HHsearch alignment for GI: 254781099 and conserved domain: KOG0029

>KOG0029 consensus.
Probab=97.27  E-value=0.0015  Score=43.58  Aligned_cols=78  Identities=24%  Similarity=0.319  Sum_probs=52.3

Q ss_pred             HCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECCCCCCCCCCC--EEEECCCCCCCCCCCCH
Q ss_conf             1898799983685489999999985986999818964788999789899645315722588--89988886856755788
Q gi|254781099|r    6 FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIIS--FLVLSPGIALTGENAHW   83 (468)
Q Consensus         6 ~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~~~~~~~~~d--~vv~Spgi~~~~~~~~~   83 (468)
T Consensus        13 ~~~~~VIVIGAGiaGLsAArqL~~~G~~V~VLEARd-------RvGGRI~t~~~~~~~~vd~Gas~~~g------~~~np   79 (501)
T KOG0029          13 GKKKKVIVIGAGLAGLSAARQLQDFGFDVLVLEARD-------RVGGRIYTFKSEGGDHVDLGASVLTG------VYNNP   79 (501)
T ss_pred             CCCCCEEEECCCHHHHHHHHHHHHCCCCEEEEECCC-------CCCCEEEEEECCCCCEEECCCCEECC------CCCCH
T ss_conf             788838998985789999999997598259997147-------76764778744898667147746517------78757


Q ss_pred             HHHHHHHCCCEEE
Q ss_conf             8999997698099
Q gi|254781099|r   84 CVKLANQFNVEII   96 (468)
Q Consensus        84 ~~~~a~~~gi~v~   96 (468)
T Consensus        80 l~~l~~qlgl~~~   92 (501)
T KOG0029          80 LALLSKQLGLELY   92 (501)
T ss_pred             HHHHHHHHCCCCC
T ss_conf             9999987496531