HHsearch alignment for GI: 254781099 and conserved domain: PRK08132

>PRK08132 hypothetical protein; Provisional.
Probab=93.92  E-value=0.1  Score=30.90  Aligned_cols=32  Identities=38%  Similarity=0.584  Sum_probs=29.5

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             79998368548999999998598699981896
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
T Consensus        25 pVlIVGaGPvGL~lA~~L~~~Gv~~~vvEr~~   56 (549)
T PRK08132         25 PVVVVGAGPVGLALAIDLAQQGVPVVLLDDDD   56 (549)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             99999925799999999998799999995999