RPSBLAST alignment of GI: 254781095 and MMDB domain: 1uxy_A_67-190

>1uxy_A (A:67-190) MURB, uridine diphospho-N-acetylenolpyruvylglucosamine reductase; peptidoglycan synthesis, cell WALL, cell division, oxidoreductase, NADP; HET: FAD EPU; 1.80A {Escherichia coli}Length = 124
 Score = 55.3 bits (133), Expect = 9e-09
 Identities = 27/109 (24%), Positives = 44/109 (40%), Gaps = 5/109 (4%)

Query: 103 MIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGID 162
           + VGA  +   L    L+ G+ G      IPG +G +   N GA   E  +    V  ++
Sbjct: 13  LHVGAGENWHRLVKYTLQEGMPGLENLALIPGCVGSSPIQNIGAYGVELQRVCAYVDSVE 72

Query: 163 RK-GNQHVIPREQLKYQYRS----SEITKDLIITHVVLRGFPESQNIIS 206
              G Q  +  ++ ++ YR      E      I  V LR   E Q +++
Sbjct: 73  LATGKQVRLTAKECRFGYRDSIFKHEYQDRFAIVAVGLRLPKEWQPVLT 121