HHsearch alignment for GI: 254781099 and conserved domain: PRK12490

>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed.
Probab=97.46  E-value=0.0014  Score=43.90  Aligned_cols=110  Identities=22%  Similarity=0.264  Sum_probs=72.1

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECCCCCCC---CCCCEEEECCCCCCCCCCCCHHHH
Q ss_conf             79998368548999999998598699981896478899978989964531572---258889988886856755788899
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPW---SIISFLVLSPGIALTGENAHWCVK   86 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~~~~~~---~~~d~vv~Spgi~~~~~~~~~~~~   86 (468)
T Consensus         2 kIGfIGLG~MG~~mA~nL~~~G~~V~v~d~~~~~~~~~~~~g~~~~~s~~e~~~~l~~~~vI~~~--vp~-g~~----v~   74 (298)
T PRK12490          2 KLGLIGLGKMGGNMAERLREDGHEVVGYDVNQEAVDVAGKLGITARHSLEELVSKLEAPRAIWVM--VPA-GEV----TE   74 (298)
T ss_pred             EEEEECHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCEECCCHHHHHHHCCCCCEEEEE--CCC-CHH----HH
T ss_conf             79998346768999999997799489984998999999986995428999999737899889997--689-455----99


Q ss_pred             HHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             9997698099830342233430156886899603457521578999999873100
Q gi|254781099|r   87 LANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYD  141 (468)
Q Consensus        87 ~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~  141 (468)
T Consensus        75 ~vi~-------~--l~-----~~L~~g~-iiID~sts~~~~t~~~~~~l~~~gi~  114 (298)
T PRK12490         75 SVLK-------D--LY-----PLLSPGD-IVIDGGNSRYKDDLRRAEELAERGIH  114 (298)
T ss_pred             HHHH-------H--HH-----HHCCCCC-EEECCCCCCHHHHHHHHHHHHHCCCC
T ss_conf             9999-------6--88-----5269998-88528878999999999999975990