HHsearch alignment for GI: 254781099 and conserved domain: PRK12769

>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed.
Probab=97.82  E-value=0.00017  Score=50.15  Aligned_cols=68  Identities=26%  Similarity=0.393  Sum_probs=50.4

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCH---------------------HHHHHHHCCCEEECC----CCC-
Q ss_conf             898799983685489999999985986999818964---------------------788999789899645----315-
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPC---------------------AVKQAKDMGIEVIDF----REI-   60 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~---------------------~~~~l~~~g~~~~~~----~~~-   60 (468)
T Consensus       326 tGKkVAIIGsGPAGLsaA~~Lar~G~~VTVFE~~~~~GGlL~yGIP~fRLpk~vv~~ei~~l~~lGV~f~~n~~VGkDit  405 (654)
T PRK12769        326 SDKRVAIIGAGPAGLACADVLTRNGVAVTVYDRHPEIGGLLTFGIPAFKLDKSLLARRREIFSAMGIHFELNCEVGKDIS  405 (654)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCEEECCCEECCCCC
T ss_conf             89989998977899999999997697579952577788667524862227789999999999826988983717687658


Q ss_pred             ---CCCCCCEEEECCCC
Q ss_conf             ---72258889988886
Q gi|254781099|r   61 ---PWSIISFLVLSPGI   74 (468)
Q Consensus        61 ---~~~~~d~vv~Spgi   74 (468)
T Consensus       406 l~eL~~~yDAVfla~Ga  422 (654)
T PRK12769        406 LESLLEDYDAVFVGVGT  422 (654)
T ss_pred             HHHHHHCCCEEEEECCC
T ss_conf             99997369989995178