDRRTTKQPLDRKSAGSTFKRPTGSYASKLIDECGLRGYRKGEC 250

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDF 306
           ++SE HC F+IN D+AT  D+    E+V K V  ++G +LE E+K +GDF
Sbjct: 251 QVSEKHCGFIINIDHATCEDMLSFIEEVSKIVNEKTGFVLEREVKLIGDF 300


>gi|300361319|ref|ZP_07057496.1| UDP-N-acetylmuramate dehydrogenase [Lactobacillus gasseri JV-V03]
 gi|300353938|gb|EFJ69809.1| UDP-N-acetylmuramate dehydrogenase [Lactobacillus gasseri JV-V03]
          Length = 301

 Score =  209 bits (532), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 89/290 (30%), Positives = 144/290 (49%), Gaps = 3/290 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAG 79
            QEN PL + T+ +TGG A+ +  P+++ +LK  +  +  +++P+T++G  SN+++RD G
Sbjct: 13  IQENIPLSRFTFTKTGGPAQYLAFPKNLDELKILVETVKTNNLPLTVIGNASNLIIRDGG 72

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           I G+VL L+                  A       + +A   G+ G  F  GIPGS+GGA
Sbjct: 73  ISGLVLILTKMDEIVANQEEATVT-ADAGARIIDTSEAACEAGLSGLEFAAGIPGSVGGA 131

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            +MNAGA   ET   +  V  + RKG       +++++ YR S + +   I+        
Sbjct: 132 VFMNAGAYGGETEFVIKSVRVLTRKGEFKTYTHDEMEFGYRHSLVQETGDIVISATFGLE 191

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P  +  I A +      R   QP++  + GS FK PTGH    +I K+G +G   GGA+ 
Sbjct: 192 PGDKWAIKAKMEYFNGLRRAKQPLEYPSCGSVFKRPTGHFVGPMIIKAGLQGKRIGGAED 251

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFD 308
           S  H  F+IN   AT  D   L   ++K +     + L+ E++ +G   D
Sbjct: 252 SMKHAGFIINVGGATATDYLDLIHLIQKTIKKDFDVDLQTEVRIIGKEKD 301


>gi|239826337|ref|YP_002948961.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus sp.
           WCH70]
 gi|239806630|gb|ACS23695.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Geobacillus sp.
           WCH70]
          Length = 310

 Score =  209 bits (531), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 101/307 (32%), Positives = 158/307 (51%), Gaps = 11/307 (3%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           MIY  + ++        +     + PLK  T  + GG A+ +  P     +   + L   
Sbjct: 6   MIYQELVQICG------KENVLRDEPLKYHTLVKIGGKADFLVWPTTYEQVMEVVRLKEK 59

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
             +P T++G GSN++VRD GIRG+V++L +     +E      +I  +    K+++  AL
Sbjct: 60  YQLPFTLLGNGSNVIVRDGGIRGIVMQLKHLTEIKVEGEK---IIAQSGADIKAVSRFAL 116

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            H + G  F  GIPGSIGGA  MNAGA   E    +  V  I + G   ++ ++ L+  Y
Sbjct: 117 EHSLTGLEFACGIPGSIGGAIMMNAGAYGGEVKDVIDHVKVITQTGECKILKKDDLQLGY 176

Query: 180 RSSEITK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R+S I+K   I+   V +        I   + ++   RE+ QP++  + GS FK P G+ 
Sbjct: 177 RTSIISKTHDIVLEAVFQLKKGDPQKIKEKMDDLTFQRESKQPLEYPSVGSVFKRPPGYF 236

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI+ SG +G   GGA++S  H  F+IN +NAT  D     E VRK V  + G+ LE 
Sbjct: 237 AGKLIQDSGLQGKGVGGAEVSTKHAGFIINKNNATASDYIATIEMVRKTVKEKFGVDLEL 296

Query: 299 EIKRLGD 305
           E+K +G+
Sbjct: 297 EVKIIGE 303


>gi|227529585|ref|ZP_03959634.1| UDP-N-acetylmuramate dehydrogenase [Lactobacillus vaginalis ATCC
           49540]
 gi|227350484|gb|EEJ40775.1| UDP-N-acetylmuramate dehydrogenase [Lactobacillus vaginalis ATCC
           49540]
          Length = 298

 Score =  209 bits (531), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 91/299 (30%), Positives = 153/299 (51%), Gaps = 8/299 (2%)

Query: 8   RLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITI 66
            L++E   ++    ++  PL + T+  TGG A+ +  P+++  ++  +  +  +DIP+T+
Sbjct: 4   NLIKEF-PEI--NIKKQEPLSKYTFTHTGGEADWLAFPENVEQVQQLVKFVKKNDIPLTV 60

Query: 67  VGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGF 126
           +G  SN++VRD GI G+VL ++      +       +I  A  +       A  H + G 
Sbjct: 61  IGNASNLIVRDGGIAGLVLIVTGMNQIKV---EGNNVIAQAGATYIKTTQVARDHSLTGL 117

Query: 127 HFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK 186
            F  GIPGSIGGA +MNAGA   ET   V     +   G    +  E+L + YR S +  
Sbjct: 118 EFAAGIPGSIGGAVFMNAGAYGGETKFAVKSATIMLPTGEIKELSNEELDFGYRHSSVQD 177

Query: 187 DL-IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEK 245
           +  I+        P  +  I+A +  +   R   QP++  + GS FK PTG+ A +LI  
Sbjct: 178 NHGIVLEATFELKPGDKEKITAQMDELNARRAAKQPLELPSCGSVFKRPTGYFAGKLIHD 237

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
           +G +G   GGA++S+ H  F++N DN T  D   +   V+  V ++ G+ LE E++ +G
Sbjct: 238 AGLQGYTSGGAQVSKKHAGFIVNIDNGTATDYLNVIHHVQAVVKDKFGVSLETEVRIIG 296


>gi|258539214|ref|YP_003173713.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           rhamnosus Lc 705]
 gi|257150890|emb|CAR89862.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           rhamnosus Lc 705]
          Length = 299

 Score =  209 bits (531), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 89/287 (31%), Positives = 148/287 (51%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAG 79
              + PL   T+ +TGG A+++  P+D+ +++  + +    D+P+T++G  SN++VRD G
Sbjct: 13  MLHDEPLSHYTFTKTGGPADLLAFPKDVAEVQALVEMARERDMPLTVIGNASNLIVRDGG 72

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRG+VL L+      +   N  ++   A         +A R G+ G  F  GIPGS+GGA
Sbjct: 73  IRGLVLILTAMKKITV---NGNDVTAQAGARLIDTTEAAYRAGLTGLEFAAGIPGSVGGA 129

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            +MNAGA N E    + + H + R G        +L ++YR S +     I+  V     
Sbjct: 130 LFMNAGAYNGEVCSVISQAHVLTRAGELKTYNHRELNFRYRHSVVQDTGDIVLSVTFSMK 189

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
              +  I A +  +   R   QP++  + GS FK P  H    +I+K+G +G   GGA++
Sbjct: 190 FGDKPTIRAKMDELNARRAAKQPLEYPSCGSVFKRPPDHFVGPMIQKAGLQGHIIGGAQV 249

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           S+ H  F+IN  NAT  D   +   ++K V  +  + LE E++ +G+
Sbjct: 250 SKKHAGFIINLGNATATDYLDMIHLIQKTVKAKFDVDLEPEVRIIGE 296


>gi|149007340|ref|ZP_01830998.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP18-BS74]
 gi|149019344|ref|ZP_01834706.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP23-BS72]
 gi|147761144|gb|EDK68112.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP18-BS74]
 gi|147931214|gb|EDK82193.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP23-BS72]
 gi|332074712|gb|EGI85186.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae GA17545]
 gi|332201841|gb|EGJ15911.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae GA47368]
          Length = 295

 Score =  209 bits (531), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 94/287 (32%), Positives = 145/287 (50%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAG 79
            +   PL   ++ + GG A+ +  P++  +L   +      +IP  ++G  SNI+VRD G
Sbjct: 10  IRFKEPLHSYSYTKVGGEADYLVFPRNRFELARLVKFANQENIPWMVLGNASNIIVRDGG 69

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRG V+        ++   +   +   A  +       ALRH + GF F  GIPGS+GGA
Sbjct: 70  IRGFVILCDKLNNVSV---DGYTIEAEAGANLIETTRIALRHSLTGFEFACGIPGSVGGA 126

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            +MNAGA   E +  +     + + G    +  + L + YR S I +   ++  V     
Sbjct: 127 VFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAKDLAFGYRHSAIQESGAVVLSVKFALA 186

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G   GG ++
Sbjct: 187 PGTHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGYRIGGVEV 246

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H  FMIN  + T  D E L + V +KV   SGI LE E++ LG+
Sbjct: 247 SEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGITLEREVRILGE 293


>gi|297583950|ref|YP_003699730.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           selenitireducens MLS10]
 gi|297142407|gb|ADH99164.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus
           selenitireducens MLS10]
          Length = 315

 Score =  209 bits (531), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 97/289 (33%), Positives = 150/289 (51%), Gaps = 4/289 (1%)

Query: 17  LRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILV 75
           LRGK   +    + + +R GG A+VM++P D+ D+   L  L    IP  I+G GSN++ 
Sbjct: 10  LRGKITYDEMTGKYSTWRIGGKADVMYEPSDVEDVTNLLAYLRAEKIPYFILGKGSNLMF 69

Query: 76  RDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGS 135
            D GIRGVV+++++A  +         + VGA  S   LA    R+G+ G  F  GIP +
Sbjct: 70  PDEGIRGVVIKMADALTNL--TEEGNTVTVGAGYSLVKLAAKMSRNGLSGLEFAAGIPAT 127

Query: 136 IGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDL-IITHVV 194
           +GGA +MNAGA+  E +  +  +H +   G       E L++ YR S +  +  I     
Sbjct: 128 VGGAVFMNAGAHGGEMADVISRIHVLRPDGTDAWFEGESLQFSYRHSFLQDEELICLEAE 187

Query: 195 LRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFG 254
           L         IS+ +     +R+  QP  E + GS FKNP    A +LIE +G +G  FG
Sbjct: 188 LTLQSGDSEDISSVLEKNKQYRKDTQPYGEPSCGSVFKNPRPLFAAKLIEDAGLKGKRFG 247

Query: 255 GAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRL 303
           G K+SE H NF++N    T  D+  L   ++KK+   + + LE E++ +
Sbjct: 248 GVKVSEKHANFIVNDQQGTAEDVLNLMVYIQKKIEQTAMVTLEPEVQVV 296


>gi|148993051|ref|ZP_01822645.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP9-BS68]
 gi|149002775|ref|ZP_01827701.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP14-BS69]
 gi|147759069|gb|EDK66063.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP14-BS69]
 gi|147928252|gb|EDK79269.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae SP9-BS68]
 gi|332073697|gb|EGI84176.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pneumoniae GA17570]
          Length = 295

 Score =  209 bits (531), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 94/287 (32%), Positives = 145/287 (50%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAG 79
            +   PL   ++ + GG A+ +  P++  +L   +      +IP  ++G  SNI+VRD G
Sbjct: 10  IRFKEPLHSYSYTKVGGEADYLVFPRNRFELARVVKFANQENIPWMVLGNASNIIVRDGG 69

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRG V+        ++   +   +   A  +       ALRH + GF F  GIPGS+GGA
Sbjct: 70  IRGFVILCDKLNNVSV---DGYTIEAEAGANLIETTRIALRHSLTGFEFACGIPGSVGGA 126

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            +MNAGA   E +  +     + + G    +  + L + YR S I +   ++  V     
Sbjct: 127 VFMNAGAYGGEIAHILQSCKVLTKDGEIETLSAKDLAFGYRHSAIQESGAVVLSVKFALA 186

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G   GG ++
Sbjct: 187 PGTHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGYRIGGVEV 246

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H  FMIN  + T  D E L + V +KV   SGI LE E++ LG+
Sbjct: 247 SEKHAGFMINVADGTAKDYEDLIQSVIEKVKEHSGITLEREVRILGE 293


>gi|239636649|ref|ZP_04677651.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           warneri L37603]
 gi|239598004|gb|EEQ80499.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Staphylococcus
           warneri L37603]
          Length = 307

 Score =  209 bits (531), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 92/312 (29%), Positives = 157/312 (50%), Gaps = 7/312 (2%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP- 59
           M    I + L+E         + + PLK+ T+  TGG A+    P    +++  +     
Sbjct: 1   MNKNDILKGLQEIIPN--DIIEVDEPLKKYTYTETGGKADFYLSPTKNEEVQAIVKYANQ 58

Query: 60  SDIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
            +IP+T +G GSNI++R+ GIRG+VL L +     +       +I G+  +   ++  A 
Sbjct: 59  HNIPVTYLGNGSNIIIREGGIRGIVLSLLSLKHIEVSDDA---IIAGSGAAIIDVSRVAR 115

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
            + + G  F  GIPGSIGGA +MNAGA   E    +     ++  G+   +  ++L+  Y
Sbjct: 116 DYALTGLEFACGIPGSIGGAVFMNAGAYGGEVKDCIDYALCVNEDGDLIKLTTQELELDY 175

Query: 180 RSSEITKDL-IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R+S + K   ++        P +   I A + ++   RE+ QP++  + GS F+ P GH 
Sbjct: 176 RNSIVQKKHLVVLEAAFTLEPGNLKEIQAKMDDLTERRESKQPLEYPSCGSVFQRPPGHF 235

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
           A +LI+ S  +G   GG ++S  H  FM+N DN T  D E L   V++ V ++  + L  
Sbjct: 236 AGKLIQDSDLQGHRIGGVEVSTKHAGFMVNVDNGTATDYEDLIHYVQQTVKDKFDVELNT 295

Query: 299 EIKRLGDFFDHQ 310
           E++ +G+  D +
Sbjct: 296 EVRIIGEHPDTE 307


>gi|257870109|ref|ZP_05649762.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Enterococcus
           gallinarum EG2]
 gi|257804273|gb|EEV33095.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Enterococcus
           gallinarum EG2]
          Length = 301

 Score =  209 bits (531), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 89/301 (29%), Positives = 151/301 (50%), Gaps = 7/301 (2%)

Query: 7   SRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPIT 65
             L+ ++  ++     ++  L   T+ +TGG A+++  P+   +++  +      D P  
Sbjct: 3   KELMIKQFPEIA--LLKDEALLNYTYTKTGGPADILAFPKSAKEVEQIVAYCRETDTPWL 60

Query: 66  IVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGG 125
           ++G  SN++VRD GIRGVV+ LS      +E      +IV A          AL   + G
Sbjct: 61  VLGNASNLIVRDGGIRGVVIMLSEMNQITVED---TTLIVEAGAKLIDTTYVALHESLTG 117

Query: 126 FHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEIT 185
           F F  GIPGS+GGA +MNAGA + E          +   G    + +E++ + YR S + 
Sbjct: 118 FEFACGIPGSVGGAVFMNAGAYDGEIQDIFASCDVLLADGRVVTMMKEEMAFSYRHSTLQ 177

Query: 186 KDL-IITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIE 244
               II           Q+ I   +  +   R+  QP++  + GS FK P GH   +LI+
Sbjct: 178 DQHAIILSARFDLAQGDQDQIKKRMDELTELRQLKQPLEYPSCGSVFKRPVGHFTGKLIQ 237

Query: 245 KSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            +G +GL++GGA+ISE H  F++N D+AT  D   L   +++ +  +  + LE E++ +G
Sbjct: 238 DAGLQGLKWGGAQISEKHAGFIVNVDHATATDYVELIAHIQQVIKERFDVQLETEVRIIG 297

Query: 305 D 305
           +
Sbjct: 298 E 298


>gi|259649288|dbj|BAI41450.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           rhamnosus GG]
          Length = 287

 Score =  209 bits (531), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 88/287 (30%), Positives = 148/287 (51%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAG 79
              + PL   T+ +TGG A+++  P+D+ +++  + +    D+P+T++G  SN++VRD G
Sbjct: 1   MLHDEPLSHYTFTKTGGPADLLAFPKDVAEVQALVEMARERDMPLTVIGNASNLIVRDGG 60

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRG+VL L+      +   N  ++   A         +A R G+ G  F  GIPGS+GGA
Sbjct: 61  IRGLVLILTAMKKITV---NGNDVTAQAGARLIDTTEAAYRAGLTGLEFAAGIPGSVGGA 117

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            +MNAGA N E    + + + + R G        +L ++YR S +     I+  V     
Sbjct: 118 LFMNAGAYNGEVCSVISQAYVLTRAGELKTYNHRELNFRYRHSVVQDTGDIVLSVTFSMK 177

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
              +  I A +  +   R   QP++  + GS FK P  H    +I+K+G +G   GGA++
Sbjct: 178 FGDKPTIRAKMDELNARRAAKQPLEYPSCGSVFKRPPDHFVGPMIQKAGLQGHIIGGAQV 237

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           S+ H  F+IN  NAT  D   +   ++K V  +  + LE E++ +G+
Sbjct: 238 SKKHAGFIINLGNATATDYLDMIHLIQKTVKAKFDVDLEPEVRIIGE 284


>gi|258507961|ref|YP_003170712.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           rhamnosus GG]
 gi|257147888|emb|CAR86861.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           rhamnosus GG]
          Length = 299

 Score =  209 bits (531), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 88/287 (30%), Positives = 148/287 (51%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAG 79
              + PL   T+ +TGG A+++  P+D+ +++  + +    D+P+T++G  SN++VRD G
Sbjct: 13  MLHDEPLSHYTFTKTGGPADLLAFPKDVAEVQALVEMARERDMPLTVIGNASNLIVRDGG 72

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRG+VL L+      +   N  ++   A         +A R G+ G  F  GIPGS+GGA
Sbjct: 73  IRGLVLILTAMKKITV---NGNDVTAQAGARLIDTTEAAYRAGLTGLEFAAGIPGSVGGA 129

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            +MNAGA N E    + + + + R G        +L ++YR S +     I+  V     
Sbjct: 130 LFMNAGAYNGEVCSVISQAYVLTRAGELKTYNHRELNFRYRHSVVQDTGDIVLSVTFSMK 189

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
              +  I A +  +   R   QP++  + GS FK P  H    +I+K+G +G   GGA++
Sbjct: 190 FGDKPTIRAKMDELNARRAAKQPLEYPSCGSVFKRPPDHFVGPMIQKAGLQGHIIGGAQV 249

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           S+ H  F+IN  NAT  D   +   ++K V  +  + LE E++ +G+
Sbjct: 250 SKKHAGFIINLGNATATDYLDMIHLIQKTVKAKFDVDLEPEVRIIGE 296


>gi|229544883|ref|ZP_04433608.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Enterococcus
           faecalis TX1322]
 gi|229309984|gb|EEN75971.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Enterococcus
           faecalis TX1322]
          Length = 300

 Score =  209 bits (531), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 94/307 (30%), Positives = 149/307 (48%), Gaps = 11/307 (3%)

Query: 1   MIYGRISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS 60
           M    +   L E           N PLK +T+ +TGG A+V+  P+   +++  +     
Sbjct: 1   MNTKAMLETLNEIT------LLVNEPLKNVTFTKTGGPADVLALPKTKKEVEEIVAYCRE 54

Query: 61  -DIPITIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSAL 119
             +   ++G  SN++VRD GIR VV+ L+      +       MIV A          AL
Sbjct: 55  QGLSWLVLGNASNLIVRDGGIRDVVIMLTEMKEIKV---AGTTMIVDAGAKLIDTTYEAL 111

Query: 120 RHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQY 179
              + GF F  GIPGS+GGA YMNAGA   E          +   G    + +E L ++Y
Sbjct: 112 AADLTGFEFACGIPGSVGGAVYMNAGAYGGEIKDVFQSAEVLLADGTIQTMTKEDLNFRY 171

Query: 180 RSSEITK-DLIITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHS 238
           R SEI +   I+          +   I A +  +   RE  QP++  + GS FK P GH 
Sbjct: 172 RHSEIQELHCIVLQATFALEKGNHAEIKAQMDELTELRELKQPLEYPSCGSVFKRPVGHF 231

Query: 239 AWQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEW 298
             +LI+ +G +GL++GGA+ISE H  F++N D+AT  D   L   +++ +  +  + L+ 
Sbjct: 232 TGKLIQDAGLQGLKWGGAQISEKHAGFIVNIDHATATDYVELIAHIQEVIKEKFDVELQT 291

Query: 299 EIKRLGD 305
           E++ +G+
Sbjct: 292 EVRIIGE 298


>gi|206971000|ref|ZP_03231951.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           AH1134]
 gi|206733772|gb|EDZ50943.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           AH1134]
          Length = 301

 Score =  209 bits (531), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 90/302 (29%), Positives = 151/302 (50%), Gaps = 5/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           + +L+ E  +   G+   N PL + T  + GG A+++  P+ +  ++  L L+       
Sbjct: 1   MEQLVNELIEADVGRVLVNEPLARYTTMKIGGPADILIVPKHVAGIEKTLQLVKQYKTKW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T++G GSN+LV D GI GVV+RL          ++     VG+      L+    R G+ 
Sbjct: 61  TVIGRGSNLLVSDQGIEGVVIRLGEGLDHLEVEKHKVR--VGSGYPLIKLSTLLSRQGLA 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA+  + S  + +   +   G    +  ++L++ YRSS +
Sbjct: 119 GLEFASGIPGSVGGAVYMNAGAHKSDISSVLSKALILFEDGTIDWLTNKELEFSYRSSVL 178

Query: 185 TKDLI--ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
                  +     +     +  I  ++ N   +R   QP      GS F+NP  H A  L
Sbjct: 179 QTKRPGIVLEAEFQLQAGKREEIVRSMQNNKDYRRETQPWNHPCAGSIFRNPIPHFAGDL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           +EK+G RG   GGA+ISE+H NF++N   A+  D+  L E ++  + ++  + +  E++ 
Sbjct: 239 VEKAGLRGYRIGGAQISEMHGNFIVNTGGASAQDVLSLIELIKHTIKDKFDVDMHTEVEI 298

Query: 303 LG 304
           +G
Sbjct: 299 IG 300


>gi|307704558|ref|ZP_07641463.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus mitis
           SK597]
 gi|307621855|gb|EFO00887.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus mitis
           SK597]
          Length = 295

 Score =  208 bits (530), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 92/287 (32%), Positives = 143/287 (49%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAG 79
            +   PL   ++ + GG A+ +  P++  +L   +      +IP  ++G  SNI+V D G
Sbjct: 10  IRFKEPLHSYSYTKVGGEADYLVFPRNRFELARVVKFANQENIPWMVLGNASNIIVCDGG 69

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRG V+        ++   +   +   A  +       ALRH + GF F  GIPGS+GGA
Sbjct: 70  IRGFVILCDKLNNVSV---DGYTIEAEAGANLIETTRIALRHSLTGFEFACGIPGSVGGA 126

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            +MNAGA   E +  +     + + G    +  + L + YR S I +   ++        
Sbjct: 127 VFMNAGAYGGEIAHILQSCKVLTKDGEIETLSVKDLAFGYRHSAIQESGAVVLSAKFALA 186

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P +  +I   +  + H RE  QP++  + GS FK P GH A QLI ++G +G   GG ++
Sbjct: 187 PGTHQVIKQEMDRLTHLRELKQPLEYPSCGSVFKRPVGHFAGQLISEAGLKGYRIGGVEV 246

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H  FMIN  + T  D E L E V +KV   SG+ LE E++ LG+
Sbjct: 247 SEKHAGFMINVADGTAKDYEDLIEFVIEKVKEHSGVTLEREVRILGE 293


>gi|50914169|ref|YP_060141.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pyogenes MGAS10394]
 gi|94994372|ref|YP_602470.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pyogenes MGAS10750]
 gi|139473804|ref|YP_001128520.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pyogenes str. Manfredo]
 gi|68052496|sp|Q5XCA5|MURB_STRP6 RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|166222944|sp|Q1J6Q7|MURB_STRPF RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|166222945|sp|A2REL5|MURB_STRPG RecName: Full=UDP-N-acetylenolpyruvoylglucosamine reductase;
           AltName: Full=UDP-N-acetylmuramate dehydrogenase
 gi|50903243|gb|AAT86958.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pyogenes MGAS10394]
 gi|94547880|gb|ABF37926.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pyogenes MGAS10750]
 gi|134272051|emb|CAM30290.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Streptococcus
           pyogenes str. Manfredo]
          Length = 295

 Score =  208 bits (530), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 94/287 (32%), Positives = 143/287 (49%), Gaps = 5/287 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIVGLGSNILVRDAG 79
            +EN PLK  T+ + GG A+ +  P++ ++L   +      ++P  ++G  SN++VRD G
Sbjct: 10  IRENEPLKHYTYTKVGGPADFLAFPRNHYELSRIVAYANKENMPWLVLGNASNLIVRDGG 69

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           IRG V+        ++   N   +   A  +       A  H + GF F  GIPGSIGGA
Sbjct: 70  IRGFVIMFDKLNAVHL---NGYTLEAEAGANLIETTKIAKFHSLTGFEFACGIPGSIGGA 126

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            +MNAGA   E S   +    +   G    I    + + YR S I +   I+        
Sbjct: 127 VFMNAGAYGGEISHIFLSAKVLTSSGEIKTISARDMAFGYRHSAIQETGDIVISAKFALK 186

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P + + IS  +  + H R+  QP++  + GS FK P GH A QLI ++  +G   GG ++
Sbjct: 187 PGNYDTISQEMNRLNHLRQLKQPLEFPSCGSVFKRPPGHFAGQLIMEANLKGHRIGGVEV 246

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
           SE H  FMIN  + T  D E L   V + V N SG+ LE E++ +G+
Sbjct: 247 SEKHAGFMINVADGTAKDYEDLIAYVIETVENHSGVRLEPEVRIIGE 293


>gi|229071409|ref|ZP_04204631.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           F65185]
 gi|228711700|gb|EEL63653.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           F65185]
          Length = 301

 Score =  208 bits (530), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 90/302 (29%), Positives = 151/302 (50%), Gaps = 5/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           + +L+ E  +   G+   N PL + T  + GG A+++  P+ +  ++  L L+       
Sbjct: 1   MEQLVNELIEADVGRVLVNEPLARYTTMKIGGPADILIVPKHVAGIEKTLQLVKQYKTKW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T++G GSN+LV D GI GVV+RL          ++     VG+      L+    R G+ 
Sbjct: 61  TVIGRGSNLLVSDQGIEGVVIRLGEGLDHLEVEKHKVR--VGSGYPLIKLSTLLSRQGLA 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA+  + S  + +   +   G    +  ++L++ YRSS +
Sbjct: 119 GLEFASGIPGSVGGAVYMNAGAHKSDISSVLSKALILFEDGTIAWLTNKELEFSYRSSVL 178

Query: 185 TKDLI--ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
                  +     +     +  I  ++ N   +R   QP      GS F+NP  H A  L
Sbjct: 179 QTKRPGIVLEAEFQLQVGKREEIVRSMQNNKDYRRETQPWNHPCAGSIFRNPIPHFAGDL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           +EK+G RG   GGA+ISE+H NF++N   A+  D+  L E ++  + ++  + +  E++ 
Sbjct: 239 VEKAGLRGYRIGGAQISEMHGNFIVNTGGASAQDVLSLIELIKHTIKDKFDVDMHTEVEI 298

Query: 303 LG 304
           +G
Sbjct: 299 IG 300


>gi|206976781|ref|ZP_03237685.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           H3081.97]
 gi|206745091|gb|EDZ56494.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           H3081.97]
          Length = 301

 Score =  208 bits (530), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 88/302 (29%), Positives = 150/302 (49%), Gaps = 5/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           + +L+ E  +   G+   + PL + T  + GG A+++  P+ +  ++  L L+       
Sbjct: 1   MEQLVNELIEANVGRVLVDEPLARYTTMKIGGPADILIVPKHVAGIEKTLQLVKKYKTKW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIG 124
           T++G GSN+LV D GI GVV+RL          ++     VG       L+    R G+ 
Sbjct: 61  TVIGRGSNLLVSDLGIEGVVIRLGEGLDHLEVEKHRVR--VGGGYPLIKLSTLLSRQGLA 118

Query: 125 GFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEI 184
           G  F  GIPGS+GGA YMNAGA+N + S  + +   +   G    +   ++++ YR+S +
Sbjct: 119 GLEFASGIPGSVGGAVYMNAGAHNSDISNILSKALILFEDGTIDWLTHGEMEFSYRTSVL 178

Query: 185 TKDLI--ITHVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQL 242
                  +     +     +  I + +     +R   QP      GS F+NP  + A  L
Sbjct: 179 QTKRPGIVLEAEFQLQIGERERIVSVMQKNKDYRRETQPWNHPCAGSVFRNPIPYFAGDL 238

Query: 243 IEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKR 302
           IEK+G RG + GGA+ISE+H NF+IN   A+  D+  L   V++ + ++  + +  E++ 
Sbjct: 239 IEKAGLRGYQIGGAQISEMHGNFIINTGGASAQDVLSLIALVKQTIKDKFSVEMHTEVEI 298

Query: 303 LG 304
           +G
Sbjct: 299 IG 300


>gi|114766764|ref|ZP_01445701.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Pelagibaca
           bermudensis HTCC2601]
 gi|114541021|gb|EAU44078.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Roseovarius sp.
           HTCC2601]
          Length = 314

 Score =  208 bits (530), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 110/310 (35%), Positives = 160/310 (51%), Gaps = 15/310 (4%)

Query: 12  ERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGS 71
           +    +RG+   N  L  +TW R GG A+V+FQP D+ DL+ FL  LP +  +  +G+GS
Sbjct: 8   DTLPDVRGRLTPNRDLSALTWLRVGGPADVLFQPADLEDLQQFLRALPPEREVFPMGVGS 67

Query: 72  NILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYG 131
           N++VRD G+R VV+RL         +      +        + A            F   
Sbjct: 68  NLIVRDGGLRAVVIRLGRGFN---GIEIDGTRVTVGAAMLDAQAAKRAAAEGVDLTFLRT 124

Query: 132 IPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIIT 191
           IPGSIGGA  MNAG      + +++E+  + R G+   + ++ LK  YR SE+ +  +I 
Sbjct: 125 IPGSIGGAVRMNAGCYGTYVADHLIEIRAVTRAGDLVTLSKDALKLGYRHSELPEGCVIV 184

Query: 192 HVVLRGFPESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGH------------SA 239
             V  G       ++A +      R+  QP K++T GSTF+NP G              A
Sbjct: 185 EAVFEGTTGDAEELAARMDAQVKKRDETQPTKDRTAGSTFRNPAGFSSTGREDDVHDLKA 244

Query: 240 WQLIEKSGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWE 299
           W++I+ +G RG   GGA++S  H NF++N   AT  DLE LGE+VRKKVF  SGI L WE
Sbjct: 245 WKVIDDAGMRGATLGGAQMSPKHSNFLVNTGEATAADLEGLGEEVRKKVFQDSGIELHWE 304

Query: 300 IKRLGDFFDH 309
           I R+G+    
Sbjct: 305 IMRVGEPAQK 314


>gi|67920790|ref|ZP_00514309.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Crocosphaera
           watsonii WH 8501]
 gi|67856907|gb|EAM52147.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Crocosphaera
           watsonii WH 8501]
          Length = 304

 Score =  208 bits (530), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 85/302 (28%), Positives = 138/302 (45%), Gaps = 4/302 (1%)

Query: 9   LLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLL-PSDIPITIV 67
           ++             N  L   T +R GG A+    P++   L+         DIP+ ++
Sbjct: 1   MITAFKPSSEPIIHPNVSLASHTSYRVGGKAQWYTAPRNFEQLQETFEWFQKQDIPLVLL 60

Query: 68  GLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFH 127
           G GSN+L+ D GI G+VL                ++ V A      +A  A + G  G  
Sbjct: 61  GAGSNLLISDRGIDGLVLSTRYLRHRRF-DEATGQVTVAAGKPIVGVAWQAAKLGWSGLE 119

Query: 128 FFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKD 187
           +  GIPG++GGA  MNAGA+N  T+  +V    +   G    +  E L Y YR+S +   
Sbjct: 120 WAVGIPGTVGGAVVMNAGAHNQCTADSLVSAVVVSPDGKVETLTPEDLNYSYRTSALQGG 179

Query: 188 LIITHVVLRGFPESQNIISA--AIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEK 245
             +                      +    R++ QP  + + GS F+NP+ ++A  LIE+
Sbjct: 180 KRLVIEATFQLQTGFTREEITAKTQDNLWKRKSSQPYDKPSCGSVFRNPSPYAAGWLIEQ 239

Query: 246 SGCRGLEFGGAKISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGD 305
            G +G   G A++S+ H NF++N   A   D+ +L   +++KV +   +LLE E+K LG+
Sbjct: 240 LGLKGYRVGDAEVSQRHANFILNCGQAKAQDIFHLINHIQEKVQSHWSLLLEPEVKILGE 299

Query: 306 FF 307
           F 
Sbjct: 300 FS 301


>gi|227889651|ref|ZP_04007456.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           johnsonii ATCC 33200]
 gi|227849794|gb|EEJ59880.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Lactobacillus
           johnsonii ATCC 33200]
          Length = 301

 Score =  208 bits (530), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 88/290 (30%), Positives = 149/290 (51%), Gaps = 3/290 (1%)

Query: 21  FQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLP-SDIPITIVGLGSNILVRDAG 79
            QEN PL + T+ +TGG A+ +  P+++++L+  +  +  ++IP+T++G  SN+++RD G
Sbjct: 13  IQENIPLSRFTFTKTGGPAQYLAFPKNLNELELLVDTVKENNIPLTVIGNASNLIIRDGG 72

Query: 80  IRGVVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGA 139
           I G+VL L+      +  ++   +   A       + +A   G+ G  F  GIPGS+GGA
Sbjct: 73  ISGLVLILTKMDTI-VANKDEATVTADAGARIIDTSEAACEAGLSGLEFAAGIPGSVGGA 131

Query: 140 AYMNAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITK-DLIITHVVLRGF 198
            +MNAGA   ET   +  V  + R G       +++++ YR S + +   I+        
Sbjct: 132 VFMNAGAYGGETEFVIKSVRVLTRAGEFKTYTHDEMEFGYRHSLVQETGDIVVSATFGLE 191

Query: 199 PESQNIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKI 258
           P  +  I A +      R   QP++  + GS FK P GH    +I K+G +G   GGA+ 
Sbjct: 192 PGDKWAIKAKMEYFNGLRRAKQPLEYPSCGSVFKRPAGHFVGPMIIKAGLQGKRIGGAED 251

Query: 259 SELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLGDFFD 308
           S  H  F++N  +AT  D   L   ++K +    GI L+ E++ +G   D
Sbjct: 252 SMKHAGFIVNVGDATATDYLDLIHLIQKTIKKDFGIDLQTEVRIIGKEKD 301


>gi|229081162|ref|ZP_04213672.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           Rock4-2]
 gi|228702206|gb|EEL54682.1| UDP-N-acetylenolpyruvoylglucosamine reductase [Bacillus cereus
           Rock4-2]
          Length = 301

 Score =  208 bits (530), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 90/302 (29%), Positives = 151/302 (50%), Gaps = 5/302 (1%)

Query: 6   ISRLLRERGKQLRGKFQENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPI 64
           + +L+ E  +   G+   N PL + T  + GG A+++  P+ +  ++  L L+       
Sbjct: 1   MEQLVNELIEADVGRVLVNEPLARYTTMKIGGPADILIVPKHVAGIEKTLQLVKQYKTKW 60

Query: 65  TIVGLGSNILVRDAGIRGVVLRLSNAGFSNIEVRNHC