HHsearch alignment for GI: 254781099 and conserved domain: COG1086

>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism].
Probab=91.86  E-value=0.98  Score=24.18  Aligned_cols=349  Identities=11%  Similarity=0.028  Sum_probs=0.0

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCC-EEEEEECCCHHHHHHHHCCCEEECCCCCC-----CCCCCEEEECCCCCCCCCCCC
Q ss_conf             879998368548999999998598-69998189647889997898996453157-----225888998888685675578
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGV-HVIAWDDHPCAVKQAKDMGIEVIDFREIP-----WSIISFLVLSPGIALTGENAH   82 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~-~V~~~D~~~~~~~~l~~~g~~~~~~~~~~-----~~~~d~vv~Spgi~~~~~~~~   82 (468)
T Consensus       117 ~r~lIiGAG~ag~~l~r~~~~~~~~~pV~fiDdd~~~~g~~i~Gv~V~g~~~i~~~v~~~~~~~iiiAips~~~~--~~~  194 (588)
T COG1086         117 IRLLIIGAGSAGDLLLRALRRDPEYTPVAFLDDDPDLTGMKIRGVPVLGRIEIERVVEELGIQLILIAIPSASQE--ERR  194 (588)
T ss_pred             CCEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHCCCEEECEEEECHHHHHHHHHHCCCCEEEEECCCCCHH--HHH
T ss_conf             866999376589999999974899615999888736518877022642314799999971876699964878899--999


Q ss_pred             HHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHH----CCCCCCCCCCCCC-CCC
Q ss_conf             88999997698099830342233430156886899603457521578999999873100----0000012443221-101
Q gi|254781099|r   83 WCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYD----VQLGGNIGLPILN-LEY  157 (468)
Q Consensus        83 ~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~----~~~~GNiG~p~~~-~~~  157 (468)
T Consensus       195 ~i~~~l~~~~~~v~~lP~~~~l~~--~~~~lreI~ieDLLgR~pV~~d~~~i~~~~~gK~vLVTGagGSiGsel~~qil~  272 (588)
T COG1086         195 RILLRLARTGIAVRILPQLTDLKD--LNGQLREIEIEDLLGRPPVALDTELIGAMLTGKTVLVTGGGGSIGSELCRQILK  272 (588)
T ss_pred             HHHHHHHHCCCCEEECCCHHHHHH--HCCCCCCCCHHHHHCCCCCCCCHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHH
T ss_conf             999998755970785574899987--324654377989738999987879998670798899968987367999999985


Q ss_pred             CCCCCEEEEECCCCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHCCCCC
Q ss_conf             68883799921775432122333221011100210122211100001122100010134432247867899987401234
Q gi|254781099|r  158 FSPNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIG  237 (468)
Q Consensus       158 ~~~~~~~V~E~SSfQL~~~~~~~PdiavITNI~~DHLd~~~s~e~y~~aK~~i~~~~~~~iln~dd~~~~~~~~~~~~~~  237 (468)
T Consensus       273 ~~p~~i~l~~~~----E~~~~--------------------~i~~el~~~~~---~~~~~~~igdVrD~~~~~~~~~~~k  325 (588)
T COG1086         273 FNPKEIILFSRD----EYKLY--------------------LIDMELREKFP---ELKLRFYIGDVRDRDRVERAMEGHK  325 (588)
T ss_pred             CCCCEEEEECCC----HHHHH--------------------HHHHHHHHHCC---CCCEEEEECCCCCHHHHHHHHHCCC
T ss_conf             498789996176----37799--------------------99999986278---7516899635346899999986388


Q ss_pred             CEEECCCCCCCCCCCCEEECCCEEEECCCCCCCCCCCCCCCCHHHHHCCCHHHHHHCCCCCCCCCHHHCCCHHHHHHHHH
Q ss_conf             30110364432223411212413541467642123455885101110011012221022222110000000013454433
Q gi|254781099|r  238 HSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQ  317 (468)
Q Consensus       238 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~G~HNi~NalaAia~a~~lGi~~~~i~~~L~~f~gv~~R~E  317 (468)
T Consensus       326 vd~VfHAAA~-----------KHVPl~E~nP~Eai~tNV~GT~nv~~aa~~~~V~~~V~iSTDKAV~PtNvmGaTKr~aE  394 (588)
T COG1086         326 VDIVFHAAAL-----------KHVPLVEYNPEEAIKTNVLGTENVAEAAIKNGVKKFVLISTDKAVNPTNVMGATKRLAE  394 (588)
T ss_pred             CCEEEEHHHH-----------CCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCHHHHHHHHHHH
T ss_conf             8668875555-----------36863101889999872173899999999839778999705866688417668899999


Q ss_pred             HHCCCCCCEEECCCCCCCHHHHHHHHHCCCCCCEEEECCCCCCCCHHHHHHHHCCCCEEEEECCCHHHHHHHHHCCCCEE
Q ss_conf             21003430000023556755555532013332001203210122068989984278689998899899888631689889
Q gi|254781099|r  318 TIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINST  397 (468)
Q Consensus       318 ~i~~~~gv~iIDDS~atnp~a~~~Al~~~~~~i~lI~GG~~K~~d~~~L~~~~~~~~~~~liG~~~~~i~~~~~~~~~~~  397 (468)
T Consensus       395 ~~~~a~~~~~-------~~~~T~f~~VRFGN----VlG--SrGSViPlFk~QI~~GgplTvTdp~------------mtR  449 (588)
T COG1086         395 KLFQAANRNV-------SGTGTRFCVVRFGN----VLG--SRGSVIPLFKKQIAEGGPLTVTDPD------------MTR  449 (588)
T ss_pred             HHHHHHHHCC-------CCCCCEEEEEEECC----EEC--CCCCCHHHHHHHHHCCCCCCCCCCC------------CEE
T ss_conf             9999974104-------88885799998254----545--8877778899999759984546867------------056


Q ss_pred             EECCHHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             987999999999999984489859994
Q gi|254781099|r  398 LSKTLDQALKSVVRDVENVQLPSIVLF  424 (468)
Q Consensus       398 ~~~~~~~a~~~i~~~~~~~~~gDiVLl  424 (468)
T Consensus       450 yfMTI~EAv~LVlqA~a~~~gGeifvl  476 (588)
T COG1086         450 FFMTIPEAVQLVLQAGAIAKGGEIFVL  476 (588)
T ss_pred             EEEEHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             788899999999998750689858998