HHsearch alignment for GI: 254781099 and conserved domain: PRK12775

>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional.
Probab=97.56  E-value=0.00069  Score=45.94  Aligned_cols=69  Identities=20%  Similarity=0.352  Sum_probs=51.8

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC---------------------HHHHHHHHCCCEEECCC----C--
Q ss_conf             89879998368548999999998598699981896---------------------47889997898996453----1--
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP---------------------CAVKQAKDMGIEVIDFR----E--   59 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~---------------------~~~~~l~~~g~~~~~~~----~--   59 (468)
T Consensus       431 ~~gKVAVIGsGPAGLs~A~~Lar~G~~VTVfEal~~~GGvL~YGIPeFRLPK~IV~~EI~~l~~lGVef~~n~~VGkdit  510 (993)
T PRK12775        431 KIGKVAIVGSGPAGLAAAADLTRYGVETTVYEALHVLGGVLQYGIPSFRLPRDIIDREIQRLKDIGVKFETNKVVGKTFT  510 (993)
T ss_pred             CCCCEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHCCEEEECCCEECCCCC
T ss_conf             89808997837889999999997799648971688899726843777678889999999999878949983888656078


Q ss_pred             ---CC-CCCCCEEEECCCCC
Q ss_conf             ---57-22588899888868
Q gi|254781099|r   60 ---IP-WSIISFLVLSPGIA   75 (468)
Q Consensus        60 ---~~-~~~~d~vv~Spgi~   75 (468)
T Consensus       511 l~eL~~e~gyDAVFIg~GA~  530 (993)
T PRK12775        511 IPQLMNDRGFDAVFVAAGAG  530 (993)
T ss_pred             HHHHHHCCCCCEEEEECCCC
T ss_conf             99995345989899955878