HHsearch alignment for GI: 254781099 and conserved domain: PRK08063

>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional.
Probab=93.57  E-value=0.59  Score=25.72  Aligned_cols=49  Identities=16%  Similarity=0.191  Sum_probs=35.7

Q ss_pred             HCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCC-H----HHHHHHHCCCEE
Q ss_conf             18987999836-8548999999998598699981896-4----788999789899
Q gi|254781099|r    6 FRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHP-C----AVKQAKDMGIEV   54 (468)
Q Consensus         6 ~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~-~----~~~~l~~~g~~~   54 (468)
T Consensus         2 L~gKvalVTGas~GIG~aia~~la~~Ga~Vvi~~~~~~~~~~~~~~~~~~~g~~~   56 (250)
T PRK08063          2 FSGKVALVTGSSRGIGKAIALRLAKEGYDIAINYARSRKAAEETANEIEQLGRKA   56 (250)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCE
T ss_conf             8949899958766999999999998899899975999899999999999549958