RPSBLAST alignment of GI: 254781095 and MMDB domain: 2gqt_A_70-198

>2gqt_A (A:70-198) UDP-N-acetylenolpyruvylglucosamine reductase; peptidoglycan biosynthesis, enolpyruvyl-UDP-N- acetylglucosamine, flavin adenine dinucleotide; HET: FAD; 1.30A {Thermus caldophilus} PDB: 2gqu_A*Length = 129
 Score = 68.5 bits (167), Expect = 1e-12
 Identities = 38/125 (30%), Positives = 52/125 (41%), Gaps = 2/125 (1%)

Query: 103 MIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYMNAGANNCETSQYVVEVHGID 162
             VGA      L   A R G+ G     GIP  +GGA  MNAG    E +  +  V    
Sbjct: 7   GWVGAGTLLPLLVQEAARAGLSGLEGLLGIPAQVGGAVKMNAGTRFGEMADALEAVEVFH 66

Query: 163 RKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPESQNIISAAIANVCHHRETVQPI 222
                HV   E+L + YR S +    I+T V L+     +  I   +A V   R+  QP 
Sbjct: 67  DGA-FHVYCPEELGFGYRKSHLPPGGIVTRVRLKLKERPKEEILRRMAEVDRARKG-QPK 124

Query: 223 KEKTG 227
           ++  G
Sbjct: 125 RKSAG 129