HHsearch alignment for GI: 254781099 and conserved domain: PRK05855

>PRK05855 short chain dehydrogenase; Validated.
Probab=94.55  E-value=0.38  Score=27.00  Aligned_cols=28  Identities=29%  Similarity=0.326  Sum_probs=16.6

Q ss_pred             EEEECCCHHHH---HHHHHHHHCCCEEEEEEC
Q ss_conf             99983685489---999999985986999818
Q gi|254781099|r   11 IAVFGLGRSGL---SAACALKDSGVHVIAWDD   39 (468)
Q Consensus        11 v~i~G~G~sG~---s~A~~l~~~G~~V~~~D~   39 (468)
T Consensus        29 vlvHGyPD~~~vW~~v~~~La~-~f~vv~yDv   59 (582)
T PRK05855         29 VLVHGYPDSHEVWDGVAPLLAE-RFRVVAYDV   59 (582)
T ss_pred             EEEECCCCCHHHHHHHHHHHCC-CEEEEEECC
T ss_conf             9980688836668999998504-605995557