HHsearch alignment for GI: 254781099 and conserved domain: PRK07208

>PRK07208 hypothetical protein; Provisional.
Probab=96.90  E-value=0.0019  Score=42.93  Aligned_cols=35  Identities=31%  Similarity=0.559  Sum_probs=32.4

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             89879998368548999999998598699981896
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
T Consensus         2 ~~kkv~IiGAG~~GL~aA~~L~~~g~~v~vlEk~~   36 (474)
T PRK07208          2 EKKSVVIIGAGPAGLTAAYELVKRGYPVTILEADP   36 (474)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             98759998976899999999986899759997899