HHsearch alignment for GI: 254781099 and conserved domain: PRK08265

>PRK08265 short chain dehydrogenase; Provisional.
Probab=96.09  E-value=0.022  Score=35.63  Aligned_cols=47  Identities=19%  Similarity=0.087  Sum_probs=38.4

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHH
Q ss_conf             13218987999836-854899999999859869998189647889997
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAKD   49 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~   49 (468)
T Consensus         1 M~~L~gKvalVTGgs~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~   48 (261)
T PRK08265          1 MIGLAGKVAIVTGGATLIGAAVARALVAAGACVAILDIDADNGAAVAA   48 (261)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH
T ss_conf             989999989994877689999999999879989999798899999999