HHsearch alignment for GI: 254781099 and conserved domain: PRK07530

>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated.
Probab=96.43  E-value=0.0088  Score=38.30  Aligned_cols=41  Identities=20%  Similarity=0.264  Sum_probs=34.7

Q ss_pred             CHHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHH
Q ss_conf             1321898799983685489999999985986999818964788
Q gi|254781099|r    3 LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVK   45 (468)
Q Consensus         3 ~~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~   45 (468)
T Consensus         1 M~~i--k~VaViGAG~MG~giA~~~a~~G~~V~l~D~~~e~~~   41 (292)
T PRK07530          1 MMAI--KKVGVIGAGQMGNGIAHVCALAGYDVLLNDVSADRLE   41 (292)
T ss_pred             CCCC--CEEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHH
T ss_conf             9998--8899989669999999999967996899979889999