HHsearch alignment for GI: 254781099 and conserved domain: COG0773

>COG0773 MurC UDP-N-acetylmuramate-alanine ligase [Cell envelope biogenesis, outer membrane].
Probab=100.00  E-value=0  Score=450.92  Aligned_cols=392  Identities=22%  Similarity=0.264  Sum_probs=289.1

Q ss_pred             EEEEECCCHHHHH-HHHHHHHCCCEEEEEECC-CHHHHHHHHCCCEEEC-CCCCCCCCCCEEEECCCCCCCCCCCCHHHH
Q ss_conf             7999836854899-999999859869998189-6478899978989964-531572258889988886856755788899
Q gi|254781099|r   10 SIAVFGLGRSGLS-AACALKDSGVHVIAWDDH-PCAVKQAKDMGIEVID-FREIPWSIISFLVLSPGIALTGENAHWCVK   86 (468)
Q Consensus        10 ~v~i~G~G~sG~s-~A~~l~~~G~~V~~~D~~-~~~~~~l~~~g~~~~~-~~~~~~~~~d~vv~Spgi~~~~~~~~~~~~   86 (468)
T Consensus         9 ~iHfIGIgG~GMsglA~iL~~~G~~VsGSD~~~~~~t~~L~~~G~~i~~gh~~~ni~~~~~VV~s~Ai~~----~NpEi~   84 (459)
T COG0773           9 KIHFIGIGGIGMSGLAEILLNLGYKVSGSDLAESPMTQRLEALGIEIFIGHDAENILDADVVVVSNAIKE----DNPEIV   84 (459)
T ss_pred             EEEEEEECCCCHHHHHHHHHHCCCCEECCCCCCCHHHHHHHHCCCEEECCCCHHHCCCCCEEEEECCCCC----CCHHHH
T ss_conf             1799965505679999999967991177166526778999978996867979788589965999656579----998999


Q ss_pred             HHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHC-CCCC-C---CCCCCCCCCCCCCC
Q ss_conf             99976980998303422334301568868996034575215789999998731000-0000-1---24432211016888
Q gi|254781099|r   87 LANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDV-QLGG-N---IGLPILNLEYFSPN  161 (468)
Q Consensus        87 ~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~-~~~G-N---iG~p~~~~~~~~~~  161 (468)
T Consensus        85 ~A~e~~ipi~~r~e~L~elm~~----~~~iaVaGTHGKTTTTsmla~vl~~~gldPtf~iGG~~~~~g~n----a~~g~~  156 (459)
T COG0773          85 AALERGIPVISRAEMLAELMRF----RTSIAVAGTHGKTTTTSMLAWVLEAAGLDPTFLIGGILKNFGTN----ARLGSG  156 (459)
T ss_pred             HHHHCCCCEECHHHHHHHHHHC----CEEEEEECCCCCHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCC----CCCCCC
T ss_conf             9998599816289999999707----71699947887540899999999867999879977744557765----545888


Q ss_pred             CEEEEECC----CCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHCCCCCCCEEEEC---CCCCCCCCCHHHHHHHHHCC
Q ss_conf             37999217----754321223332210111002101222111000011221000101---34432247867899987401
Q gi|254781099|r  162 RFYVIECS----SYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS---KHAIICINDHQCEKIAYDMN  234 (468)
Q Consensus       162 ~~~V~E~S----SfQL~~~~~~~PdiavITNI~~DHLd~~~s~e~y~~aK~~i~~~~---~~~iln~dd~~~~~~~~~~~  234 (468)
T Consensus       157 ~~fV~EADEsD~sF-----l~~~P~~aIvTNid~DH~D~y~~~~~i~~~F~~f~~~vp~~G~~v~~~dd~~l~~l~~~~~  231 (459)
T COG0773         157 DYFVAEADESDSSF-----LHYNPRVAIVTNIEFDHLDYYGDLEAIKQAFHHFVRNVPFYGRAVVCGDDPNLRELLSRGC  231 (459)
T ss_pred             CEEEEEECCCCCCC-----CCCCCCEEEEECCCCCCHHHHCCHHHHHHHHHHHHHHCCCCCEEEEECCCHHHHHHHHCCC
T ss_conf             64999951541650-----2488978998078834001218999999999999983886655999788888999872225


Q ss_pred             CCCCEEECCCCC---CCCCCCCEEECCC--EEEECCCCC-CCCCCCCCCCCHHHHHCCCHHHHHHCCCCCCCCCHHHCCC
Q ss_conf             234301103644---3222341121241--354146764-2123455885101110011012221022222110000000
Q gi|254781099|r  235 FIGHSISRISSQ---SLQSDSDLYIDES--FLKCSATSE-VIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLS  308 (468)
Q Consensus       235 ~~~~~~~~~~~~---~~~~~~~~~~~~~--~~~~~~~~~-~~~~~~~l~G~HNi~NalaAia~a~~lGi~~~~i~~~L~~  308 (468)
T Consensus       232 --~~~v~tyG~~~~ad~~a-~ni~~~~~~~~F~V~~~g~~~~~~~l~~pG~HNvlNAlaaia~a~~~Gi~~~~i~~aL~~  308 (459)
T COG0773         232 --WSPVVTYGFDDEADWRA-ENIRQDGSGTTFDVLFRGEELGEVKLPLPGRHNVLNALAAIAVARELGIDPEAIAEALAS  308 (459)
T ss_pred             --CCCEEEECCCCCCCEEE-EEEEEECCCCEEEEEECCCEEEEEEECCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             --87379424787672899-976870664279999868556799972676226888999999999849998999999973


Q ss_pred             HHHHHHHHHHHCCCCCCEEECCCCCCCHH---HHHHHHHCCC---CCCEEEECC--CCCC-CCHHHHHHHHCCCCEEEEE
Q ss_conf             01345443321003430000023556755---5555320133---320012032--1012-2068989984278689998
Q gi|254781099|r  309 CGGLTHRLQTIARLGHVIFINDSKATNLH---SVIHAFLNEK---RRIYWIAGG--LSKS-DDFSTLFPFISKIAKAYFI  379 (468)
Q Consensus       309 f~gv~~R~E~i~~~~gv~iIDDS~atnp~---a~~~Al~~~~---~~i~lI~GG--~~K~-~d~~~L~~~~~~~~~~~li  379 (468)
T Consensus       309 F~GvkRRfe~~g~~~~~~viDD-YaHHPtEI~aTL~aaR~~~~~~~rIvaifQPHrySRt~~~~~dF~~~l~~AD~v~l~  387 (459)
T COG0773         309 FQGVKRRFELKGEVNGVTVIDD-YAHHPTEIKATLAAARQKVPGGKRIVAVFQPHRYSRTRDLLDDFAKALSDADEVILL  387 (459)
T ss_pred             CCCCCEEEEEEEEECCEEEEEC-CCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             8896413688646887899856-888979999999999976588866999977873175899999999888519999996


Q ss_pred             -----------C-CCHHHHHHHHHCCCCEEEECCHHHHHHHHHHHHHHCCCCCEEEECC
Q ss_conf             -----------8-9989988863168988998799999999999998448985999452
Q gi|254781099|r  380 -----------G-NSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIVLFSP  426 (468)
Q Consensus       380 -----------G-~~~~~i~~~~~~~~~~~~~~~~~~a~~~i~~~~~~~~~gDiVLlSP  426 (468)
T Consensus       388 ~VY~A~e~~~~g~~~~~~l~~~i~~~~~~~-~~~~~~~~~~l~---~~~~~gD~il~mG  442 (459)
T COG0773         388 DVYAAGEEPIEGDVSSEDLAEKIRQPGHVD-VPDLDDLVELLA---KVAQPGDVILFMG  442 (459)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHCCCCCC-CCCHHHHHHHHH---HHCCCCCEEEEEC
T ss_conf             233357888767753999999851377014-788889999999---6478999899966