HHsearch alignment for GI: 254781099 and conserved domain: PRK06847

>PRK06847 hypothetical protein; Provisional.
Probab=96.79  E-value=0.0023  Score=42.38  Aligned_cols=36  Identities=31%  Similarity=0.418  Sum_probs=32.5

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCH
Q ss_conf             898799983685489999999985986999818964
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPC   42 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~   42 (468)
T Consensus         3 ~~kkV~IVGaG~aGL~lA~~L~~~Gi~v~V~E~~~~   38 (375)
T PRK06847          3 AVKKVLIVGGGIGGMSAAIALRKAGISVDLVEIDPE   38 (375)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             998799999668999999999967999999908999