HHsearch alignment for GI: 254781099 and conserved domain: COG2084

>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism].
Probab=96.99  E-value=0.0029  Score=41.68  Aligned_cols=114  Identities=16%  Similarity=0.181  Sum_probs=72.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHH-HHHHHHCCCEEECCCCCCCCCCCEEEECCCCCCCCCCCCHHHHH
Q ss_conf             87999836854899999999859869998189647-88999789899645315722588899888868567557888999
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCA-VKQAKDMGIEVIDFREIPWSIISFLVLSPGIALTGENAHWCVKL   87 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~-~~~l~~~g~~~~~~~~~~~~~~d~vv~Spgi~~~~~~~~~~~~~   87 (468)
T Consensus         1 ~kIafIGLG~MG~pmA~~L~~aG~~v~v~~r~~~ka~~~~~~~Ga~~a~s~~eaa~~aDvVitm--v~-~~~----~V~~   73 (286)
T COG2084           1 MKIAFIGLGIMGSPMAANLLKAGHEVTVYNRTPEKAAELLAAAGATVAASPAEAAAEADVVITM--LP-DDA----AVRA   73 (286)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCEECCCHHHHHHHCCEEEEE--CC-CHH----HHHH
T ss_conf             9079985735259999999977987899808856656899972980038899999619989996--17-989----9999


Q ss_pred             HHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             997698099830342233430156886899603457521578999999873100
Q gi|254781099|r   88 ANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYD  141 (468)
Q Consensus        88 a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~  141 (468)
T Consensus        74 V~~-g-----~~g~~-----~~~~~G~i~IDmSTisp~~a~~-~a~~~~~~G~~  115 (286)
T COG2084          74 VLF-G-----ENGLL-----EGLKPGAIVIDMSTISPETARE-LAAALAAKGLE  115 (286)
T ss_pred             HHH-C-----CCCHH-----HCCCCCCEEEECCCCCHHHHHH-HHHHHHHCCCC
T ss_conf             981-8-----53353-----3378997899878999899999-99999966986