HHsearch alignment for GI: 254781096 and conserved domain: cd00757

>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1-like enzymes involved in molybdopterin and thiamine biosynthesis family. The common reaction mechanism catalyzed by MoeB and ThiF, like other E1 enzymes, begins with a nucleophilic attack of the C-terminal carboxylate of MoaD and ThiS, respectively, on the alpha-phosphate of an ATP molecule bound at the active site of the activating enzymes, leading to the formation of a high-energy acyladenylate intermediate and subsequently to the formation of a thiocarboxylate at the C termini of MoaD and ThiS. MoeB, as the MPT synthase (MoaE/MoaD complex) sulfurase, is involved in the biosynthesis of the molybdenum cofactor, a derivative of the tricyclic pterin, molybdopterin (MPT). ThiF catalyzes the adenylation of ThiS, as part of the biosynthesis pathway of thiamin pyrophosphate (vitamin B1).
Probab=94.14  E-value=0.4  Score=26.75  Aligned_cols=31  Identities=35%  Similarity=0.476  Sum_probs=24.6

Q ss_pred             CEEEEEEECHHHHHHHHHHHHHCCC-EEEEEEC
Q ss_conf             6079994614608789999998798-6999607
Q gi|254781096|r    8 GPIHFVGIGGIGMSGIAEVLHNTGH-QVQGSDV   39 (474)
Q Consensus         8 ~~i~~iGigG~G~s~lA~~l~~~G~-~V~g~D~   39 (474)
T Consensus        22 s~VlivG~GGlG-s~~~~~La~~Gvg~i~lvD~   53 (228)
T cd00757          22 ARVLVVGAGGLG-SPAAEYLAAAGVGKLGLVDD   53 (228)
T ss_pred             CCEEEECCCHHH-HHHHHHHHHCCCCEEEEEEC
T ss_conf             978998877889-99999999839975899978