RPSBLAST alignment of GI: 254781095 and protein with PDBid: 2gqt

>2gqt_A UDP-N-acetylenolpyruvylglucosamine reductase; peptidoglycan biosynthesis, enolpyruvyl-UDP-N- acetylglucosamine, flavin adenine dinucleotide; HET: FAD; 1.30A {Thermus caldophilus} PDB: 2gqu_A* Length = 268
 Score =  185 bits (470), Expect = 1e-47
 Identities = 88/278 (31%), Positives = 127/278 (45%), Gaps = 18/278 (6%)

Query: 23  ENFPLKQITWFRTGGNAEVMFQPQDIHDLKYFLTLLPSDIPITIVGLGSNILVRDAGIRG 82
           E   LK  T    GG AE+ +  +   +LK        + P  ++G GSN+LV D G+  
Sbjct: 7   ERVLLKDYTTLGVGGPAEL-WTVETREELKRAT-----EAPYRVLGNGSNLLVLDEGVPE 60

Query: 83  VVLRLSNAGFSNIEVRNHCEMIVGARCSGKSLANSALRHGIGGFHFFYGIPGSIGGAAYM 142
            V+R      +        +  VGA      L   A R G+ G     GIP  +GGA  M
Sbjct: 61  RVIR-----LAGEFQTYDLKGWVGAGTLLPLLVQEAARAGLSGLEGLLGIPAQVGGAVKM 115

Query: 143 NAGANNCETSQYVVEVHGIDRKGNQHVIPREQLKYQYRSSEITKDLIITHVVLRGFPESQ 202
           NAG    E     +E   +   G  HV   E+L + YR S +    I+T V L+     +
Sbjct: 116 NAGTRFGEM-ADALEAVEVFHDGAFHVYCPEELGFGYRKSHLPPGGIVTRVRLKLKERPK 174

Query: 203 NIISAAIANVCHHRETVQPIKEKTGGSTFKNPTGHSAWQLIEKSGCRGLEFGGAKISELH 262
             I   +A V   R+     K K+ G  FKNP G SA +LI++ G +GL  G A IS  H
Sbjct: 175 EEILRRMAEVDRARK--GQPKRKSAGCAFKNPPGQSAGRLIDERGLKGLRVGDAMISLEH 232

Query: 263 CNFMINADNATGYDLEYLGEQVRKKVFNQSGILLEWEI 300
            NF++N   A   D+  L  +V++++     + LEWE+
Sbjct: 233 GNFIVNLGQARAKDVLELVRRVQEEL----PLELEWEV 266