HHsearch alignment for GI: 254781099 and conserved domain: COG1004

>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane].
Probab=93.04  E-value=0.71  Score=25.17  Aligned_cols=43  Identities=26%  Similarity=0.291  Sum_probs=34.9

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCC
Q ss_conf             7999836854899999999859869998189647889997898
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGI   52 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~   52 (468)
T Consensus         2 kI~viGtGYVGLv~g~~lA~~GHeVv~vDid~~KV~~ln~g~~   44 (414)
T COG1004           2 KITVIGTGYVGLVTGACLAELGHEVVCVDIDESKVELLNKGIS   44 (414)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHCCCC
T ss_conf             1589888556887899998709848999578899999867999