HHsearch alignment for GI: 254781099 and conserved domain: PRK07063

>PRK07063 short chain dehydrogenase; Provisional.
Probab=95.71  E-value=0.041  Score=33.68  Aligned_cols=43  Identities=19%  Similarity=0.156  Sum_probs=36.2

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHH
Q ss_conf             13218987999836-85489999999985986999818964788
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVK   45 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~   45 (468)
T Consensus         2 m~rL~gKvalVTGa~~GIG~aiA~~~a~~Ga~V~i~~~~~~~~~   45 (259)
T PRK07063          2 MNRLAGKVALVTGAAQGIGAAIARAFVREGAAVALADLDAALAE   45 (259)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHH
T ss_conf             75359988999587878999999999987998999979878999