HHsearch alignment for GI: 254781099 and conserved domain: PRK06436

>PRK06436 glycerate dehydrogenase; Provisional.
Probab=96.63  E-value=0.0072  Score=38.91  Aligned_cols=34  Identities=26%  Similarity=0.457  Sum_probs=17.0

Q ss_pred             HCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEEC
Q ss_conf             1898799983685489999999985986999818
Q gi|254781099|r    6 FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDD   39 (468)
Q Consensus         6 ~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~   39 (468)
T Consensus       120 L~gktvGIiG~G~IG~~vA~~~~afg~~V~~~~r  153 (303)
T PRK06436        120 LYNKSLGILGYGGIGRRVALLAKAFGMNIYAYTR  153 (303)
T ss_pred             ECCCEEEEECCCHHHHHHHHHHHHCCCEEEEECC
T ss_conf             1188899989765699999999977988999898