HHsearch alignment for GI: 254781099 and conserved domain: KOG0069

>KOG0069 consensus.
Probab=95.93  E-value=0.028  Score=34.79  Aligned_cols=27  Identities=7%  Similarity=0.137  Sum_probs=19.5

Q ss_pred             EEEECCCCCCCCCCCCHHHHHHHHCCCEEEE
Q ss_conf             8998888685675578889999976980998
Q gi|254781099|r   67 FLVLSPGIALTGENAHWCVKLANQFNVEIIG   97 (468)
Q Consensus        67 ~vv~Spgi~~~~~~~~~~~~~a~~~gi~v~s   97 (468)
T Consensus        86 K~i~t~~vG~D~----vDl~a~~krgI~V~n  112 (336)
T KOG0069          86 KLIVTMSVGYDH----VDLEAARKRGIRVAN  112 (336)
T ss_pred             EEEEEEECCCCH----HHHHHHHHCCCEEEC
T ss_conf             699984106532----138989865966860