HHsearch alignment for GI: 254781099 and conserved domain: PRK08993

>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated.
Probab=96.72  E-value=0.014  Score=37.02  Aligned_cols=54  Identities=17%  Similarity=0.240  Sum_probs=40.4

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCC--HHHHHHHHCCCEE
Q ss_conf             9813218987999836-8548999999998598699981896--4788999789899
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHP--CAVKQAKDMGIEV   54 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~--~~~~~l~~~g~~~   54 (468)
T Consensus         3 ~~~~~L~gK~alITGas~GIG~aia~~la~~Ga~Vv~~~~~~~~~~~~~~~~~~~~~   59 (253)
T PRK08993          3 LDAFSLEGKVAVVTGCDTGLGQGMALGLAEAGCDIVGINIVEPTETIEQVTALGRRF   59 (253)
T ss_pred             CCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHCCCCE
T ss_conf             766399999899938876899999999998799999955877499999999659957