HHsearch alignment for GI: 254781099 and conserved domain: COG0169

>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism].
Probab=96.93  E-value=0.023  Score=35.47  Aligned_cols=41  Identities=15%  Similarity=0.301  Sum_probs=25.2

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCC-EEEEEECCCHHHHHH
Q ss_conf             89879998368548999999998598-699981896478899
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGV-HVIAWDDHPCAVKQA   47 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~-~V~~~D~~~~~~~~l   47 (468)
T Consensus       125 ~~~~vlilGAGGAarAv~~aL~~~g~~~i~V~NRt~~ra~~L  166 (283)
T COG0169         125 TGKRVLILGAGGAARAVAFALAEAGAKRITVVNRTRERAEEL  166 (283)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCCEEEEEECCHHHHHHH
T ss_conf             788899989768999999999986998799995888999999