HHsearch alignment for GI: 254781099 and conserved domain: PRK12826

>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed.
Probab=97.23  E-value=0.0035  Score=41.10  Aligned_cols=52  Identities=19%  Similarity=0.158  Sum_probs=40.8

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHH----HHHHHCCCEE
Q ss_conf             13218987999836-8548999999998598699981896478----8999789899
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAV----KQAKDMGIEV   54 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~----~~l~~~g~~~   54 (468)
T Consensus         1 M~~L~gK~alITGgs~GIG~aia~~la~~G~~V~~~~r~~~~~~~~~~~l~~~g~~~   57 (253)
T PRK12826          1 MRDLMGRVALVTGAARGIGRAIAVRFAADGADVIVVDICGQAAAATAELVAAAGGKA   57 (253)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCE
T ss_conf             998899889994897789999999999879989999898899999999998509958