HHsearch alignment for GI: 254781099 and conserved domain: PRK06475

>PRK06475 salicylate hydroxylase; Provisional.
Probab=95.90  E-value=0.013  Score=37.19  Aligned_cols=33  Identities=36%  Similarity=0.408  Sum_probs=30.3

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             879998368548999999998598699981896
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
T Consensus         3 ~~VlIVGaGiaGL~~A~~L~~~G~~v~V~E~~~   35 (400)
T PRK06475          3 GSILIAGAGVAGLSAALELAARGWAVTIIEKAQ   35 (400)
T ss_pred             CCEEEECCCHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             979998958899999999997899999991799