HHsearch alignment for GI: 254781099 and conserved domain: PRK06598

>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed.
Probab=92.77  E-value=0.55  Score=25.92  Aligned_cols=85  Identities=12%  Similarity=0.072  Sum_probs=51.4

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCC---EEEEEECCCHHHHHHH--HCCCEEECCCCCCCCCCCEEEECCCCCCCCCCCC
Q ss_conf             87999836-8548999999998598---6999818964788999--7898996453157225888998888685675578
Q gi|254781099|r    9 HSIAVFGL-GRSGLSAACALKDSGV---HVIAWDDHPCAVKQAK--DMGIEVIDFREIPWSIISFLVLSPGIALTGENAH   82 (468)
Q Consensus         9 k~v~i~G~-G~sG~s~A~~l~~~G~---~V~~~D~~~~~~~~l~--~~g~~~~~~~~~~~~~~d~vv~Spgi~~~~~~~~   82 (468)
T Consensus         3 ~kVaIvGATG~vG~eli~lL~~~~~p~~~i~~~aS~~s~G~~~~~~~~~~~~~~~~~~~~~~~Di~f~a~~~----~~s~   78 (348)
T PRK06598          3 YNVGVVGATGMVGSVLLQMLEERDFPVIEPVFFASSRSGGKAPSFGGKTLLVDALDIEDLKGLDIALFSAGG----DYSK   78 (348)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCEECCCEEEEEECCHHHHHCCCEEEECCCC----HHHH
T ss_conf             479998984599999999998679996249999875668987506895547862785576079999986882----3568


Q ss_pred             HHHHHHHHCCCEEEE
Q ss_conf             889999976980998
Q gi|254781099|r   83 WCVKLANQFNVEIIG   97 (468)
Q Consensus        83 ~~~~~a~~~gi~v~s   97 (468)
T Consensus        79 ~~~~~~~~~g~~VID   93 (348)
T PRK06598         79 EVAPKLRAAGGVVID   93 (348)
T ss_pred             HHHHHHHHCCCEEEE
T ss_conf             888999758989998