HHsearch alignment for GI: 254781099 and conserved domain: PTZ00325

>PTZ00325 malate dehydrogenase; Provisional.
Probab=95.23  E-value=0.23  Score=28.47  Aligned_cols=123  Identities=18%  Similarity=0.124  Sum_probs=63.1

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCC--EEEEEECCCHHHH--HHHHCCCE----EECCC--CCCCCCCCEEEECCCCCCC
Q ss_conf             87999836-8548999999998598--6999818964788--99978989----96453--1572258889988886856
Q gi|254781099|r    9 HSIAVFGL-GRSGLSAACALKDSGV--HVIAWDDHPCAVK--QAKDMGIE----VIDFR--EIPWSIISFLVLSPGIALT   77 (468)
Q Consensus         9 k~v~i~G~-G~sG~s~A~~l~~~G~--~V~~~D~~~~~~~--~l~~~g~~----~~~~~--~~~~~~~d~vv~Spgi~~~   77 (468)
T Consensus         2 ~KV~IIGA~G~VG~s~A~~l~~~~~~~elvL~Di~~a~g~a~Dl~~~~~~~~~~~~~~~~~~e~~~~aDIVVitaG~~rk   81 (313)
T PTZ00325          2 FKVAVLGAAGGIGQPLSLLLKRNPYVSTLSLYDIVGAPGVAADLSHIPSPAKVTGYAKGELHKAVDGADVVLIVAGVPRK   81 (313)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHCCCCCCCCCEECCCCHHHHHCCCCEEEECCCCCCC
T ss_conf             38999899986999999999838997779998089726689888675553566545279888984899899988898899


Q ss_pred             CCCCCHHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             75578889999976980998303422334301568868996034575215789999998731
Q gi|254781099|r   78 GENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNG  139 (468)
Q Consensus        78 ~~~~~~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g  139 (468)
T Consensus        82 pg~tR~dL---l~~N~~I~~~i--~~~i~-~~~~~a--iiivvtNPvD~mt~i~~~~~~~~~  135 (313)
T PTZ00325         82 PGMTRDDL---FNTNAGIVRDL--VLACA-SSAPKA--IFGIITNPVNSTVPIAAETLKKAG  135 (313)
T ss_pred             CCCCHHHH---HHHHHHHHHHH--HHHHH-HHCCCE--EEEECCCCHHHHHHHHHHHHHHCC
T ss_conf             78968999---99706999999--99999-769980--999736824799999999999747