HHsearch alignment for GI: 254781099 and conserved domain: COG0665

>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism].
Probab=93.53  E-value=0.18  Score=29.26  Aligned_cols=35  Identities=29%  Similarity=0.399  Sum_probs=31.5

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             89879998368548999999998598699981896
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
T Consensus         3 ~~~~vvIIGgGi~Gls~A~~La~~G~~V~vie~~~   37 (387)
T COG0665           3 MKMDVVIIGGGIVGLSAAYYLAERGADVTVLEAGE   37 (387)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             76439998986999999999997699199991798