HHsearch alignment for GI: 254781099 and conserved domain: PRK11749

>PRK11749 putative oxidoreductase; Provisional.
Probab=97.73  E-value=0.00027  Score=48.79  Aligned_cols=36  Identities=31%  Similarity=0.482  Sum_probs=33.2

Q ss_pred             HCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             189879998368548999999998598699981896
Q gi|254781099|r    6 FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         6 ~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
T Consensus       138 ~~gkkVAIIGaGPAGLsAA~~Lar~G~~VtVfE~~~  173 (460)
T PRK11749        138 KTGKKVAVIGAGPAGLTAAHRLARKGYDVTIFEARD  173 (460)
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             789989998967899999999997698479970478