RPSBLAST alignment for GI: 254781095 and conserved domain: TIGR00179

>gnl|CDD|161747 TIGR00179, murB, UDP-N-acetylenolpyruvoylglucosamine reductase. This model describes MurB, UDP-N-acetylenolpyruvoylglucosamine reductase, which is also called UDP-N-acetylmuramate dehydrogenase. It is part of the pathway for the biosynthesis of the UDP-N-acetylmuramoyl-pentapeptide that is a precursor of bacterial peptidoglycan. Length = 284
 Score =  177 bits (450), Expect = 4e-45
 Identities = 97/288 (33%), Positives = 144/288 (50%), Gaps = 14/288 (4%)

Query: 27  LKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPS-DIPITIVGLGSNILVRDAGIRGVVL 85
           L + T ++ GGNA  +  P+ I  L   L      D P+ I+G GSN+L+ D G  GV++
Sbjct: 1   LAEFTTYKIGGNARHIVCPESIEQLVNVLDNAKEEDQPLLILGEGSNLLILDDGRGGVII 60

Query: 86  RLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAG 145
            L   G    +      + VG   +   L   AL++G+ G  F  GIPG++GGA  MNAG
Sbjct: 61  NLG-KGIDIEDDEGEY-VHVGGGENWHKLVKYALKNGLSGLEFLAGIPGTVGGAVIMNAG 118

Query: 146 ANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLR-------GF 198
           A   E S+ +V    +   G    +  EQL + YR+S      +   +VL+       GF
Sbjct: 119 AYGVEISEVLVYATILLATGKTEWLTNEQLGFGYRTSIFQHKYV--GLVLKAEFQLTLGF 176

Query: 199 PESQN--IISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGA 256
               +   I+A        R       +   GS FKNP+ + A +LIE+ G +G + GGA
Sbjct: 177 GTRLDPETITAQQVFNKVCRMRTSHYPDPNAGSFFKNPSPNHAGRLIEECGLKGYQIGGA 236

Query: 257 KISELHCNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEIKRLG 304
            +S+ H NF++N DNA   D+  L E V+ +V  + GILLE E+K +G
Sbjct: 237 AVSKQHANFLVNIDNAKSEDVLDLIEHVKAEVGEKYGILLEPEVKIIG 284