HHsearch alignment for GI: 254781099 and conserved domain: PRK06125

>PRK06125 short chain dehydrogenase; Provisional.
Probab=97.03  E-value=0.013  Score=37.10  Aligned_cols=45  Identities=22%  Similarity=0.302  Sum_probs=36.2

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHH
Q ss_conf             9813218987999836-854899999999859869998189647889
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQ   46 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~   46 (468)
T Consensus         1 M~~-~l~gK~alITG~s~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~   46 (259)
T PRK06125          1 MDL-HLAGKRVLITGASKGIGAAAAEAFAAEGCHLVLAARDADALAA   46 (259)
T ss_pred             CCC-CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHH
T ss_conf             998-8699989996877689999999999879989999798899999