HHsearch alignment for GI: 254781099 and conserved domain: COG1232

>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism].
Probab=94.21  E-value=0.087  Score=31.43  Aligned_cols=32  Identities=41%  Similarity=0.613  Sum_probs=29.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCC--CEEEEEECC
Q ss_conf             87999836854899999999859--869998189
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSG--VHVIAWDDH   40 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G--~~V~~~D~~   40 (468)
T Consensus         1 ~~i~IiG~GiaGLsaAy~L~k~~p~~~i~lfE~~   34 (444)
T COG1232           1 MKIAIIGGGIAGLSAAYRLQKAGPDVEVTLFEAD   34 (444)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCCCEEEEECC
T ss_conf             9399987828889999999985899867998348