HHsearch alignment for GI: 254781099 and conserved domain: TIGR03649

>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family. This family consists of fungal proteins of unknown function associated with secondary metabolite biosynthesis, such as of the ergot alkaloids such as ergovaline. Nomenclature differs because gene order differs - this is EasG in Neotyphodium lolii but is designated ergot alkaloid biosynthetic protein A in several other fungi.
Probab=94.95  E-value=0.061  Score=32.50  Aligned_cols=87  Identities=15%  Similarity=0.127  Sum_probs=52.3

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECCCCCC----C-------CCCCEEE-ECCCCCC
Q ss_conf             7999836-854899999999859869998189647889997898996453157----2-------2588899-8888685
Q gi|254781099|r   10 SIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP----W-------SIISFLV-LSPGIAL   76 (468)
Q Consensus        10 ~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~~~~~----~-------~~~d~vv-~Spgi~~   76 (468)
T Consensus         1 TIlVtGATG~iG~~v~~~L~~~g~~v~~~~R~~~~~~~~~~~~v~~d~~d~~~~~~a~~~~d~~~~~v~~v~l~~p~~~~   80 (285)
T TIGR03649         1 TILLTGGTGKTASRIARLLQAASVPFLVASRSSSSSAGPNEKHVKFDWLDEDTWDNPFSSDDGMEPEISAVYLVAPPIPD   80 (285)
T ss_pred             CEEEECCCCHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCC
T ss_conf             98999899818999999998689978999588566466667536864448114888976353231274189983899877


Q ss_pred             CCCCCCHHHHHHHHCCCEEE
Q ss_conf             67557888999997698099
Q gi|254781099|r   77 TGENAHWCVKLANQFNVEII   96 (468)
Q Consensus        77 ~~~~~~~~~~~a~~~gi~v~   96 (468)
T Consensus        81 ~~~~~~~~i~aA~~aGV~~i  100 (285)
T TIGR03649        81 LAPPMIKFIDFARSKGVRRF  100 (285)
T ss_pred             HHHHHHHHHHHHHHCCCCEE
T ss_conf             67899999999998499889