HHsearch alignment for GI: 254781099 and conserved domain: PRK07067

>PRK07067 sorbitol dehydrogenase; Provisional.
Probab=95.68  E-value=0.15  Score=29.88  Aligned_cols=46  Identities=20%  Similarity=0.252  Sum_probs=35.4

Q ss_pred             HCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHH-HHCC
Q ss_conf             18987999836-8548999999998598699981896478899-9789
Q gi|254781099|r    6 FRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQA-KDMG   51 (468)
Q Consensus         6 ~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l-~~~g   51 (468)
T Consensus         3 L~gKvalVTGas~GIG~aia~~la~~Ga~V~i~d~~~~~~~~~~~~~g   50 (256)
T PRK07067          3 LQGKVALLTGAASGIGEAVAQRYLREGARVVLADIKPARAALAALEIG   50 (256)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHC
T ss_conf             899889993767789999999999879999999798899999999819