HHsearch alignment for GI: 254781099 and conserved domain: cd01337

>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. Members of this subfamily are localized to the glycosome and mitochondria. MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=94.86  E-value=0.32  Score=27.50  Aligned_cols=69  Identities=16%  Similarity=0.123  Sum_probs=44.4

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCC--EEEEEECCCHHHHH--HHHC----CCEEECCCC---CCCCCCCEEEECCCCCCC
Q ss_conf             7999836-8548999999998598--69998189647889--9978----989964531---572258889988886856
Q gi|254781099|r   10 SIAVFGL-GRSGLSAACALKDSGV--HVIAWDDHPCAVKQ--AKDM----GIEVIDFRE---IPWSIISFLVLSPGIALT   77 (468)
Q Consensus        10 ~v~i~G~-G~sG~s~A~~l~~~G~--~V~~~D~~~~~~~~--l~~~----g~~~~~~~~---~~~~~~d~vv~Spgi~~~   77 (468)
T Consensus         2 KV~IIGA~G~VG~~~A~~l~~~~~~~elvLiDi~~~~g~a~DL~h~~~~~~v~~~~~~~~~~~~l~daDiVVitAG~~rk   81 (310)
T cd01337           2 KVAVLGAAGGIGQPLSLLLKLNPLVSELALYDIVNTPGVAADLSHINTPAKVTGYLGPEELKKALKGADVVVIPAGVPRK   81 (310)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHCCCCCCCEEEEECCCCHHHHHCCCCEEEECCCCCCC
T ss_conf             89999999818999999997299977699982774266755321656568512570887466774799999987898899


Q ss_pred             C
Q ss_conf             7
Q gi|254781099|r   78 G   78 (468)
Q Consensus        78 ~   78 (468)
T Consensus        82 p   82 (310)
T cd01337          82 P   82 (310)
T ss_pred             C
T ss_conf             7