HHsearch alignment for GI: 254781099 and conserved domain: COG0499

>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism].
Probab=95.42  E-value=0.079  Score=31.73  Aligned_cols=146  Identities=20%  Similarity=0.107  Sum_probs=59.6

Q ss_pred             HHHHHHHCCCEEEEEECCCHH-----HHHH-HHCCCEEECCCCCCC------------CCCCEEEECCCCC--CCCCCCC
Q ss_conf             999999859869998189647-----8899-978989964531572------------2588899888868--5675578
Q gi|254781099|r   23 AACALKDSGVHVIAWDDHPCA-----VKQA-KDMGIEVIDFREIPW------------SIISFLVLSPGIA--LTGENAH   82 (468)
Q Consensus        23 ~A~~l~~~G~~V~~~D~~~~~-----~~~l-~~~g~~~~~~~~~~~------------~~~d~vv~Spgi~--~~~~~~~   82 (468)
T Consensus        61 LietL~a~GAeV~~a~cNplSTqD~vaaAl~~~~GipVfA~kGe~~eeY~~~~~~vl~~~p~iiiDDG~D~~~~vh-~~~  139 (420)
T COG0499          61 LIETLKAGGAEVRWASCNPLSTQDDVAAALAAKEGIPVFAWKGETLEEYYEAIDQVLDWEPNIIIDDGGDLTKLVH-LER  139 (420)
T ss_pred             HHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHCCCCCEEEECCCCEEEEEE-CCC
T ss_conf             9999985585699852788766678999987505961799707878999999999956599879824732021000-054


Q ss_pred             HHHHHHHHCCCEE-EEEHHHHHHHHHHCCCCCCEEEEECCCCCCHH-------HHHHHHHHHH-----HHHHCCCCC--C
Q ss_conf             8899999769809-98303422334301568868996034575215-------7899999987-----310000000--1
Q gi|254781099|r   83 WCVKLANQFNVEI-IGDIELFVRERRFSSLQSPFIAVTGTNGKSST-------VALISHVLRK-----NGYDVQLGG--N  147 (468)
Q Consensus        83 ~~~~~a~~~gi~v-~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt-------~~ll~~iL~~-----~g~~~~~~G--N  147 (468)
T Consensus       140 ~~l~~~i~G~tEETTTGV~RL~am~~~G~L~fPai~VNDs~tK~~FDNrYGtgqS~~DgI~RaTn~liaGK~vVV~GYG~  219 (420)
T COG0499         140 PELLDAIKGGTEETTTGVHRLRAMEKDGVLKFPAINVNDSVTKSLFDNRYGTGQSLLDGILRATNVLLAGKNVVVAGYGW  219 (420)
T ss_pred             HHHHHHHCCCCCCCCHHHHHHHHHHHCCCCCCCEEEECCHHHHCCCCCCCCCCHHHHHHHHHHHCEEECCCEEEEECCCC
T ss_conf             87887742877534228999998976697323558604344413145665641248999986420011486699963564


Q ss_pred             CCCCCCCCCCCCCCCEEEEECC
Q ss_conf             2443221101688837999217
Q gi|254781099|r  148 IGLPILNLEYFSPNRFYVIECS  169 (468)
Q Consensus       148 iG~p~~~~~~~~~~~~~V~E~S  169 (468)
T Consensus       220 vGrG~A~~~rg~GA~ViVtEvD  241 (420)
T COG0499         220 VGRGIAMRLRGMGARVIVTEVD  241 (420)
T ss_pred             CCHHHHHHHHCCCCEEEEEECC
T ss_conf             4366999862289869998248