HHsearch alignment for GI: 254781099 and conserved domain: COG0059

>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism].
Probab=95.13  E-value=0.1  Score=30.97  Aligned_cols=67  Identities=27%  Similarity=0.424  Sum_probs=53.2

Q ss_pred             CHHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEEC-CCHHHHHHHHCCCEEECCCCCCCCCCCEEEE
Q ss_conf             1321898799983685489999999985986999818-9647889997898996453157225888998
Q gi|254781099|r    3 LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDD-HPCAVKQAKDMGIEVIDFREIPWSIISFLVL   70 (468)
Q Consensus         3 ~~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~-~~~~~~~l~~~g~~~~~~~~~~~~~~d~vv~   70 (468)
T Consensus        13 l~~LkgK~iaIIGYGsQG~ahalNlRDSGlnViiGlr~g~~s~~kA~~dGf~V~~v~ea~-k~ADvim~   80 (338)
T COG0059          13 LDLLKGKKVAIIGYGSQGHAQALNLRDSGLNVIIGLRKGSSSWKKAKEDGFKVYTVEEAA-KRADVVMI   80 (338)
T ss_pred             HHHHCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHCCCEEECHHHHH-HCCCEEEE
T ss_conf             456549869999027087888742242487479985688724899996697751399985-22799998