HHsearch alignment for GI: 254781099 and conserved domain: PRK07479

>PRK07479 consensus.
Probab=95.07  E-value=0.084  Score=31.55  Aligned_cols=41  Identities=20%  Similarity=0.209  Sum_probs=33.9

Q ss_pred             HCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHH
Q ss_conf             18987999836-854899999999859869998189647889
Q gi|254781099|r    6 FRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQ   46 (468)
Q Consensus         6 ~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~   46 (468)
T Consensus         3 L~gK~alITGgs~GIG~a~a~~la~~G~~V~i~~~~~~~~~~   44 (252)
T PRK07479          3 LSGKVAIVTGAGSGFGEGIAKRFAREGAKVVVADLNAAAAER   44 (252)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHH
T ss_conf             799889993887689999999999879999999798999999