HHsearch alignment for GI: 254781099 and conserved domain: PRK08339

>PRK08339 short chain dehydrogenase; Provisional.
Probab=96.07  E-value=0.023  Score=35.45  Aligned_cols=45  Identities=18%  Similarity=0.225  Sum_probs=36.8

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHH
Q ss_conf             9813218987999836-854899999999859869998189647889
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQ   46 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~   46 (468)
T Consensus         2 m~l-~L~gK~alITG~s~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~   47 (263)
T PRK08339          2 LKI-DLSGKLAFTTASSKGIGFGVARVLARAGADVIILSRNEENLKR   47 (263)
T ss_pred             CCC-CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHH
T ss_conf             741-7899989991626099999999999869999999798899999