HHsearch alignment for GI: 254781099 and conserved domain: PRK12726

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional.
Probab=91.78  E-value=0.27  Score=28.03  Aligned_cols=54  Identities=19%  Similarity=0.162  Sum_probs=0.0

Q ss_pred             HHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCC--CCCHHHHHHHHHHHHHHHHCCCC
Q ss_conf             8899999769809983034223343015688689960345--75215789999998731000000
Q gi|254781099|r   83 WCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTN--GKSSTVALISHVLRKNGYDVQLG  145 (468)
Q Consensus        83 ~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~--GKTTt~~ll~~iL~~~g~~~~~~  145 (468)
T Consensus       185 ~~~~~~~~~~~~~---------~~~~~l~~g~VIaLVGvnGvGKTTTiAKLA~~l~~~gkkV~LV  240 (407)
T PRK12726        185 DWFVPYLSGKLAV---------EDSFDLSNHRIISLIGQTGVGKTTTLVKLGWQLLKQNRTVGFI  240 (407)
T ss_pred             HHHHHHHCCCCCC---------CCEEEECCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             8999975389770---------3202303690899989998978999999999999779917999