HHsearch alignment for GI: 254781099 and conserved domain: PRK07531

>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated.
Probab=96.06  E-value=0.02  Score=35.86  Aligned_cols=35  Identities=31%  Similarity=0.308  Sum_probs=32.0

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHH
Q ss_conf             87999836854899999999859869998189647
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCA   43 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~   43 (468)
T Consensus         3 kkVAVIGAGvMGsGwAa~FA~aG~~V~L~Dp~peA   37 (489)
T PRK07531          3 MKAACIGGGVIGGGWAARFLLNGWDVAVFDPHPEA   37 (489)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHH
T ss_conf             67999871886899999999579969999488789