HHsearch alignment for GI: 254781099 and conserved domain: PRK12744

>PRK12744 short chain dehydrogenase; Provisional.
Probab=96.40  E-value=0.061  Score=32.51  Aligned_cols=77  Identities=18%  Similarity=0.233  Sum_probs=48.2

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCH--------HHHHHHHCCCEEECCC----C--------
Q ss_conf             9813218987999836-85489999999985986999818964--------7889997898996453----1--------
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPC--------AVKQAKDMGIEVIDFR----E--------   59 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~--------~~~~l~~~g~~~~~~~----~--------   59 (468)
T Consensus         1 m~~~~L~gKvalVTGgs~GIG~aiA~~la~~Ga~vv~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~~   80 (257)
T PRK12744          1 MADHSLKGKVVLIAGGAKNLGGLIARDLAAQGAKAVAIHYNSAATKADAEETVAAVKAAGAKAVAFQADLTTAAAVEKLF   80 (257)
T ss_pred             CCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHH
T ss_conf             99999899989992887589999999999879989999378743689999999999973992899976889999999999


Q ss_pred             ----CCCCCCCEEEECCCCCCC
Q ss_conf             ----572258889988886856
Q gi|254781099|r   60 ----IPWSIISFLVLSPGIALT   77 (468)
Q Consensus        60 ----~~~~~~d~vv~Spgi~~~   77 (468)
T Consensus        81 ~~~~~~~G~iDilVnnAG~~~~  102 (257)
T PRK12744         81 DDAKAAFGRPDIAINTVGKVLK  102 (257)
T ss_pred             HHHHHHCCCCCEEEECCCCCCC
T ss_conf             9999980998899976644567